3NQJB

Crystal structure of (cenp-a/h4)2 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nqjB00
1M19A 3VH6W 4CAYA 1P3FC 2YFWB 5B2JC 3WAAB 3W99D 3AV2C 1M1AC 3B6FD 1P3KA 3MGSD 5AV8D 5AV5B 5BNVB 4Z5TC 5CPJD 1P3FA 5GT3D 5B32C 5B2JA 3X1TC 1M1AA 3AV2A 5B1LC 4Z5TA 1BH9B 1KX3B 5B32A 3X1TA 3KSYA 5BNXA 3C1CB 4J8UD 3WA9C 2F8NH 1S32B 3MNNC 1F66D 2F8NB 4ZBJC 4XZQC 5GT0D 3AZGB 5E5AC 3WA9A 3AZHC 4ZUXC 4R8PB 3MNNA 3TU4D 3AYWB 3VH5A 5B0YC 1M18D 3REHD 3MGRC 4XZQA 3NQJA 4Z66C 5E5AA 3MVDD 3AZHA 4ZUXA 4J8XC 5B0YA 3AZJC 3MGRA 4H9OB 4G91B 4Z66A 1P3AC 5AV6D 5AV9C 4J8XA 5GSUC 1P3AA 3REIC 3AN2C 2NZDC 3C1BD 1P3MC 1Q9CA 5AVBC 4WU9D 5GSUA 3REIA 2NZDA 5C3IB 3W99A 5AY8C 4XUJD 1P3MA 5AVBA 4NE6A 1JFIB 5B2IC 1WWSA 5AY8A 5B31G 4KUDC 5DNMB 4HGAB 5CP6D 5B2IA 3KWQD 5B24C 3AZFD 3AZID 4KUDA 3B0DB 4JJNC 5B24A 1P3BC 3MGRB 2PYOB 3WAAD 5B33B 2YFVA 1AOID 4WU8C 3X1SD 4JJNA 1U35D 3AFAC 1P3BA 1P3LC 3KUYB 2CV5D 1HQ3D 4WU8A 3W96C 3AFAA 1P3LA 3MGPD 3UT9C 3UTBD 3B6FB 3W99B 3MGSB 5AV8B 3W96A 5FUGB 1N1JB 5B32G 5CPJB 3UT9A 4X23D 3W97D 5CPKD 4Z2MG 1KX5C 3KXBD 3AZNC 3LZ1C 5G49A 3AV1C 1H3OB 1TZYD 4YM6C 3X1VD 4J8UB 3AZNA 1KX4C 3AV1A 4YM6A 1M19D 4J8VC 5GT0B 2YFVB 1P3KD 3TU4B 4JJNB 1P3BB 1M18B 3KWQA 3REHB 4LD9C 4J8VA 1P3FD 3B6GC 5B2JD 4WZSB 1EQZC 1M1AD 3AV2D 3MVDB 4Z5TD 1P34C 5B32D 3B6GA 1EQZA 3VH6T 3X1TD 5B1MC 3AZLC 5B1LD 5AV6B 1U35A 1P34A 3AZMC 5B1MA 3C1BB 2AROC 3WA9D 3MNND 3AZMA 1WWIA 4XZQD 4XUJB 5E5AD 5B31A 2AROA 3AZHD 4ZUXD 5B0YD 3WTPE 3MGRD 4UUZB 4Z66D 5CP6B 4J8XD 3KWQB 3AZFB 3AZIB 2BYMB 3AZJD 1P3AD 5GXQC 3X1UC 5AV9D 3NQUB 4H9NA 3LELC 5GSUD 3REID 3AN2D 2NZDD 3X1UA 1AOIB 1P3GC 3X1SB 1U35B 1P3MD 5AVBD 4E44A 3RELC 2CV5B 2IO5C 3O62C 5AY8D 1HQ3B 1P3GA 2HUEB 3MGPB 3AZMB 4WNNB 3RELA 1BH8A 3R45B 1TAFB 5B2ID 3UTBB 5B1LA 3REKC 4KUDD 5B31B 4G92B 4X23B 3W97B 2FJ7C 5CPKB 1HTAA 5B24D 3REKA 3KXBB 3MGQC 2FJ7A 4JJND 1TZYB 1P3BD 4J8WC 3X1VB 4H9QA 4WU8D 1ZLAC 3AFAD 1M19B 1P3LD 4CSRA 4CAYB 3REJC 4J8WA 5B0ZC 1P3KB 4KGCC 3UTAC 1ZLAA 3W96D 3REJA 3UT9D 3AZJA 1P3FB 5B2JB 1M1AB 5B0ZA 3AV2B 5AV9A 3UTAA 4KGCA 4Z5TB 2F8NK 4H9SC 5B32B 3LZ0C 3AN2A 3X1TB 5B1LB 1KX5D 1ULYA 2JSSA 4H9SA 2BYKA 5BNXB 3AZND 3LZ0A 3LZ1D 3AV1D 4YM6D 3WA9B 2FJ7B 3MNNB 1KX4D 1P3IC 3VH5W 3LJAC 4ZBJB 4J8VD 4XZQB 3NQJB 5E5AB 3AZHB 4ZUXB 1P3IA 2CWEA 5B0YB 4LD9D 3LJAA 3B6GD 4Z66B 1EQZD 1P3OC 4J8XB 4QLCC 3AZJB 1P34D 1P3AB 5F99C 4AWLC 5B1MD 3WTPC 3AZLD 5AV9B 1P3OA 5DNNC 5CPIC 4QLCA 5GSUB 3REIB 5F99A 3AZMD 3AN2B 5KDMA 2NZDB 5DNNA 5CPIA 1P3MB 2BYKB 5AVBB 5B31D 2AROD 5BO0A 5AY8B 3B0CW 1R4VA 2HIOC 1P3PC 5B2IB 1A7WA 1KX5A 2HIOA 4KUDB 4YS3C 1P3PA 5AVCC 3LZ1A 5B24B 4E45A 5B40C 5GXQD 3X1UD 1ID3C 4H9PA 5AVCA 1KX4A 5B40A 3AZKC 1ID3A 4KHAA 4WU8B 4WU9C 1P3GD 3AFAB 3WKJC 4LD9A 5JA4A 1P3LB 3RELD 3AZKA 3O62D 3W96B 3WKJA 3UT9B 5BO0B 3AZEC 3AZLA 3REKD 3V9RA 2FJ7D 5G49B 3AZEA 1KX5B 4WV4B 3AZNB 3MGQD 3LZ1B 4EO5C 3AV1B 4YM6B 4J8WD 4H9RA 5AV5C 3VH6A 1KX4B 1ZLAD 3REJD 4J8VB 5B0ZD 5BNVA 4KGCD 3UTAD 1KX3C 4LD9B 2RVQC 3B6GB 1EQZB 5GXQA 1BH9A 3C1CC 1BFMA 1KX3A 1S32C 3LELA 1P34B 3LZ0D 5B1MB 3AZLB 3AZGC 3C1CA 4M6BA 1S32A 4R8PC 3AYWC 2F8NA 5BS7C 3O62A 3AZGA 4R8PA 3AYWA 2AROB 1P3ID 4G91C 5BS7A 3LJAD 2NQBC 4EO5B 4H9OA 2NQBA 3W98C 3VH5T 1P3OD 3MGQA 4H9NB 4QLCD 3W98A 5C3IC 5F99D 3A6NC 5GXQB 3X1UB 3WTPD 5DNND 5JRGC 5CPID 3LELB 3A6NA 4NE3A 5DNMC 4HGAC 5JRGA 1P3GB 5BT1C 1JFIA 3RELB 1BH8B 2IO5B 4Z2MH 3O62B 5DNMA 2HIOD 3B0DC 1P3PD 2PYOC 3REKB 5B33C 3B0CT 4YS3D 5AVCD 2NQBB 3KUYC 2PYOA 5B40D 5B33A 1B67A 1ID3D 3MGQB 4H9QB 3W98B 3KUYA 3W99C 4CSRB 3B6FC 4J8WB 3MGSC 5AV8C 3AZKD 5CPJC 1ZLAB 5GT3C 3WKJD 3REJB 3B6FA 3A6NB 3MGSA 5AV8A 5B0ZB 5FUGA 5JRGB 1N1JA 3UTAB 5CPJA 4KGCB 5GT3A 3AZED 3WTPA 4J8UC 2F8NG 1F66C 1H3OA 3LZ0B 4DRAA 1KU5A 5GT0C 4J8UA 4NFTA 3TU4C 1F66A 1M18C 5CHLB 3REHC 2LY8A 5GT0A 2L5AA 3MVDC 3TU4A 1B6WA 5AV5D 1M18A 3REHA 1P3IB 3LJAB 3B0BA 3MVDA 5AV6C 4YS3A 1KX3D 2RVQD 3LELD 5AV6A 3C1BC 1P3OB 3C1CD 5GT3B 4QLCB 1S32D 4DRBA 2F8ND 5F99B 4AWLB 5KDMB 3WTPB 4XUJC 3C1BA 3AZGD 5DNNB 4WU9A 5CPIB 4R8PD 3AYWD 4XUJA 5CP6C 1F66B 3KWQC 3AZFC 3AZIC 4UUZA 1F1EA 2NQBD 2HIOB 5CP6A 1P3PB 3AZFA 3AZIA 2BYMA 3W98D 3WAAC 3NQUA 1AOIC 4YS3B 3X1SC 1U35C 4H9PB 5AVCB 2YFWA 2CV5C 3WAAA 5B40B 3A6ND 1AOIA 1HQ3C 1ID3B 4KHAB 5AV5A 3X1SA 5JRGD 2HUEC 3MGPC 3UTBC 5JA4B 2CV5A 3AZKB 1HQ3A 5B31C 5DNMD 4G92C 3MGPA 4WU9B 4X23C 4WNNA 3W97C 3R45A 5BT1D 1TAFA 3UTBA 5CPKC 3WKJB 3KXBC 4X23A 3W97A 3V9RB 5CPKA 1TZYC 3AZEB 2PYOD 3X1VC 3KXBA 5B33D 4NE5A 1TZYA 1M19C 3KUYD 3X1VA 1P3KC 4H9RB
chains in the Genus database with same CATH superfamily
1M19A 3VH6W 4CAYA 1P3FC 2YFWB 5B2JC 3WAAB 3W99D 3AV2C 1M1AC 3B6FD 1P3KA 3MGSD 5AV8D 5AV5B 5BNVB 4Z5TC 5CPJD 1P3FA 5GT3D 5B32C 5B2JA 3EPJA 3X1TC 1M1AA 3AV2A 5B1LC 2Y2OA 4Z5TA 1BH9B 1KX3B 5B32A 3FDDA 3X1TA 3KSYA 5BNXA 3C1CB 4J8UD 3WA9C 2F8NH 1S32B 3MNNC 1F66D 2F8NB 4ZBJC 4XZQC 5GT0D 3AZGB 5E5AC 3WA9A 3AZHC 4ZUXC 4R8PB 3MNNA 3TU4D 3AYWB 3VH5A 5B0YC 1M18D 3REHD 3MGRC 4XZQA 3NQJA 4Z66C 5E5AA 3MVDD 3AZHA 4ZUXA 4J8XC 5B0YA 3AZJC 3MGRA 4H9OB 4G91B 4Z66A 1P3AC 5AV6D 5AV9C 4J8XA 5GSUC 1P3AA 2RIQA 3REIC 3AN2C 2NZDC 3C1BD 1P3MC 1Q9CA 5AVBC 4WU9D 5GSUA 3REIA 2NZDA 5C3IB 3W99A 5AY8C 4XUJD 1P3MA 5AVBA 4NE6A 1JFIB 5B2IC 1WWSA 5AY8A 5B31G 4KUDC 5DNMB 4HGAB 5CP6D 5B2IA 3KWQD 5B24C 3AZFD 3AZID 4KUDA 3B0DB 4JJNC 5B24A 1P3BC 3MGRB 2PYOB 3WAAD 5B33B 2YFVA 1AOID 4WU8C 3X1SD 4JJNA 1U35D 3AFAC 1P3BA 1P3LC 4UPKA 3KUYB 2CV5D 1HQ3D 4WU8A 3W96C 3EPHA 3AFAA 1P3LA 3MGPD 3UT9C 3UTBD 3B6FB 3W99B 3MGSB 5AV8B 3W96A 5FUGB 1N1JB 5B32G 5CPJB 3UT9A 4X23D 3W97D 5CPKD 4Z2MG 1KX5C 3KXBD 3AZNC 3LZ1C 5G49A 3AV1C 1H3OB 1TZYD 4YM6C 3X1VD 4J8UB 3AZNA 1KX4C 3AV1A 4YM6A 1M19D 4J8VC 5GT0B 2YFVB 1P3KD 3TU4B 4JJNB 1P3BB 1M18B 3KWQA 3REHB 4LD9C 4J8VA 1P3FD 3B6GC 5B2JD 4WZSB 1EQZC 1M1AD 3AV2D 3MVDB 4Z5TD 1P34C 5B32D 3B6GA 1EQZA 3VH6T 3X1TD 5B1MC 3AZLC 5B1LD 5AV6B 2Y2JA 1U35A 1P34A 3AZMC 2DQNC 5B1MA 3C1BB 2AROC 3WA9D 3MNND 3AZMA 1WWIA 4XZQD 4XUJB 3H0RC 5E5AD 5B31A 2AROA 3AZHD 4ZUXD 5B0YD 3WTPE 3MGRD 4UUZB 4Z66D 5CP6B 4J8XD 3KWQB 3AZFB 3AZIB 2BYMB 3AZJD 1P3AD 5GXQC 3X1UC 2XD1A 5AV9D 3NQUB 4H9NA 3LELC 5GSUD 3REID 3AN2D 2NZDD 3X1UA 1AOIB 1P3GC 3X1SB 1U35B 1P3MD 5AVBD 4E44A 3RELC 2CV5B 2IO5C 3O62C 5AY8D 1HQ3B 1P3GA 2HUEB 3MGPB 3AZMB 4WNNB 3RELA 1BH8A 3R45B 1TAFB 5B2ID 3UTBB 5B1LA 3A1IA 3REKC 4KUDD 5B31B 4G92B 4X23B 2Y2IA 3W97B 2FJ7C 5CPKB 1HTAA 5B24D 3H0MC 3REKA 3KXBB 3MGQC 2FJ7A 4JJND 1TZYB 1P3BD 4J8WC 3X1VB 3H0LC 4H9QA 4WU8D 1ZLAC 3AFAD 1M19B 1P3LD 4CSRA 4CAYB 3REJC 4J8WA 5B0ZC 1P3KB 4KGCC 3UTAC 1ZLAA 3W96D 3EPLA 3REJA 3UT9D 3AZJA 1P3FB 5B2JB 1M1AB 5B0ZA 3AV2B 5AV9A 3UTAA 4KGCA 4Z5TB 2F8NK 4H9SC 5B32B 3LZ0C 3AN2A 3X1TB 5B1LB 2Y2KA 1KX5D 1ULYA 2JSSA 4H9SA 2BYKA 3A1KA 5BNXB 3AZND 3LZ0A 3LZ1D 3AV1D 4YM6D 4WJ3C 3WA9B 2FJ7B 3MNNB 1KX4D 1P3IC 3VH5W 3LJAC 4ZBJB 4J8VD 3EG5B 3NQJB 4XZQB 5E5AB 3AZHB 4ZUXB 1P3IA 2CWEA 5B0YB 4LD9D 3LJAA 3B6GD 4Z66B 1EQZD 1P3OC 4J8XB 1T3UA 4QLCC 3AZJB 1P34D 1P3AB 5F99C 4AWLC 5B1MD 3WTPC 3AZLD 2Y2HA 5AV9B 1P3OA 5DNNC 5CPIC 4QLCA 2Y2MA 5GSUB 3REIB 5F99A 3AZMD 3AN2B 5KDMA 2NZDB 5DNNA 5CPIA 1P3MB 2BYKB 5AVBB 5B31D 2AROD 5BO0A 5AY8B 3B0CW 1R4VA 2HIOC 1P3PC 2ZY5A 2Y2GA 5B2IB 1A7WA 2JCHA 2HIOA 1KX5A 3AL0C 4KUDB 4YS3C 1P3PA 5AVCC 3LZ1A 5B24B 2G5HC 4E45A 5B40C 5GXQD 3X1UD 1ID3C 4H9PA 5AVCA 1KX4A 5B40A 3AZKC 1ID3A 4KHAA 4WU8B 4WU9C 1P3GD 3AFAB 3WKJC 4LD9A 2G5IC 5JA4A 1P3LB 3RELD 3AZKA 3O62D 3W96B 3WKJA 3UT9B 5BO0B 3AZEC 3AZLA 2ZY2A 3REKD 3V9RA 2FJ7D 5G49B 3AZEA 1PZRA 1KX5B 4WV4B 3AZNB 3MGQD 3LZ1B 2VQRA 4EO5C 3AV1B 4YM6B 4J8WD 4H9RA 5AV5C 3VH6A 1KX4B 1ZLAD 3REJD 2F2AC 4J8VB 5B0ZD 5BNVA 4KGCD 3UTAD 1KX3C 4LD9B 2RVQC 3B6GB 1EQZB 5GXQA 1BH9A 3C1CC 1BFMA 1KX3A 1S32C 2J8PA 3LELA 1P34B 3LZ0D 5B1MB 3AZLB 3AZGC 3C1CA 4M6BA 1S32A 4R8PC 3AYWC 2F8NA 5BS7C 3O62A 3AZGA 4R8PA 3AYWA 2AROB 1P3ID 1P3KC 5BS7A 4G91C 3LJAD 2NQBC 4EO5B 4H9OA 2NQBA 3W98C 3VH5T 1P3OD 3MGQA 4H9NB 4QLCD 3W98A 5C3IC 5F99D 3A6NC 5GXQB 3X1UB 3WTPD 2DF4C 2Y2LA 2Y2QA 5DNND 5JRGC 5CPID 3LELB 3A6NA 4NE3A 5DNMC 4HGAC 5JRGA 1P3GB 5BT1C 1JFIA 3RELB 1BH8B 2IO5B 4Z2MH 3O62B 5DNMA 2HIOD 3B0DC 1P3PD 2XD5A 1Z2CB 2PYOC 3REKB 5B33C 3B0CT 4YS3D 5AVCD 2NQBB 3KUYC 2PYOA 5B40D 5B33A 1B67A 2Y2NA 1ID3D 3MGQB 4H9QB 3W98B 3KUYA 3W99C 4CSRB 3B6FC 4J8WB 3MGSC 5AV8C 3AZKD 2BG1A 2ZY4A 5CPJC 1ZLAB 5GT3C 3WKJD 2JE5A 3REJB 3A6NB 3B6FA 3MGSA 5AV8A 5B0ZB 5FUGA 5JRGB 1N1JA 3UTAB 5CPJA 4KGCB 5GT3A 3AZED 3WTPA 3F6TA 4J8UC 2F8NG 1F66C 1H3OA 3LZ0B 4DRAA 1KU5A 5GT0C 4J8UA 4NFTA 3TU4C 1F66A 1M18C 5CHLB 3REHC 2LY8A 5GT0A 2L5AA 3MVDC 3TU4A 1B6WA 5AV5D 1M18A 3REHA 1P3IB 4DQYB 3LJAB 3B0BA 3MVDA 5AV6C 4YS3A 1W2EA 1KX3D 2RVQD 3LELD 5AV6A 3C1BC 1P3OB 3C1CD 5GT3B 4QLCB 1S32D 4DRBA 2F8ND 5F99B 4AWLB 5KDMB 3WTPB 4XUJC 3C1BA 3AZGD 3IP4C 5DNNB 4WU9A 5CPIB 4R8PD 3AYWD 3KFUG 4XUJA 2UWXA 5CP6C 1F66B 3KWQC 3AZFC 3AZIC 2FFFB 4UUZA 1F1EA 2NQBD 2Y2PA 2HIOB 5CP6A 1P3PB 3AZFA 3AZIA 2BYMA 3W98D 3WAAC 3NQUA 1AOIC 4YS3B 3X1SC 1U35C 4H9PB 5AVCB 2ZY3A 2YFWA 2CV5C 3WAAA 5B40B 3A6ND 1AOIA 1HQ3C 1ID3B 4KHAB 5AV5A 3X1SA 5JRGD 2HUEC 2W8SA 3MGPC 3UTBC 5JA4B 2CV5A 3AZKB 1HQ3A 5B31C 5DNMD 4G92C 3MGPA 4WU9B 4X23C 4WNNA 3W97C 3R45A 5BT1D 1TAFA 3UTBA 5CPKC 3WKJB 2ZM5A 3KXBC 4X23A 3W97A 3V9RB 5CPKA 1TZYC 3AZEB 2PYOD 3X1VC 3KXBA 5B33D 3EPKA 4NE5A 1TZYA 1M19C 3KUYD 3X1VA 3P5JB 4H9RB
chains in the Genus database with same CATH topology
1M19A 3VH6W 4CAYA 1P3FC 2YFWB 5B2JC 3WAAB 3W99D 3AV2C 1M1AC 3B6FD 1P3KA 3MGSD 5AV8D 5AV5B 5BNVB 4Z5TC 5CPJD 1P3FA 5GT3D 5B32C 5B2JA 3EPJA 3X1TC 1M1AA 3AV2A 5B1LC 2Y2OA 4Z5TA 1BH9B 1KX3B 5B32A 3FDDA 3X1TA 3KSYA 5BNXA 3C1CB 4J8UD 3WA9C 2F8NH 1S32B 3MNNC 1F66D 2F8NB 4ZBJC 4XZQC 5GT0D 3AZGB 5E5AC 3WA9A 3AZHC 4ZUXC 4R8PB 3MNNA 3TU4D 3AYWB 3VH5A 5B0YC 1M18D 3REHD 3MGRC 4XZQA 3NQJA 4Z66C 5E5AA 3MVDD 3AZHA 4ZUXA 4J8XC 5B0YA 3AZJC 3MGRA 4H9OB 4G91B 4Z66A 1P3AC 5AV6D 5AV9C 4J8XA 5GSUC 1P3AA 2RIQA 3REIC 3AN2C 2NZDC 3C1BD 1P3MC 1Q9CA 5AVBC 4WU9D 5GSUA 3REIA 2NZDA 5C3IB 3W99A 5AY8C 4XUJD 1P3MA 5AVBA 4NE6A 1JFIB 5B2IC 1WWSA 5AY8A 5B31G 4KUDC 5DNMB 4HGAB 5CP6D 5B2IA 3KWQD 5B24C 3AZFD 3AZID 4KUDA 3B0DB 4JJNC 5B24A 1P3BC 3MGRB 2PYOB 3WAAD 5B33B 2YFVA 1AOID 4WU8C 3X1SD 4JJNA 1U35D 3AFAC 1P3BA 1P3LC 4UPKA 3KUYB 2CV5D 1HQ3D 4WU8A 3W96C 3EPHA 3AFAA 1P3LA 3MGPD 3UT9C 3UTBD 3B6FB 3W99B 3MGSB 5AV8B 3W96A 5FUGB 1N1JB 5B32G 5CPJB 3UT9A 4X23D 3W97D 5CPKD 4Z2MG 1KX5C 3KXBD 3AZNC 3LZ1C 5G49A 3AV1C 1H3OB 1TZYD 4YM6C 3X1VD 4J8UB 3AZNA 1KX4C 3AV1A 4YM6A 1M19D 4J8VC 5GT0B 2YFVB 1P3KD 3TU4B 4JJNB 1P3BB 1M18B 3KWQA 3REHB 4LD9C 4J8VA 1P3FD 3B6GC 5B2JD 4WZSB 1EQZC 1M1AD 3AV2D 3MVDB 4Z5TD 1P34C 5B32D 3B6GA 1EQZA 3VH6T 3X1TD 5B1MC 3AZLC 5B1LD 5AV6B 2Y2JA 1U35A 1P34A 3AZMC 2DQNC 5B1MA 3C1BB 2AROC 3WA9D 3MNND 3AZMA 1WWIA 4XZQD 4XUJB 3H0RC 5E5AD 5B31A 2AROA 3AZHD 4ZUXD 5B0YD 3WTPE 3MGRD 4UUZB 4Z66D 5CP6B 4J8XD 3KWQB 3AZFB 3AZIB 2BYMB 3AZJD 1P3AD 5GXQC 3X1UC 2XD1A 5AV9D 3NQUB 4H9NA 3LELC 5GSUD 3REID 3AN2D 2NZDD 3X1UA 1AOIB 1P3GC 3X1SB 1U35B 1P3MD 5AVBD 4E44A 3RELC 2CV5B 2IO5C 3O62C 5AY8D 1HQ3B 1P3GA 2HUEB 3MGPB 3AZMB 4WNNB 3RELA 1BH8A 3R45B 1TAFB 5B2ID 3UTBB 5B1LA 3A1IA 3REKC 4KUDD 5B31B 4G92B 4X23B 2Y2IA 3W97B 2FJ7C 5CPKB 1HTAA 5B24D 3H0MC 3REKA 3KXBB 3MGQC 2FJ7A 4JJND 1TZYB 1P3BD 4J8WC 3X1VB 3H0LC 4H9QA 4WU8D 1ZLAC 3AFAD 1M19B 1P3LD 4CSRA 4CAYB 3REJC 4J8WA 5B0ZC 1P3KB 4KGCC 3UTAC 1ZLAA 3W96D 3EPLA 3REJA 3UT9D 3AZJA 1P3FB 5B2JB 1M1AB 5B0ZA 3AV2B 5AV9A 3UTAA 4KGCA 4Z5TB 2F8NK 4H9SC 5B32B 3LZ0C 3AN2A 3X1TB 5B1LB 2Y2KA 1KX5D 1ULYA 2JSSA 4H9SA 2BYKA 3A1KA 5BNXB 3AZND 3LZ0A 3LZ1D 3AV1D 4YM6D 4WJ3C 3WA9B 2FJ7B 3MNNB 1KX4D 1P3IC 3VH5W 3LJAC 4ZBJB 4J8VD 3EG5B 3NQJB 4XZQB 5E5AB 3AZHB 4ZUXB 1P3IA 2CWEA 5B0YB 4LD9D 3LJAA 3B6GD 4Z66B 1EQZD 1P3OC 4J8XB 1T3UA 4QLCC 3AZJB 1P34D 1P3AB 5F99C 4AWLC 5B1MD 3WTPC 3AZLD 2Y2HA 5AV9B 1P3OA 5DNNC 5CPIC 4QLCA 2Y2MA 5GSUB 3REIB 5F99A 3AZMD 3AN2B 5KDMA 2NZDB 5DNNA 5CPIA 1P3MB 2BYKB 5AVBB 5B31D 2AROD 5BO0A 5AY8B 3B0CW 1R4VA 2HIOC 1P3PC 2ZY5A 2Y2GA 5B2IB 1A7WA 2JCHA 2HIOA 1KX5A 3AL0C 4KUDB 4YS3C 1P3PA 5AVCC 3LZ1A 5B24B 2G5HC 4E45A 5B40C 5GXQD 3X1UD 1ID3C 4H9PA 5AVCA 1KX4A 5B40A 3AZKC 1ID3A 4KHAA 4WU8B 4WU9C 1P3GD 3AFAB 3WKJC 4LD9A 2G5IC 5JA4A 1P3LB 3RELD 3AZKA 3O62D 3W96B 3WKJA 3UT9B 5BO0B 3AZEC 3AZLA 2ZY2A 3REKD 3V9RA 2FJ7D 5G49B 3AZEA 1PZRA 1KX5B 4WV4B 3AZNB 3MGQD 3LZ1B 2VQRA 4EO5C 3AV1B 4YM6B 4J8WD 4H9RA 5AV5C 3VH6A 1KX4B 1ZLAD 3REJD 2F2AC 4J8VB 5B0ZD 5BNVA 4KGCD 3UTAD 1KX3C 4LD9B 2RVQC 3B6GB 1EQZB 5GXQA 1BH9A 3C1CC 1BFMA 1KX3A 1S32C 2J8PA 3LELA 1P34B 3LZ0D 5B1MB 3AZLB 3AZGC 3C1CA 4M6BA 1S32A 4R8PC 3AYWC 2F8NA 5BS7C 3O62A 3AZGA 4R8PA 3AYWA 2AROB 1P3ID 1P3KC 5BS7A 4G91C 3LJAD 2NQBC 4EO5B 4H9OA 2NQBA 3W98C 3VH5T 1P3OD 3MGQA 4H9NB 4QLCD 3W98A 5C3IC 5F99D 3A6NC 5GXQB 3X1UB 3WTPD 2DF4C 2Y2LA 2Y2QA 5DNND 5JRGC 5CPID 3LELB 3A6NA 4NE3A 5DNMC 4HGAC 5JRGA 1P3GB 5BT1C 1JFIA 3RELB 1BH8B 2IO5B 4Z2MH 3O62B 5DNMA 2HIOD 3B0DC 1P3PD 2XD5A 1Z2CB 2PYOC 3REKB 5B33C 3B0CT 4YS3D 5AVCD 2NQBB 3KUYC 2PYOA 5B40D 5B33A 1B67A 2Y2NA 1ID3D 3MGQB 4H9QB 3W98B 3KUYA 3W99C 4CSRB 3B6FC 4J8WB 3MGSC 5AV8C 3AZKD 2BG1A 2ZY4A 5CPJC 1ZLAB 5GT3C 3WKJD 2JE5A 3REJB 3A6NB 3B6FA 3MGSA 5AV8A 5B0ZB 5FUGA 5JRGB 1N1JA 3UTAB 5CPJA 4KGCB 5GT3A 3AZED 3WTPA 3F6TA 4J8UC 2F8NG 1F66C 1H3OA 3LZ0B 4DRAA 1KU5A 5GT0C 4J8UA 4NFTA 3TU4C 1F66A 1M18C 5CHLB 3REHC 2LY8A 5GT0A 2L5AA 3MVDC 3TU4A 1B6WA 5AV5D 1M18A 3REHA 1P3IB 4DQYB 3LJAB 3B0BA 3MVDA 5AV6C 4YS3A 1W2EA 1KX3D 2RVQD 3LELD 5AV6A 3C1BC 1P3OB 3C1CD 5GT3B 4QLCB 1S32D 4DRBA 2F8ND 5F99B 4AWLB 5KDMB 3WTPB 4XUJC 3C1BA 3AZGD 3IP4C 5DNNB 4WU9A 5CPIB 4R8PD 3AYWD 3KFUG 4XUJA 2UWXA 5CP6C 1F66B 3KWQC 3AZFC 3AZIC 2FFFB 4UUZA 1F1EA 2NQBD 2Y2PA 2HIOB 5CP6A 1P3PB 3AZFA 3AZIA 2BYMA 3W98D 3WAAC 3NQUA 1AOIC 4YS3B 3X1SC 1U35C 4H9PB 5AVCB 2ZY3A 2YFWA 2CV5C 3WAAA 5B40B 3A6ND 1AOIA 1HQ3C 1ID3B 4KHAB 5AV5A 3X1SA 5JRGD 2HUEC 2W8SA 3MGPC 3UTBC 5JA4B 2CV5A 3AZKB 1HQ3A 5B31C 5DNMD 4G92C 3MGPA 4WU9B 4X23C 4WNNA 3W97C 3R45A 5BT1D 1TAFA 3UTBA 5CPKC 3WKJB 2ZM5A 3KXBC 4X23A 3W97A 3V9RB 5CPKA 1TZYC 3AZEB 2PYOD 3X1VC 3KXBA 5B33D 3EPKA 4NE5A 1TZYA 1M19C 3KUYD 3X1VA 3P5JB 4H9RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 A;  3VH6 W;  4CAY A;  1P3F C;  2YFW B;  5B2J C;  3WAA B;  3W99 D;  3AV2 C;  1M1A C;  3B6F D;  1P3K A;  3MGS D;  5AV8 D;  5AV5 B;  5BNV B;  4Z5T C;  5CPJ D;  1P3F A;  5GT3 D;  5B32 C;  5B2J A;  3X1T C;  1M1A A;  3AV2 A;  5B1L C;  4Z5T A;  1BH9 B;  1KX3 B;  5B32 A;  3X1T A;  3KSY A;  5BNX A;  3C1C B;  4J8U D;  3WA9 C;  2F8N H;  1S32 B;  3MNN C;  1F66 D;  2F8N B;  4ZBJ C;  4XZQ C;  5GT0 D;  3AZG B;  5E5A C;  3WA9 A;  3AZH C;  4ZUX C;  4R8P B;  3MNN A;  3TU4 D;  3AYW B;  3VH5 A;  5B0Y C;  1M18 D;  3REH D;  3MGR C;  4XZQ A;  3NQJ A;  4Z66 C;  5E5A A;  3MVD D;  3AZH A;  4ZUX A;  4J8X C;  5B0Y A;  3AZJ C;  3MGR A;  4H9O B;  4G91 B;  4Z66 A;  1P3A C;  5AV6 D;  5AV9 C;  4J8X A;  5GSU C;  1P3A A;  3REI C;  3AN2 C;  2NZD C;  3C1B D;  1P3M C;  1Q9C A;  5AVB C;  4WU9 D;  5GSU A;  3REI A;  2NZD A;  5C3I B;  3W99 A;  5AY8 C;  4XUJ D;  1P3M A;  5AVB A;  4NE6 A;  1JFI B;  5B2I C;  1WWS A;  5AY8 A;  5B31 G;  4KUD C;  5DNM B;  4HGA B;  5CP6 D;  5B2I A;  3KWQ D;  5B24 C;  3AZF D;  3AZI D;  4KUD A;  3B0D B;  4JJN C;  5B24 A;  1P3B C;  3MGR B;  2PYO B;  3WAA D;  5B33 B;  2YFV A;  1AOI D;  4WU8 C;  3X1S D;  4JJN A;  1U35 D;  3AFA C;  1P3B A;  1P3L C;  3KUY B;  2CV5 D;  1HQ3 D;  4WU8 A;  3W96 C;  3AFA A;  1P3L A;  3MGP D;  3UT9 C;  3UTB D;  3B6F B;  3W99 B;  3MGS B;  5AV8 B;  3W96 A;  5FUG B;  1N1J B;  5B32 G;  5CPJ B;  3UT9 A;  4X23 D;  3W97 D;  5CPK D;  4Z2M G;  1KX5 C;  3KXB D;  3AZN C;  3LZ1 C;  5G49 A;  3AV1 C;  1H3O B;  1TZY D;  4YM6 C;  3X1V D;  4J8U B;  3AZN A;  1KX4 C;  3AV1 A;  4YM6 A;  1M19 D;  4J8V C;  5GT0 B;  2YFV B;  1P3K D;  3TU4 B;  4JJN B;  1P3B B;  1M18 B;  3KWQ A;  3REH B;  4LD9 C;  4J8V A;  1P3F D;  3B6G C;  5B2J D;  4WZS B;  1EQZ C;  1M1A D;  3AV2 D;  3MVD B;  4Z5T D;  1P34 C;  5B32 D;  3B6G A;  1EQZ A;  3VH6 T;  3X1T D;  5B1M C;  3AZL C;  5B1L D;  5AV6 B;  1U35 A;  1P34 A;  3AZM C;  5B1M A;  3C1B B;  2ARO C;  3WA9 D;  3MNN D;  3AZM A;  1WWI A;  4XZQ D;  4XUJ B;  5E5A D;  5B31 A;  2ARO A;  3AZH D;  4ZUX D;  5B0Y D;  3WTP E;  3MGR D;  4UUZ B;  4Z66 D;  5CP6 B;  4J8X D;  3KWQ B;  3AZF B;  3AZI B;  2BYM B;  3AZJ D;  1P3A D;  5GXQ C;  3X1U C;  5AV9 D;  3NQU B;  4H9N A;  3LEL C;  5GSU D;  3REI D;  3AN2 D;  2NZD D;  3X1U A;  1AOI B;  1P3G C;  3X1S B;  1U35 B;  1P3M D;  5AVB D;  4E44 A;  3REL C;  2CV5 B;  2IO5 C;  3O62 C;  5AY8 D;  1HQ3 B;  1P3G A;  2HUE B;  3MGP B;  3AZM B;  4WNN B;  3REL A;  1BH8 A;  3R45 B;  1TAF B;  5B2I D;  3UTB B;  5B1L A;  3REK C;  4KUD D;  5B31 B;  4G92 B;  4X23 B;  3W97 B;  2FJ7 C;  5CPK B;  1HTA A;  5B24 D;  3REK A;  3KXB B;  3MGQ C;  2FJ7 A;  4JJN D;  1TZY B;  1P3B D;  4J8W C;  3X1V B;  4H9Q A;  4WU8 D;  1ZLA C;  3AFA D;  1M19 B;  1P3L D;  4CSR A;  4CAY B;  3REJ C;  4J8W A;  5B0Z C;  1P3K B;  4KGC C;  3UTA C;  1ZLA A;  3W96 D;  3REJ A;  3UT9 D;  3AZJ A;  1P3F B;  5B2J B;  1M1A B;  5B0Z A;  3AV2 B;  5AV9 A;  3UTA A;  4KGC A;  4Z5T B;  2F8N K;  4H9S C;  5B32 B;  3LZ0 C;  3AN2 A;  3X1T B;  5B1L B;  1KX5 D;  1ULY A;  2JSS A;  4H9S A;  2BYK A;  5BNX B;  3AZN D;  3LZ0 A;  3LZ1 D;  3AV1 D;  4YM6 D;  3WA9 B;  2FJ7 B;  3MNN B;  1KX4 D;  1P3I C;  3VH5 W;  3LJA C;  4ZBJ B;  4J8V D;  4XZQ B;  3NQJ B;  5E5A B;  3AZH B;  4ZUX B;  1P3I A;  2CWE A;  5B0Y B;  4LD9 D;  3LJA A;  3B6G D;  4Z66 B;  1EQZ D;  1P3O C;  4J8X B;  4QLC C;  3AZJ B;  1P34 D;  1P3A B;  5F99 C;  4AWL C;  5B1M D;  3WTP C;  3AZL D;  5AV9 B;  1P3O A;  5DNN C;  5CPI C;  4QLC A;  5GSU B;  3REI B;  5F99 A;  3AZM D;  3AN2 B;  5KDM A;  2NZD B;  5DNN A;  5CPI A;  1P3M B;  2BYK B;  5AVB B;  5B31 D;  2ARO D;  5BO0 A;  5AY8 B;  3B0C W;  1R4V A;  2HIO C;  1P3P C;  5B2I B;  1A7W A;  1KX5 A;  2HIO A;  4KUD B;  4YS3 C;  1P3P A;  5AVC C;  3LZ1 A;  5B24 B;  4E45 A;  5B40 C;  5GXQ D;  3X1U D;  1ID3 C;  4H9P A;  5AVC A;  1KX4 A;  5B40 A;  3AZK C;  1ID3 A;  4KHA A;  4WU8 B;  4WU9 C;  1P3G D;  3AFA B;  3WKJ C;  4LD9 A;  5JA4 A;  1P3L B;  3REL D;  3AZK A;  3O62 D;  3W96 B;  3WKJ A;  3UT9 B;  5BO0 B;  3AZE C;  3AZL A;  3REK D;  3V9R A;  2FJ7 D;  5G49 B;  3AZE A;  1KX5 B;  4WV4 B;  3AZN B;  3MGQ D;  3LZ1 B;  4EO5 C;  3AV1 B;  4YM6 B;  4J8W D;  4H9R A;  5AV5 C;  3VH6 A;  1KX4 B;  1ZLA D;  3REJ D;  4J8V B;  5B0Z D;  5BNV A;  4KGC D;  3UTA D;  1KX3 C;  4LD9 B;  2RVQ C;  3B6G B;  1EQZ B;  5GXQ A;  1BH9 A;  3C1C C;  1BFM A;  1KX3 A;  1S32 C;  3LEL A;  1P34 B;  3LZ0 D;  5B1M B;  3AZL B;  3AZG C;  3C1C A;  4M6B A;  1S32 A;  4R8P C;  3AYW C;  2F8N A;  5BS7 C;  3O62 A;  3AZG A;  4R8P A;  3AYW A;  2ARO B;  1P3I D;  4G91 C;  5BS7 A;  3LJA D;  2NQB C;  4EO5 B;  4H9O A;  2NQB A;  3W98 C;  3VH5 T;  1P3O D;  3MGQ A;  4H9N B;  4QLC D;  3W98 A;  5C3I C;  5F99 D;  3A6N C;  5GXQ B;  3X1U B;  3WTP D;  5DNN D;  5JRG C;  5CPI D;  3LEL B;  3A6N A;  4NE3 A;  5DNM C;  4HGA C;  5JRG A;  1P3G B;  5BT1 C;  1JFI A;  3REL B;  1BH8 B;  2IO5 B;  4Z2M H;  3O62 B;  5DNM A;  2HIO D;  3B0D C;  1P3P D;  2PYO C;  3REK B;  5B33 C;  3B0C T;  4YS3 D;  5AVC D;  2NQB B;  3KUY C;  2PYO A;  5B40 D;  5B33 A;  1B67 A;  1ID3 D;  3MGQ B;  4H9Q B;  3W98 B;  3KUY A;  3W99 C;  4CSR B;  3B6F C;  4J8W B;  3MGS C;  5AV8 C;  3AZK D;  5CPJ C;  1ZLA B;  5GT3 C;  3WKJ D;  3REJ B;  3B6F A;  3A6N B;  3MGS A;  5AV8 A;  5B0Z B;  5FUG A;  5JRG B;  1N1J A;  3UTA B;  5CPJ A;  4KGC B;  5GT3 A;  3AZE D;  3WTP A;  4J8U C;  2F8N G;  1F66 C;  1H3O A;  3LZ0 B;  4DRA A;  1KU5 A;  5GT0 C;  4J8U A;  4NFT A;  3TU4 C;  1F66 A;  1M18 C;  5CHL B;  3REH C;  2LY8 A;  5GT0 A;  2L5A A;  3MVD C;  3TU4 A;  1B6W A;  5AV5 D;  1M18 A;  3REH A;  1P3I B;  3LJA B;  3B0B A;  3MVD A;  5AV6 C;  4YS3 A;  1KX3 D;  2RVQ D;  3LEL D;  5AV6 A;  3C1B C;  1P3O B;  3C1C D;  5GT3 B;  4QLC B;  1S32 D;  4DRB A;  2F8N D;  5F99 B;  4AWL B;  5KDM B;  3WTP B;  4XUJ C;  3C1B A;  3AZG D;  5DNN B;  4WU9 A;  5CPI B;  4R8P D;  3AYW D;  4XUJ A;  5CP6 C;  1F66 B;  3KWQ C;  3AZF C;  3AZI C;  4UUZ A;  1F1E A;  2NQB D;  2HIO B;  5CP6 A;  1P3P B;  3AZF A;  3AZI A;  2BYM A;  3W98 D;  3WAA C;  3NQU A;  1AOI C;  4YS3 B;  3X1S C;  1U35 C;  4H9P B;  5AVC B;  2YFW A;  2CV5 C;  3WAA A;  5B40 B;  3A6N D;  1AOI A;  1HQ3 C;  1ID3 B;  4KHA B;  5AV5 A;  3X1S A;  5JRG D;  2HUE C;  3MGP C;  3UTB C;  5JA4 B;  2CV5 A;  3AZK B;  1HQ3 A;  5B31 C;  5DNM D;  4G92 C;  3MGP A;  4WU9 B;  4X23 C;  4WNN A;  3W97 C;  3R45 A;  5BT1 D;  1TAF A;  3UTB A;  5CPK C;  3WKJ B;  3KXB C;  4X23 A;  3W97 A;  3V9R B;  5CPK A;  1TZY C;  3AZE B;  2PYO D;  3X1V C;  3KXB A;  5B33 D;  4NE5 A;  1TZY A;  1M19 C;  3KUY D;  3X1V A;  1P3K C;  4H9R B; 
#chains in the Genus database with same CATH topology
 1M19 A;  3VH6 W;  4CAY A;  1P3F C;  2YFW B;  5B2J C;  3WAA B;  3W99 D;  3AV2 C;  1M1A C;  3B6F D;  1P3K A;  3MGS D;  5AV8 D;  5AV5 B;  5BNV B;  4Z5T C;  5CPJ D;  1P3F A;  5GT3 D;  5B32 C;  5B2J A;  3EPJ A;  3X1T C;  1M1A A;  3AV2 A;  5B1L C;  2Y2O A;  4Z5T A;  1BH9 B;  1KX3 B;  5B32 A;  3FDD A;  3X1T A;  3KSY A;  5BNX A;  3C1C B;  4J8U D;  3WA9 C;  2F8N H;  1S32 B;  3MNN C;  1F66 D;  2F8N B;  4ZBJ C;  4XZQ C;  5GT0 D;  3AZG B;  5E5A C;  3WA9 A;  3AZH C;  4ZUX C;  4R8P B;  3MNN A;  3TU4 D;  3AYW B;  3VH5 A;  5B0Y C;  1M18 D;  3REH D;  3MGR C;  4XZQ A;  3NQJ A;  4Z66 C;  5E5A A;  3MVD D;  3AZH A;  4ZUX A;  4J8X C;  5B0Y A;  3AZJ C;  3MGR A;  4H9O B;  4G91 B;  4Z66 A;  1P3A C;  5AV6 D;  5AV9 C;  4J8X A;  5GSU C;  1P3A A;  2RIQ A;  3REI C;  3AN2 C;  2NZD C;  3C1B D;  1P3M C;  1Q9C A;  5AVB C;  4WU9 D;  5GSU A;  3REI A;  2NZD A;  5C3I B;  3W99 A;  5AY8 C;  4XUJ D;  1P3M A;  5AVB A;  4NE6 A;  1JFI B;  5B2I C;  1WWS A;  5AY8 A;  5B31 G;  4KUD C;  5DNM B;  4HGA B;  5CP6 D;  5B2I A;  3KWQ D;  5B24 C;  3AZF D;  3AZI D;  4KUD A;  3B0D B;  4JJN C;  5B24 A;  1P3B C;  3MGR B;  2PYO B;  3WAA D;  5B33 B;  2YFV A;  1AOI D;  4WU8 C;  3X1S D;  4JJN A;  1U35 D;  3AFA C;  1P3B A;  1P3L C;  4UPK A;  3KUY B;  2CV5 D;  1HQ3 D;  4WU8 A;  3W96 C;  3EPH A;  3AFA A;  1P3L A;  3MGP D;  3UT9 C;  3UTB D;  3B6F B;  3W99 B;  3MGS B;  5AV8 B;  3W96 A;  5FUG B;  1N1J B;  5B32 G;  5CPJ B;  3UT9 A;  4X23 D;  3W97 D;  5CPK D;  4Z2M G;  1KX5 C;  3KXB D;  3AZN C;  3LZ1 C;  5G49 A;  3AV1 C;  1H3O B;  1TZY D;  4YM6 C;  3X1V D;  4J8U B;  3AZN A;  1KX4 C;  3AV1 A;  4YM6 A;  1M19 D;  4J8V C;  5GT0 B;  2YFV B;  1P3K D;  3TU4 B;  4JJN B;  1P3B B;  1M18 B;  3KWQ A;  3REH B;  4LD9 C;  4J8V A;  1P3F D;  3B6G C;  5B2J D;  4WZS B;  1EQZ C;  1M1A D;  3AV2 D;  3MVD B;  4Z5T D;  1P34 C;  5B32 D;  3B6G A;  1EQZ A;  3VH6 T;  3X1T D;  5B1M C;  3AZL C;  5B1L D;  5AV6 B;  2Y2J A;  1U35 A;  1P34 A;  3AZM C;  2DQN C;  5B1M A;  3C1B B;  2ARO C;  3WA9 D;  3MNN D;  3AZM A;  1WWI A;  4XZQ D;  4XUJ B;  3H0R C;  5E5A D;  5B31 A;  2ARO A;  3AZH D;  4ZUX D;  5B0Y D;  3WTP E;  3MGR D;  4UUZ B;  4Z66 D;  5CP6 B;  4J8X D;  3KWQ B;  3AZF B;  3AZI B;  2BYM B;  3AZJ D;  1P3A D;  5GXQ C;  3X1U C;  2XD1 A;  5AV9 D;  3NQU B;  4H9N A;  3LEL C;  5GSU D;  3REI D;  3AN2 D;  2NZD D;  3X1U A;  1AOI B;  1P3G C;  3X1S B;  1U35 B;  1P3M D;  5AVB D;  4E44 A;  3REL C;  2CV5 B;  2IO5 C;  3O62 C;  5AY8 D;  1HQ3 B;  1P3G A;  2HUE B;  3MGP B;  3AZM B;  4WNN B;  3REL A;  1BH8 A;  3R45 B;  1TAF B;  5B2I D;  3UTB B;  5B1L A;  3A1I A;  3REK C;  4KUD D;  5B31 B;  4G92 B;  4X23 B;  2Y2I A;  3W97 B;  2FJ7 C;  5CPK B;  1HTA A;  5B24 D;  3H0M C;  3REK A;  3KXB B;  3MGQ C;  2FJ7 A;  4JJN D;  1TZY B;  1P3B D;  4J8W C;  3X1V B;  3H0L C;  4H9Q A;  4WU8 D;  1ZLA C;  3AFA D;  1M19 B;  1P3L D;  4CSR A;  4CAY B;  3REJ C;  4J8W A;  5B0Z C;  1P3K B;  4KGC C;  3UTA C;  1ZLA A;  3W96 D;  3EPL A;  3REJ A;  3UT9 D;  3AZJ A;  1P3F B;  5B2J B;  1M1A B;  5B0Z A;  3AV2 B;  5AV9 A;  3UTA A;  4KGC A;  4Z5T B;  2F8N K;  4H9S C;  5B32 B;  3LZ0 C;  3AN2 A;  3X1T B;  5B1L B;  2Y2K A;  1KX5 D;  1ULY A;  2JSS A;  4H9S A;  2BYK A;  3A1K A;  5BNX B;  3AZN D;  3LZ0 A;  3LZ1 D;  3AV1 D;  4YM6 D;  4WJ3 C;  3WA9 B;  2FJ7 B;  3MNN B;  1KX4 D;  1P3I C;  3VH5 W;  3LJA C;  4ZBJ B;  4J8V D;  3EG5 B;  3NQJ B;  4XZQ B;  5E5A B;  3AZH B;  4ZUX B;  1P3I A;  2CWE A;  5B0Y B;  4LD9 D;  3LJA A;  3B6G D;  4Z66 B;  1EQZ D;  1P3O C;  4J8X B;  1T3U A;  4QLC C;  3AZJ B;  1P34 D;  1P3A B;  5F99 C;  4AWL C;  5B1M D;  3WTP C;  3AZL D;  2Y2H A;  5AV9 B;  1P3O A;  5DNN C;  5CPI C;  4QLC A;  2Y2M A;  5GSU B;  3REI B;  5F99 A;  3AZM D;  3AN2 B;  5KDM A;  2NZD B;  5DNN A;  5CPI A;  1P3M B;  2BYK B;  5AVB B;  5B31 D;  2ARO D;  5BO0 A;  5AY8 B;  3B0C W;  1R4V A;  2HIO C;  1P3P C;  2ZY5 A;  2Y2G A;  5B2I B;  1A7W A;  2JCH A;  2HIO A;  1KX5 A;  3AL0 C;  4KUD B;  4YS3 C;  1P3P A;  5AVC C;  3LZ1 A;  5B24 B;  2G5H C;  4E45 A;  5B40 C;  5GXQ D;  3X1U D;  1ID3 C;  4H9P A;  5AVC A;  1KX4 A;  5B40 A;  3AZK C;  1ID3 A;  4KHA A;  4WU8 B;  4WU9 C;  1P3G D;  3AFA B;  3WKJ C;  4LD9 A;  2G5I C;  5JA4 A;  1P3L B;  3REL D;  3AZK A;  3O62 D;  3W96 B;  3WKJ A;  3UT9 B;  5BO0 B;  3AZE C;  3AZL A;  2ZY2 A;  3REK D;  3V9R A;  2FJ7 D;  5G49 B;  3AZE A;  1PZR A;  1KX5 B;  4WV4 B;  3AZN B;  3MGQ D;  3LZ1 B;  2VQR A;  4EO5 C;  3AV1 B;  4YM6 B;  4J8W D;  4H9R A;  5AV5 C;  3VH6 A;  1KX4 B;  1ZLA D;  3REJ D;  2F2A C;  4J8V B;  5B0Z D;  5BNV A;  4KGC D;  3UTA D;  1KX3 C;  4LD9 B;  2RVQ C;  3B6G B;  1EQZ B;  5GXQ A;  1BH9 A;  3C1C C;  1BFM A;  1KX3 A;  1S32 C;  2J8P A;  3LEL A;  1P34 B;  3LZ0 D;  5B1M B;  3AZL B;  3AZG C;  3C1C A;  4M6B A;  1S32 A;  4R8P C;  3AYW C;  2F8N A;  5BS7 C;  3O62 A;  3AZG A;  4R8P A;  3AYW A;  2ARO B;  1P3I D;  1P3K C;  5BS7 A;  4G91 C;  3LJA D;  2NQB C;  4EO5 B;  4H9O A;  2NQB A;  3W98 C;  3VH5 T;  1P3O D;  3MGQ A;  4H9N B;  4QLC D;  3W98 A;  5C3I C;  5F99 D;  3A6N C;  5GXQ B;  3X1U B;  3WTP D;  2DF4 C;  2Y2L A;  2Y2Q A;  5DNN D;  5JRG C;  5CPI D;  3LEL B;  3A6N A;  4NE3 A;  5DNM C;  4HGA C;  5JRG A;  1P3G B;  5BT1 C;  1JFI A;  3REL B;  1BH8 B;  2IO5 B;  4Z2M H;  3O62 B;  5DNM A;  2HIO D;  3B0D C;  1P3P D;  2XD5 A;  1Z2C B;  2PYO C;  3REK B;  5B33 C;  3B0C T;  4YS3 D;  5AVC D;  2NQB B;  3KUY C;  2PYO A;  5B40 D;  5B33 A;  1B67 A;  2Y2N A;  1ID3 D;  3MGQ B;  4H9Q B;  3W98 B;  3KUY A;  3W99 C;  4CSR B;  3B6F C;  4J8W B;  3MGS C;  5AV8 C;  3AZK D;  2BG1 A;  2ZY4 A;  5CPJ C;  1ZLA B;  5GT3 C;  3WKJ D;  2JE5 A;  3REJ B;  3A6N B;  3B6F A;  3MGS A;  5AV8 A;  5B0Z B;  5FUG A;  5JRG B;  1N1J A;  3UTA B;  5CPJ A;  4KGC B;  5GT3 A;  3AZE D;  3WTP A;  3F6T A;  4J8U C;  2F8N G;  1F66 C;  1H3O A;  3LZ0 B;  4DRA A;  1KU5 A;  5GT0 C;  4J8U A;  4NFT A;  3TU4 C;  1F66 A;  1M18 C;  5CHL B;  3REH C;  2LY8 A;  5GT0 A;  2L5A A;  3MVD C;  3TU4 A;  1B6W A;  5AV5 D;  1M18 A;  3REH A;  1P3I B;  4DQY B;  3LJA B;  3B0B A;  3MVD A;  5AV6 C;  4YS3 A;  1W2E A;  1KX3 D;  2RVQ D;  3LEL D;  5AV6 A;  3C1B C;  1P3O B;  3C1C D;  5GT3 B;  4QLC B;  1S32 D;  4DRB A;  2F8N D;  5F99 B;  4AWL B;  5KDM B;  3WTP B;  4XUJ C;  3C1B A;  3AZG D;  3IP4 C;  5DNN B;  4WU9 A;  5CPI B;  4R8P D;  3AYW D;  3KFU G;  4XUJ A;  2UWX A;  5CP6 C;  1F66 B;  3KWQ C;  3AZF C;  3AZI C;  2FFF B;  4UUZ A;  1F1E A;  2NQB D;  2Y2P A;  2HIO B;  5CP6 A;  1P3P B;  3AZF A;  3AZI A;  2BYM A;  3W98 D;  3WAA C;  3NQU A;  1AOI C;  4YS3 B;  3X1S C;  1U35 C;  4H9P B;  5AVC B;  2ZY3 A;  2YFW A;  2CV5 C;  3WAA A;  5B40 B;  3A6N D;  1AOI A;  1HQ3 C;  1ID3 B;  4KHA B;  5AV5 A;  3X1S A;  5JRG D;  2HUE C;  2W8S A;  3MGP C;  3UTB C;  5JA4 B;  2CV5 A;  3AZK B;  1HQ3 A;  5B31 C;  5DNM D;  4G92 C;  3MGP A;  4WU9 B;  4X23 C;  4WNN A;  3W97 C;  3R45 A;  5BT1 D;  1TAF A;  3UTB A;  5CPK C;  3WKJ B;  2ZM5 A;  3KXB C;  4X23 A;  3W97 A;  3V9R B;  5CPK A;  1TZY C;  3AZE B;  2PYO D;  3X1V C;  3KXB A;  5B33 D;  3EPK A;  4NE5 A;  1TZY A;  1M19 C;  3KUY D;  3X1V A;  3P5J B;  4H9R B; 
#chains in the Genus database with same CATH homology
 1M19 A;  3VH6 W;  4CAY A;  1P3F C;  2YFW B;  5B2J C;  3WAA B;  3W99 D;  3AV2 C;  1M1A C;  3B6F D;  1P3K A;  3MGS D;  5AV8 D;  5AV5 B;  5BNV B;  4Z5T C;  5CPJ D;  1P3F A;  5GT3 D;  5B32 C;  5B2J A;  3EPJ A;  3X1T C;  1M1A A;  3AV2 A;  5B1L C;  2Y2O A;  4Z5T A;  1BH9 B;  1KX3 B;  5B32 A;  3FDD A;  3X1T A;  3KSY A;  5BNX A;  3C1C B;  4J8U D;  3WA9 C;  2F8N H;  1S32 B;  3MNN C;  1F66 D;  2F8N B;  4ZBJ C;  4XZQ C;  5GT0 D;  3AZG B;  5E5A C;  3WA9 A;  3AZH C;  4ZUX C;  4R8P B;  3MNN A;  3TU4 D;  3AYW B;  3VH5 A;  5B0Y C;  1M18 D;  3REH D;  3MGR C;  4XZQ A;  3NQJ A;  4Z66 C;  5E5A A;  3MVD D;  3AZH A;  4ZUX A;  4J8X C;  5B0Y A;  3AZJ C;  3MGR A;  4H9O B;  4G91 B;  4Z66 A;  1P3A C;  5AV6 D;  5AV9 C;  4J8X A;  5GSU C;  1P3A A;  2RIQ A;  3REI C;  3AN2 C;  2NZD C;  3C1B D;  1P3M C;  1Q9C A;  5AVB C;  4WU9 D;  5GSU A;  3REI A;  2NZD A;  5C3I B;  3W99 A;  5AY8 C;  4XUJ D;  1P3M A;  5AVB A;  4NE6 A;  1JFI B;  5B2I C;  1WWS A;  5AY8 A;  5B31 G;  4KUD C;  5DNM B;  4HGA B;  5CP6 D;  5B2I A;  3KWQ D;  5B24 C;  3AZF D;  3AZI D;  4KUD A;  3B0D B;  4JJN C;  5B24 A;  1P3B C;  3MGR B;  2PYO B;  3WAA D;  5B33 B;  2YFV A;  1AOI D;  4WU8 C;  3X1S D;  4JJN A;  1U35 D;  3AFA C;  1P3B A;  1P3L C;  4UPK A;  3KUY B;  2CV5 D;  1HQ3 D;  4WU8 A;  3W96 C;  3EPH A;  3AFA A;  1P3L A;  3MGP D;  3UT9 C;  3UTB D;  3B6F B;  3W99 B;  3MGS B;  5AV8 B;  3W96 A;  5FUG B;  1N1J B;  5B32 G;  5CPJ B;  3UT9 A;  4X23 D;  3W97 D;  5CPK D;  4Z2M G;  1KX5 C;  3KXB D;  3AZN C;  3LZ1 C;  5G49 A;  3AV1 C;  1H3O B;  1TZY D;  4YM6 C;  3X1V D;  4J8U B;  3AZN A;  1KX4 C;  3AV1 A;  4YM6 A;  1M19 D;  4J8V C;  5GT0 B;  2YFV B;  1P3K D;  3TU4 B;  4JJN B;  1P3B B;  1M18 B;  3KWQ A;  3REH B;  4LD9 C;  4J8V A;  1P3F D;  3B6G C;  5B2J D;  4WZS B;  1EQZ C;  1M1A D;  3AV2 D;  3MVD B;  4Z5T D;  1P34 C;  5B32 D;  3B6G A;  1EQZ A;  3VH6 T;  3X1T D;  5B1M C;  3AZL C;  5B1L D;  5AV6 B;  2Y2J A;  1U35 A;  1P34 A;  3AZM C;  2DQN C;  5B1M A;  3C1B B;  2ARO C;  3WA9 D;  3MNN D;  3AZM A;  1WWI A;  4XZQ D;  4XUJ B;  3H0R C;  5E5A D;  5B31 A;  2ARO A;  3AZH D;  4ZUX D;  5B0Y D;  3WTP E;  3MGR D;  4UUZ B;  4Z66 D;  5CP6 B;  4J8X D;  3KWQ B;  3AZF B;  3AZI B;  2BYM B;  3AZJ D;  1P3A D;  5GXQ C;  3X1U C;  2XD1 A;  5AV9 D;  3NQU B;  4H9N A;  3LEL C;  5GSU D;  3REI D;  3AN2 D;  2NZD D;  3X1U A;  1AOI B;  1P3G C;  3X1S B;  1U35 B;  1P3M D;  5AVB D;  4E44 A;  3REL C;  2CV5 B;  2IO5 C;  3O62 C;  5AY8 D;  1HQ3 B;  1P3G A;  2HUE B;  3MGP B;  3AZM B;  4WNN B;  3REL A;  1BH8 A;  3R45 B;  1TAF B;  5B2I D;  3UTB B;  5B1L A;  3A1I A;  3REK C;  4KUD D;  5B31 B;  4G92 B;  4X23 B;  2Y2I A;  3W97 B;  2FJ7 C;  5CPK B;  1HTA A;  5B24 D;  3H0M C;  3REK A;  3KXB B;  3MGQ C;  2FJ7 A;  4JJN D;  1TZY B;  1P3B D;  4J8W C;  3X1V B;  3H0L C;  4H9Q A;  4WU8 D;  1ZLA C;  3AFA D;  1M19 B;  1P3L D;  4CSR A;  4CAY B;  3REJ C;  4J8W A;  5B0Z C;  1P3K B;  4KGC C;  3UTA C;  1ZLA A;  3W96 D;  3EPL A;  3REJ A;  3UT9 D;  3AZJ A;  1P3F B;  5B2J B;  1M1A B;  5B0Z A;  3AV2 B;  5AV9 A;  3UTA A;  4KGC A;  4Z5T B;  2F8N K;  4H9S C;  5B32 B;  3LZ0 C;  3AN2 A;  3X1T B;  5B1L B;  2Y2K A;  1KX5 D;  1ULY A;  2JSS A;  4H9S A;  2BYK A;  3A1K A;  5BNX B;  3AZN D;  3LZ0 A;  3LZ1 D;  3AV1 D;  4YM6 D;  4WJ3 C;  3WA9 B;  2FJ7 B;  3MNN B;  1KX4 D;  1P3I C;  3VH5 W;  3LJA C;  4ZBJ B;  4J8V D;  3EG5 B;  3NQJ B;  4XZQ B;  5E5A B;  3AZH B;  4ZUX B;  1P3I A;  2CWE A;  5B0Y B;  4LD9 D;  3LJA A;  3B6G D;  4Z66 B;  1EQZ D;  1P3O C;  4J8X B;  1T3U A;  4QLC C;  3AZJ B;  1P34 D;  1P3A B;  5F99 C;  4AWL C;  5B1M D;  3WTP C;  3AZL D;  2Y2H A;  5AV9 B;  1P3O A;  5DNN C;  5CPI C;  4QLC A;  2Y2M A;  5GSU B;  3REI B;  5F99 A;  3AZM D;  3AN2 B;  5KDM A;  2NZD B;  5DNN A;  5CPI A;  1P3M B;  2BYK B;  5AVB B;  5B31 D;  2ARO D;  5BO0 A;  5AY8 B;  3B0C W;  1R4V A;  2HIO C;  1P3P C;  2ZY5 A;  2Y2G A;  5B2I B;  1A7W A;  2JCH A;  2HIO A;  1KX5 A;  3AL0 C;  4KUD B;  4YS3 C;  1P3P A;  5AVC C;  3LZ1 A;  5B24 B;  2G5H C;  4E45 A;  5B40 C;  5GXQ D;  3X1U D;  1ID3 C;  4H9P A;  5AVC A;  1KX4 A;  5B40 A;  3AZK C;  1ID3 A;  4KHA A;  4WU8 B;  4WU9 C;  1P3G D;  3AFA B;  3WKJ C;  4LD9 A;  2G5I C;  5JA4 A;  1P3L B;  3REL D;  3AZK A;  3O62 D;  3W96 B;  3WKJ A;  3UT9 B;  5BO0 B;  3AZE C;  3AZL A;  2ZY2 A;  3REK D;  3V9R A;  2FJ7 D;  5G49 B;  3AZE A;  1PZR A;  1KX5 B;  4WV4 B;  3AZN B;  3MGQ D;  3LZ1 B;  2VQR A;  4EO5 C;  3AV1 B;  4YM6 B;  4J8W D;  4H9R A;  5AV5 C;  3VH6 A;  1KX4 B;  1ZLA D;  3REJ D;  2F2A C;  4J8V B;  5B0Z D;  5BNV A;  4KGC D;  3UTA D;  1KX3 C;  4LD9 B;  2RVQ C;  3B6G B;  1EQZ B;  5GXQ A;  1BH9 A;  3C1C C;  1BFM A;  1KX3 A;  1S32 C;  2J8P A;  3LEL A;  1P34 B;  3LZ0 D;  5B1M B;  3AZL B;  3AZG C;  3C1C A;  4M6B A;  1S32 A;  4R8P C;  3AYW C;  2F8N A;  5BS7 C;  3O62 A;  3AZG A;  4R8P A;  3AYW A;  2ARO B;  1P3I D;  1P3K C;  5BS7 A;  4G91 C;  3LJA D;  2NQB C;  4EO5 B;  4H9O A;  2NQB A;  3W98 C;  3VH5 T;  1P3O D;  3MGQ A;  4H9N B;  4QLC D;  3W98 A;  5C3I C;  5F99 D;  3A6N C;  5GXQ B;  3X1U B;  3WTP D;  2DF4 C;  2Y2L A;  2Y2Q A;  5DNN D;  5JRG C;  5CPI D;  3LEL B;  3A6N A;  4NE3 A;  5DNM C;  4HGA C;  5JRG A;  1P3G B;  5BT1 C;  1JFI A;  3REL B;  1BH8 B;  2IO5 B;  4Z2M H;  3O62 B;  5DNM A;  2HIO D;  3B0D C;  1P3P D;  2XD5 A;  1Z2C B;  2PYO C;  3REK B;  5B33 C;  3B0C T;  4YS3 D;  5AVC D;  2NQB B;  3KUY C;  2PYO A;  5B40 D;  5B33 A;  1B67 A;  2Y2N A;  1ID3 D;  3MGQ B;  4H9Q B;  3W98 B;  3KUY A;  3W99 C;  4CSR B;  3B6F C;  4J8W B;  3MGS C;  5AV8 C;  3AZK D;  2BG1 A;  2ZY4 A;  5CPJ C;  1ZLA B;  5GT3 C;  3WKJ D;  2JE5 A;  3REJ B;  3A6N B;  3B6F A;  3MGS A;  5AV8 A;  5B0Z B;  5FUG A;  5JRG B;  1N1J A;  3UTA B;  5CPJ A;  4KGC B;  5GT3 A;  3AZE D;  3WTP A;  3F6T A;  4J8U C;  2F8N G;  1F66 C;  1H3O A;  3LZ0 B;  4DRA A;  1KU5 A;  5GT0 C;  4J8U A;  4NFT A;  3TU4 C;  1F66 A;  1M18 C;  5CHL B;  3REH C;  2LY8 A;  5GT0 A;  2L5A A;  3MVD C;  3TU4 A;  1B6W A;  5AV5 D;  1M18 A;  3REH A;  1P3I B;  4DQY B;  3LJA B;  3B0B A;  3MVD A;  5AV6 C;  4YS3 A;  1W2E A;  1KX3 D;  2RVQ D;  3LEL D;  5AV6 A;  3C1B C;  1P3O B;  3C1C D;  5GT3 B;  4QLC B;  1S32 D;  4DRB A;  2F8N D;  5F99 B;  4AWL B;  5KDM B;  3WTP B;  4XUJ C;  3C1B A;  3AZG D;  3IP4 C;  5DNN B;  4WU9 A;  5CPI B;  4R8P D;  3AYW D;  3KFU G;  4XUJ A;  2UWX A;  5CP6 C;  1F66 B;  3KWQ C;  3AZF C;  3AZI C;  2FFF B;  4UUZ A;  1F1E A;  2NQB D;  2Y2P A;  2HIO B;  5CP6 A;  1P3P B;  3AZF A;  3AZI A;  2BYM A;  3W98 D;  3WAA C;  3NQU A;  1AOI C;  4YS3 B;  3X1S C;  1U35 C;  4H9P B;  5AVC B;  2ZY3 A;  2YFW A;  2CV5 C;  3WAA A;  5B40 B;  3A6N D;  1AOI A;  1HQ3 C;  1ID3 B;  4KHA B;  5AV5 A;  3X1S A;  5JRG D;  2HUE C;  2W8S A;  3MGP C;  3UTB C;  5JA4 B;  2CV5 A;  3AZK B;  1HQ3 A;  5B31 C;  5DNM D;  4G92 C;  3MGP A;  4WU9 B;  4X23 C;  4WNN A;  3W97 C;  3R45 A;  5BT1 D;  1TAF A;  3UTB A;  5CPK C;  3WKJ B;  2ZM5 A;  3KXB C;  4X23 A;  3W97 A;  3V9R B;  5CPK A;  1TZY C;  3AZE B;  2PYO D;  3X1V C;  3KXB A;  5B33 D;  3EPK A;  4NE5 A;  1TZY A;  1M19 C;  3KUY D;  3X1V A;  3P5J B;  4H9R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...