3NQJB

Crystal structure of (cenp-a/h4)2 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nqjB00
4X23A 1HTAA 3LJAB 4YM6C 3B0CW 3AZIC 4LD9A 5GT3D 5JA4A 3AV2C 2RVQD 3W96D 5B31D 1EQZA 5AV5A 3AFAA 3MGPB 1P3AA 4X23B 5BNVA 5CP6A 3W97A 1ZLAD 3X1TA 3REHA 2CV5C 4LD9B 4KGCD 1F66D 2F8ND 3UT9D 4WU8D 5GXQC 5AVCA 4DRBA 3REID 5AV5B 3AFAB 3RELD 1S32C 1P3AB 5BNVB 5CP6B 4ZBJC 4QLCC 3W97B 3WAAD 3REHB 1P3OB 4ZUXA 2AROA 5AVCB 1P3GA 4J8WA 3LZ0A 3LELC 5B1LC 1M18C 4ZUXB 3X1SB 3REJD 2AROB 3AZED 4J8WB 3O62C 3AZMC 3LZ0B 3UTBD 5B2IC 1P3FA 4WU9C 5AVBA 5CPKA 3MGQC 4H9PB 5B32C 1P3IA 5B40A 3C1BA 2HUEB 1P3FB 4R8PD 1WWIA 5AVBB 5CPKB 2FJ7B 3WA9A 4CAYA 4J8UD 3B6GD 3B0DB 3AZGD 5B40B 3X1VA 3C1BB 1P3LD 3KWQD 5BT1D 3MGRC 1TZYD 4CAYB 3X1VB 3AZLD 1BFMA 4XZQD 3LJAD 5AV9D 1AOIC 1TAFB 1P3BA 3VH6W 3W98B 2NZDC 1HQ3A 3MNNC 3MGPD 3R45A 4X23D 4KHAA 4Z66A 3AZFB 4LD9D 2CWEA 1P3BB 3W99A 3TU4A 1HQ3B 1EQZD 5AV5D 3AFAD 3R45B 1A7WA 5AY8A 3AV1A 5CP6D 1P3AD 1P3PA 3W97D 4Z66B 3X1TD 3REHD 5AV8C 3W99B 5B31G 4E45A 3TU4B 1P3OD 3WTPC 5AVCD 5C3IC 5AY8B 3AV1B 1P3PB 3W96B 1KX4A 2F8NG 3B6FA 5B0YC 5B1MC 4ZUXD 2AROD 4KGCB 1ID3A 3AN2C 4J8WD 1KX4B 3LZ0D 3VH5T 3B6FB 1ULYA 1H3OA 2F8NK 1ID3B 5B33C 3AYWC 1M19C 3MGSA 1P3FD 1KX3C 5AVBD 5CPKD 1H3OB 3AZJC 1P3ID 5B40D 1M1AC 3MGSB 3C1BD 5E5AA 4H9QB 4M6BA 4JJNA 4Z2MG 5DNNA 3UTBB 3UTAA 4AWLB 3WA9D 4J8VC 3X1VD 3X1UC 1P3KA 3C1CC 5E5AB 3LELA 2IO5C 4JJNB 5DNNB 3UTAB 5DNMC 4H9RA 1P3KB 4G91B 4XUJC 5B2IA 4WU9A 5JRGC 3AZFD 1P3BD 4H9RB 2PYOA 4H9NA 1WWSA 3WKJC 5BNXA 1HQ3D 5G49A 3REKA 4WU9B 3AZLB 4Z66D 4H9SC 4G92B 4YS3A 4XZQB 5B24C 3W99D 2PYOB 5AV9B 4H9NB 3TU4D 5BNXB 5G49B 1P34A 3VH5A 5GT3C 5AY8D 3REKB 3AV1D 1P3PD 2RVQC 5B31C 4YS3B 2LY8A 4KUDA 3A6NA 1ZLAC 1P34B 1B6WA 5JA4B 5CPIC 1KX4D 3UT9C 4WU8C 1EQZB 4UUZA 5BO0A 3REIC 3RELC 3B6FD 3A6NB 4KUDB 5CPJA 3X1TB 3WAAC 1ID3D 4UUZB 5BO0B 5CPJB 3B0BA 4HGAC 3LZ1C 3MVDA 3MGSD 1P3GB 3REJC 3AZEC 4NFTA 5AV8A 1P3MA 3MVDB 5E5AD 4JJND 1P3MB 5B0YA 5DNND 3UTAD 4R8PC 1U35A 3AN2A 1P3KD 3AZNA 4J8UC 3LELD 5BS7C 1P3IB 3B6GC 3AZGC 4EO5B 1U35B 5BT1C 1M19A 5B0ZA 3WA9B 4CSRA 1TZYC 3AZNB 4DRAA 4WU9D 2YFVA 3AZJA 2PYOD 3LJAC 5B0ZB 4CSRB 4WNNA 4J8XA 5GSUA 3REKD 2BYMA 4YS3D 1KX5A 3MGPC 3KXBA 3AZJB 5B2JA 4J8VA 5GT0A 1P34D 4LD9C 4WNNB 4J8XB 5GSUB 4NE5A 3AZKA 2BYMB 1KX5B 5AV5C 3AFAC 3NQUA 3KXBB 3A6ND 1P3AC 4KUDD 4KHAB 5CP6C 5B2JB 3W97C 3REHC 5GT0B 4XUJA 3AZHA 2NQBA 1P3OC 3AZKB 4Z5TC 5JRGA 2HIOA 3NQUB 5AV6A 5CPJD 3AZHB 2NQBB 5F99A 4ZUXC 1P3GD 3X1SC 1F1EA 2AROC 2HIOB 3KUYA 5AV6B 4YM6A 4J8WC 3LZ0C 3AZIA 3MVDD 3AV2A 5F99B 3KUYB 5FUGA 5AV8D 4YM6B 1P3MD 2HUEC 3AZIB 2CV5A 1P3FC 5AVBC 1B67A 3AV2B 5CPKC 2FJ7C 5CPIA 5GXQA 1S32A 3B0DC 5FUGB 4QLCA 5B0YD 5B40C 3C1BC 2L5AA 2CV5B 1U35D 3AN2D 5CPIB 5GXQB 3AZND 3V9RA 1S32B 4ZBJB 3X1VC 4QLCB 5B1LA 3LZ1A 3VH6A 1M18A 1M19D 5B0ZD 3V9RB 3W98C 3O62A 3AZMA 3LELB 5B1LB 3LZ1B 3AZJD 1M18B 3MGQA 3AZFC 4J8XD 5B32A 5GSUD 3O62B 3AZMB 4H9OA 1HQ3C 1KX5D 2JSSA 5B2IB 3KXBD 5B2JD 4J8VD 4Z66C 3MGQB 5GT0D 3W99C 5B32B 3AZKD 3TU4C 3B6GA 4H9OB 3W96C 5AY8C 3AV1C 1P3PC 3MGRA 4XUJD 3AZHD 2NQBD 3B0CT 5JRGD 2HIOD 1F66C 4KGCC 5AV6D 3KSYA 3MGRB 1KX4C 1AOIA 5F99D 2NZDA 3MNNA 3KUYD 1ID3C 4YM6D 1AOIB 3AZID 3AV2D 2NZDB 3MNNB 3MGSC 5KDMA 2CV5D 3UTBC 1P3OA 5CPID 5GXQD 4Z5TA 3WTPA 4AWLC 1S32D 4NE3A 2YFWA 4QLCD 1BH8A 5KDMB 5E5AC 5AV8B 4JJNC 5B1MA 5DNNC 3UTAC 1Q9CA 3WTPB 4Z5TB 3X1SA 4WZSB 5C3IB 2YFWB 1BH8B 1P3KC 4G91C 5B1LD 3LZ1D 5B0YB 1M18D 1BH9A 1P3LC 5B1MB 3KWQC 4H9PA 5B33A 3AYWA 3AN2B 3O62D 3AZMD 5B2ID 1KX3A 4E44A 2FJ7A 1BH9B 3AZLC 4G92C 3MGQD 4XZQC 3WTPE 5B32D 5B33B 5AV9C 3AYWB 1M19B 1M1AA 2PYOC 1KX3B 3REKC 4YS3C 2YFVB 4X23C 1M1AB 3X1UA 3C1CA 3VH6T 1P34C 1KU5A 5DNMA 3MGRD 1EQZC 4KUDC 1TAFA 3A6NC 3NQJA 4J8VB 3X1TC 3X1UB 3W98A 3C1CB 2BYKA 2IO5B 1AOID 5AVCC 5DNMB 3AZFA 3NQJB 3WKJA 5CPJC 2NZDD 1R4VA 4XUJB 2BYKB 3MNND 5JRGB 4H9SA 1P3GC 5B24A 4NE6A 3WKJB 2F8NH 5GT3A 3MVDC 3W96A 5B31A 5B24B 1N1JA 1P3MC 1ZLAA 4Z5TD 3WTPD 5GT3B 4KGCA 1F66A 2F8NA 4WU8A 3UT9A 5B31B 3REIA 3VH5W 3RELA 1P3IC 1N1JB 1ZLAB 5B1MD 3WAAA 4EO5C 3X1SD 1F66B 1U35C 2F8NB 4WU8B 3UT9B 3WA9C 3AZNC 3REIB 3RELB 3WAAB 5B33D 3AYWD 4Z2MH 1JFIA 5B0ZC 3REJA 3AZEA 1KX3D 4H9QA 2FJ7D 4WV4B 3UTBA 4HGAB 1M1AD 1JFIB 1P3BC 3REJB 3AZEB 4J8XC 5GSUC 5B32G 1KX5C 4R8PA 3KXBC 5B2JC 3X1UD 3C1CD 5GT0C 4J8UA 5BS7A 3AZGA 3AZKC 5DNMD 1P3LA 4R8PB 3KWQA 3W98D 1TZYA 4J8UB 3AZHC 2NQBC 3B6GB 3AZGB 1P3LB 3AZLA 2HIOC 4XZQA 3KWQB 5CHLB 5AV6C 3LJAA 3WKJD 5AV9A 1TZYB 3B6FC 5F99C 3MGPA 5B24D 3KUYC
chains in the Genus database with same CATH superfamily
4X23A 1HTAA 3LJAB 2F2AC 4YM6C 3B0CW 3AZIC 4LD9A 2Y2OA 5GT3D 5JA4A 3AV2C 2RVQD 3W96D 5B31D 1EQZA 5AV5A 3AFAA 3MGPB 1P3AA 4X23B 5BNVA 5CP6A 3W97A 1ZLAD 3X1TA 3REHA 3FDDA 2CV5C 4LD9B 4KGCD 1F66D 2F8ND 3UT9D 4WU8D 5GXQC 5AVCA 4DRBA 3REID 5AV5B 3AFAB 3RELD 1S32C 1P3AB 5BNVB 5CP6B 4ZBJC 4QLCC 3W97B 3WAAD 3REHB 1P3OB 4ZUXA 1PZRA 2AROA 5AVCB 1P3GA 4J8WA 3LZ0A 3LELC 5B1LC 1M18C 4ZUXB 3X1SB 3REJD 2AROB 3AZED 4J8WB 3O62C 3AZMC 3LZ0B 3UTBD 5B2IC 1P3FA 4WU9C 5AVBA 5CPKA 3MGQC 4H9PB 5B32C 1P3IA 5B40A 3C1BA 2HUEB 1P3FB 4R8PD 1WWIA 5AVBB 5CPKB 2FJ7B 3WA9A 4CAYA 4J8UD 3B6GD 3B0DB 3AZGD 5B40B 3X1VA 3C1BB 1P3LD 3KWQD 5BT1D 3MGRC 1TZYD 4CAYB 3X1VB 3AZLD 1BFMA 4XZQD 3LJAD 3EPLA 5AV9D 1AOIC 1TAFB 1P3BA 3VH6W 3W98B 2NZDC 1HQ3A 3MNNC 3MGPD 3R45A 4X23D 2DQNC 4KHAA 4Z66A 3AZFB 4LD9D 2CWEA 3EG5B 1P3BB 3W99A 3TU4A 2Y2GA 1HQ3B 1EQZD 5AV5D 3AFAD 3R45B 1A7WA 5AY8A 3AV1A 5CP6D 1P3AD 1P3PA 3W97D 4Z66B 3X1TD 3REHD 5AV8C 3W99B 5B31G 4E45A 3TU4B 1P3OD 3WTPC 5AVCD 3IP4C 5C3IC 5AY8B 3AV1B 1P3PB 3W96B 1KX4A 2F8NG 3B6FA 5B0YC 5B1MC 4ZUXD 2Y2KA 2AROD 4KGCB 1ID3A 3AN2C 4J8WD 3F6TA 1KX4B 3LZ0D 2Y2NA 3VH5T 3B6FB 1ULYA 1H3OA 2F8NK 1ID3B 5B33C 3AYWC 1M19C 3MGSA 1P3FD 1KX3C 5AVBD 5CPKD 1H3OB 2W8SA 3AZJC 1P3ID 5B40D 1M1AC 3MGSB 3C1BD 5E5AA 4H9QB 4M6BA 4JJNA 4Z2MG 5DNNA 3UTBB 3UTAA 4AWLB 3WA9D 4J8VC 3X1VD 3X1UC 1P3KA 3C1CC 5E5AB 3LELA 2IO5C 4JJNB 5DNNB 3UTAB 5DNMC 2Y2IA 2BG1A 2Y2MA 3P5JB 4H9RA 1P3KB 4G91B 4XUJC 5B2IA 4WU9A 5JRGC 3AZFD 1P3BD 4H9RB 2PYOA 4H9NA 1WWSA 3WKJC 5BNXA 1HQ3D 5G49A 3REKA 4WU9B 3EPKA 3AZLB 4Z66D 4H9SC 4G92B 4YS3A 4XZQB 5B24C 3W99D 2PYOB 5AV9B 4H9NB 3TU4D 5BNXB 5G49B 1P34A 3H0LC 3VH5A 5GT3C 5AY8D 3REKB 3AV1D 1P3PD 2RVQC 5B31C 4YS3B 2LY8A 4KUDA 3A6NA 3A1IA 1ZLAC 1P34B 1B6WA 5JA4B 5CPIC 1KX4D 3UT9C 4WU8C 1EQZB 4UUZA 5BO0A 3REIC 3RELC 3B6FD 3A6NB 4KUDB 5CPJA 3X1TB 3WAAC 1ID3D 4UUZB 5BO0B 5CPJB 3B0BA 4HGAC 3LZ1C 3MVDA 3MGSD 1P3GB 3REJC 3AZEC 4NFTA 5AV8A 1P3MA 2Y2PA 3MVDB 5E5AD 2Y2QA 4JJND 2XD1A 5B0YA 5DNND 3UTAD 1P3MB 4R8PC 1U35A 3AN2A 2VQRA 1P3KD 3AZNA 4J8UC 2Y2HA 3LELD 5BS7C 1P3IB 3B6GC 3AZGC 4EO5B 1U35B 5BT1C 1M19A 5B0ZA 3WA9B 4CSRA 1TZYC 3AZNB 4DRAA 4WU9D 2ZY3A 2YFVA 3AZJA 2RIQA 3LJAC 2PYOD 5B0ZB 4CSRB 4WNNA 4J8XA 5GSUA 3REKD 2BYMA 4YS3D 1KX5A 3MGPC 3KXBA 3AZJB 3H0RC 5B2JA 4J8VA 5GT0A 1P34D 4LD9C 4WNNB 4J8XB 5GSUB 4NE5A 3AZKA 2BYMB 1KX5B 5AV5C 1T3UA 3NQUA 3KXBB 3A6ND 3AFAC 1P3AC 4KHAB 5CP6C 5B2JB 3W97C 4KUDD 3REHC 5GT0B 4XUJA 3AZHA 2NQBA 2Y2JA 1P3OC 3AZKB 4Z5TC 5JRGA 2HIOA 1Z2CB 3NQUB 5AV6A 5CPJD 3AZHB 2NQBB 5F99A 4ZUXC 1P3GD 3X1SC 1F1EA 2AROC 2HIOB 3KUYA 5AV6B 4YM6A 4J8WC 3LZ0C 3AZIA 3MVDD 3AV2A 5F99B 3KUYB 5FUGA 5AV8D 4YM6B 1P3MD 2HUEC 3AZIB 2CV5A 1P3FC 5AVBC 1B67A 3AV2B 5CPKC 2FJ7C 5CPIA 5GXQA 1S32A 1W2EA 3B0DC 5FUGB 4QLCA 5B0YD 5B40C 3C1BC 2L5AA 2CV5B 2ZY4A 1U35D 3AN2D 5CPIB 5GXQB 3AZND 3V9RA 1S32B 4ZBJB 3X1VC 4QLCB 5B1LA 3LZ1A 3VH6A 1M18A 1M19D 5B0ZD 3V9RB 3W98C 3O62A 3AZMA 3LELB 5B1LB 3LZ1B 3AZJD 1M18B 3MGQA 3AZFC 4J8XD 5B32A 5GSUD 3O62B 3AZMB 4H9OA 1HQ3C 1KX5D 2JSSA 5B2IB 3KXBD 5B2JD 4J8VD 4Z66C 3MGQB 5GT0D 3W99C 5B32B 3AZKD 3TU4C 3B6GA 4H9OB 3W96C 5AY8C 3AV1C 1P3PC 3KFUG 3MGRA 4XUJD 3AZHD 2NQBD 3B0CT 5JRGD 2HIOD 1F66C 2ZM5A 4KGCC 2FFFB 5AV6D 3KSYA 3MGRB 1KX4C 1AOIA 2DF4C 5F99D 2NZDA 2ZY2A 3MNNA 3KUYD 1ID3C 4YM6D 1AOIB 3AZID 3AV2D 2NZDB 3MNNB 3MGSC 5KDMA 2CV5D 3A1KA 3UTBC 1P3OA 5CPID 5GXQD 4Z5TA 3WTPA 4AWLC 1S32D 4NE3A 2YFWA 4QLCD 1BH8A 5KDMB 5E5AC 5AV8B 4JJNC 5B1MA 5DNNC 3UTAC 1Q9CA 2ZY5A 3WTPB 4Z5TB 3X1SA 4WZSB 5C3IB 2YFWB 1BH8B 1P3KC 4G91C 5B1LD 2JE5A 3LZ1D 5B0YB 1M18D 1BH9A 1P3LC 5B1MB 3KWQC 4H9PA 5B33A 3AYWA 3AN2B 3O62D 3EPJA 3AZMD 5B2ID 1KX3A 4E44A 2FJ7A 1BH9B 2G5HC 3AZLC 4G92C 3MGQD 4UPKA 4XZQC 3WTPE 5B32D 5B33B 5AV9C 3AYWB 2Y2LA 1M19B 1M1AA 2PYOC 1KX3B 3REKC 4YS3C 2YFVB 4X23C 1M1AB 3X1UA 3C1CA 3VH6T 1P34C 1KU5A 5DNMA 3MGRD 1EQZC 4KUDC 1TAFA 3A6NC 3NQJA 4J8VB 3X1TC 3X1UB 3W98A 3C1CB 2BYKA 2IO5B 1AOID 5AVCC 5DNMB 3AZFA 3NQJB 3WKJA 5CPJC 2NZDD 1R4VA 4XUJB 2BYKB 2JCHA 3MNND 5JRGB 4H9SA 1P3GC 5B24A 4NE6A 3WKJB 2F8NH 3AL0C 5GT3A 3MVDC 3W96A 5B31A 5B24B 1N1JA 1P3MC 1ZLAA 4Z5TD 3WTPD 5GT3B 4KGCA 1F66A 2F8NA 4WU8A 3UT9A 5B31B 3REIA 3VH5W 3RELA 1P3IC 1N1JB 1ZLAB 5B1MD 3WAAA 4EO5C 3X1SD 1F66B 1U35C 2F8NB 4WU8B 4DQYB 3UT9B 3WA9C 3AZNC 3REIB 3RELB 3WAAB 5B33D 3AYWD 4Z2MH 1JFIA 5B0ZC 3H0MC 3REJA 3AZEA 1KX3D 4H9QA 2FJ7D 4WV4B 3UTBA 4HGAB 1M1AD 1JFIB 1P3BC 3REJB 3AZEB 4J8XC 5GSUC 2J8PA 5B32G 1KX5C 4WJ3C 4R8PA 3KXBC 5B2JC 3X1UD 3C1CD 5GT0C 4J8UA 5BS7A 3AZGA 3AZKC 5DNMD 2UWXA 1P3LA 4R8PB 3KWQA 3W98D 1TZYA 4J8UB 3AZHC 2NQBC 3B6GB 3AZGB 1P3LB 3AZLA 2HIOC 4XZQA 3KWQB 2G5IC 5CHLB 5AV6C 3LJAA 3WKJD 5AV9A 1TZYB 3B6FC 2XD5A 5F99C 3EPHA 3MGPA 5B24D 3KUYC
chains in the Genus database with same CATH topology
4X23A 1HTAA 3LJAB 2F2AC 4YM6C 3B0CW 3AZIC 4LD9A 2Y2OA 5GT3D 5JA4A 3AV2C 2RVQD 3W96D 5B31D 1EQZA 5AV5A 3AFAA 3MGPB 1P3AA 4X23B 5BNVA 5CP6A 3W97A 1ZLAD 3X1TA 3REHA 3FDDA 2CV5C 4LD9B 4KGCD 1F66D 2F8ND 3UT9D 4WU8D 5GXQC 5AVCA 4DRBA 3REID 5AV5B 3AFAB 3RELD 1S32C 1P3AB 5BNVB 5CP6B 4ZBJC 4QLCC 3W97B 3WAAD 3REHB 1P3OB 4ZUXA 1PZRA 2AROA 5AVCB 1P3GA 4J8WA 3LZ0A 3LELC 5B1LC 1M18C 4ZUXB 3X1SB 3REJD 2AROB 3AZED 4J8WB 3O62C 3AZMC 3LZ0B 3UTBD 5B2IC 1P3FA 4WU9C 5AVBA 5CPKA 3MGQC 4H9PB 5B32C 1P3IA 5B40A 3C1BA 2HUEB 1P3FB 4R8PD 1WWIA 5AVBB 5CPKB 2FJ7B 3WA9A 4CAYA 4J8UD 3B6GD 3B0DB 3AZGD 5B40B 3X1VA 3C1BB 1P3LD 3KWQD 5BT1D 3MGRC 1TZYD 4CAYB 3X1VB 3AZLD 1BFMA 4XZQD 3LJAD 3EPLA 5AV9D 1AOIC 1TAFB 1P3BA 3VH6W 3W98B 2NZDC 1HQ3A 3MNNC 3MGPD 3R45A 4X23D 2DQNC 4KHAA 4Z66A 3AZFB 4LD9D 2CWEA 3EG5B 1P3BB 3W99A 3TU4A 2Y2GA 1HQ3B 1EQZD 5AV5D 3AFAD 3R45B 1A7WA 5AY8A 3AV1A 5CP6D 1P3AD 1P3PA 3W97D 4Z66B 3X1TD 3REHD 5AV8C 3W99B 5B31G 4E45A 3TU4B 1P3OD 3WTPC 5AVCD 3IP4C 5C3IC 5AY8B 3AV1B 1P3PB 3W96B 1KX4A 2F8NG 3B6FA 5B0YC 5B1MC 4ZUXD 2Y2KA 2AROD 4KGCB 1ID3A 3AN2C 4J8WD 3F6TA 1KX4B 3LZ0D 2Y2NA 3VH5T 3B6FB 1ULYA 1H3OA 2F8NK 1ID3B 5B33C 3AYWC 1M19C 3MGSA 1P3FD 1KX3C 5AVBD 5CPKD 1H3OB 2W8SA 3AZJC 1P3ID 5B40D 1M1AC 3MGSB 3C1BD 5E5AA 4H9QB 4M6BA 4JJNA 4Z2MG 5DNNA 3UTBB 3UTAA 4AWLB 3WA9D 4J8VC 3X1VD 3X1UC 1P3KA 3C1CC 5E5AB 3LELA 2IO5C 4JJNB 5DNNB 3UTAB 5DNMC 2Y2IA 2BG1A 2Y2MA 3P5JB 4H9RA 1P3KB 4G91B 4XUJC 5B2IA 4WU9A 5JRGC 3AZFD 1P3BD 4H9RB 2PYOA 4H9NA 1WWSA 3WKJC 5BNXA 1HQ3D 5G49A 3REKA 4WU9B 3EPKA 3AZLB 4Z66D 4H9SC 4G92B 4YS3A 4XZQB 5B24C 3W99D 2PYOB 5AV9B 4H9NB 3TU4D 5BNXB 5G49B 1P34A 3H0LC 3VH5A 5GT3C 5AY8D 3REKB 3AV1D 1P3PD 2RVQC 5B31C 4YS3B 2LY8A 4KUDA 3A6NA 3A1IA 1ZLAC 1P34B 1B6WA 5JA4B 5CPIC 1KX4D 3UT9C 4WU8C 1EQZB 4UUZA 5BO0A 3REIC 3RELC 3B6FD 3A6NB 4KUDB 5CPJA 3X1TB 3WAAC 1ID3D 4UUZB 5BO0B 5CPJB 3B0BA 4HGAC 3LZ1C 3MVDA 3MGSD 1P3GB 3REJC 3AZEC 4NFTA 5AV8A 1P3MA 2Y2PA 3MVDB 5E5AD 2Y2QA 4JJND 2XD1A 5B0YA 5DNND 3UTAD 1P3MB 4R8PC 1U35A 3AN2A 2VQRA 1P3KD 3AZNA 4J8UC 2Y2HA 3LELD 5BS7C 1P3IB 3B6GC 3AZGC 4EO5B 1U35B 5BT1C 1M19A 5B0ZA 3WA9B 4CSRA 1TZYC 3AZNB 4DRAA 4WU9D 2ZY3A 2YFVA 3AZJA 2RIQA 3LJAC 2PYOD 5B0ZB 4CSRB 4WNNA 4J8XA 5GSUA 3REKD 2BYMA 4YS3D 1KX5A 3MGPC 3KXBA 3AZJB 3H0RC 5B2JA 4J8VA 5GT0A 1P34D 4LD9C 4WNNB 4J8XB 5GSUB 4NE5A 3AZKA 2BYMB 1KX5B 5AV5C 1T3UA 3NQUA 3KXBB 3A6ND 3AFAC 1P3AC 4KHAB 5CP6C 5B2JB 3W97C 4KUDD 3REHC 5GT0B 4XUJA 3AZHA 2NQBA 2Y2JA 1P3OC 3AZKB 4Z5TC 5JRGA 2HIOA 1Z2CB 3NQUB 5AV6A 5CPJD 3AZHB 2NQBB 5F99A 4ZUXC 1P3GD 3X1SC 1F1EA 2AROC 2HIOB 3KUYA 5AV6B 4YM6A 4J8WC 3LZ0C 3AZIA 3MVDD 3AV2A 5F99B 3KUYB 5FUGA 5AV8D 4YM6B 1P3MD 2HUEC 3AZIB 2CV5A 1P3FC 5AVBC 1B67A 3AV2B 5CPKC 2FJ7C 5CPIA 5GXQA 1S32A 1W2EA 3B0DC 5FUGB 4QLCA 5B0YD 5B40C 3C1BC 2L5AA 2CV5B 2ZY4A 1U35D 3AN2D 5CPIB 5GXQB 3AZND 3V9RA 1S32B 4ZBJB 3X1VC 4QLCB 5B1LA 3LZ1A 3VH6A 1M18A 1M19D 5B0ZD 3V9RB 3W98C 3O62A 3AZMA 3LELB 5B1LB 3LZ1B 3AZJD 1M18B 3MGQA 3AZFC 4J8XD 5B32A 5GSUD 3O62B 3AZMB 4H9OA 1HQ3C 1KX5D 2JSSA 5B2IB 3KXBD 5B2JD 4J8VD 4Z66C 3MGQB 5GT0D 3W99C 5B32B 3AZKD 3TU4C 3B6GA 4H9OB 3W96C 5AY8C 3AV1C 1P3PC 3KFUG 3MGRA 4XUJD 3AZHD 2NQBD 3B0CT 5JRGD 2HIOD 1F66C 2ZM5A 4KGCC 2FFFB 5AV6D 3KSYA 3MGRB 1KX4C 1AOIA 2DF4C 5F99D 2NZDA 2ZY2A 3MNNA 3KUYD 1ID3C 4YM6D 1AOIB 3AZID 3AV2D 2NZDB 3MNNB 3MGSC 5KDMA 2CV5D 3A1KA 3UTBC 1P3OA 5CPID 5GXQD 4Z5TA 3WTPA 4AWLC 1S32D 4NE3A 2YFWA 4QLCD 1BH8A 5KDMB 5E5AC 5AV8B 4JJNC 5B1MA 5DNNC 3UTAC 1Q9CA 2ZY5A 3WTPB 4Z5TB 3X1SA 4WZSB 5C3IB 2YFWB 1BH8B 1P3KC 4G91C 5B1LD 2JE5A 3LZ1D 5B0YB 1M18D 1BH9A 1P3LC 5B1MB 3KWQC 4H9PA 5B33A 3AYWA 3AN2B 3O62D 3EPJA 3AZMD 5B2ID 1KX3A 4E44A 2FJ7A 1BH9B 2G5HC 3AZLC 4G92C 3MGQD 4UPKA 4XZQC 3WTPE 5B32D 5B33B 5AV9C 3AYWB 2Y2LA 1M19B 1M1AA 2PYOC 1KX3B 3REKC 4YS3C 2YFVB 4X23C 1M1AB 3X1UA 3C1CA 3VH6T 1P34C 1KU5A 5DNMA 3MGRD 1EQZC 4KUDC 1TAFA 3A6NC 3NQJA 4J8VB 3X1TC 3X1UB 3W98A 3C1CB 2BYKA 2IO5B 1AOID 5AVCC 5DNMB 3AZFA 3NQJB 3WKJA 5CPJC 2NZDD 1R4VA 4XUJB 2BYKB 2JCHA 3MNND 5JRGB 4H9SA 1P3GC 5B24A 4NE6A 3WKJB 2F8NH 3AL0C 5GT3A 3MVDC 3W96A 5B31A 5B24B 1N1JA 1P3MC 1ZLAA 4Z5TD 3WTPD 5GT3B 4KGCA 1F66A 2F8NA 4WU8A 3UT9A 5B31B 3REIA 3VH5W 3RELA 1P3IC 1N1JB 1ZLAB 5B1MD 3WAAA 4EO5C 3X1SD 1F66B 1U35C 2F8NB 4WU8B 4DQYB 3UT9B 3WA9C 3AZNC 3REIB 3RELB 3WAAB 5B33D 3AYWD 4Z2MH 1JFIA 5B0ZC 3H0MC 3REJA 3AZEA 1KX3D 4H9QA 2FJ7D 4WV4B 3UTBA 4HGAB 1M1AD 1JFIB 1P3BC 3REJB 3AZEB 4J8XC 5GSUC 2J8PA 5B32G 1KX5C 4WJ3C 4R8PA 3KXBC 5B2JC 3X1UD 3C1CD 5GT0C 4J8UA 5BS7A 3AZGA 3AZKC 5DNMD 2UWXA 1P3LA 4R8PB 3KWQA 3W98D 1TZYA 4J8UB 3AZHC 2NQBC 3B6GB 3AZGB 1P3LB 3AZLA 2HIOC 4XZQA 3KWQB 2G5IC 5CHLB 5AV6C 3LJAA 3WKJD 5AV9A 1TZYB 3B6FC 2XD5A 5F99C 3EPHA 3MGPA 5B24D 3KUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 A;  1HTA A;  3LJA B;  4YM6 C;  3B0C W;  3AZI C;  4LD9 A;  5GT3 D;  5JA4 A;  3AV2 C;  2RVQ D;  3W96 D;  5B31 D;  1EQZ A;  5AV5 A;  3AFA A;  3MGP B;  1P3A A;  4X23 B;  5BNV A;  5CP6 A;  3W97 A;  1ZLA D;  3X1T A;  3REH A;  2CV5 C;  4LD9 B;  4KGC D;  1F66 D;  2F8N D;  3UT9 D;  4WU8 D;  5GXQ C;  5AVC A;  4DRB A;  3REI D;  5AV5 B;  3AFA B;  3REL D;  1S32 C;  1P3A B;  5BNV B;  5CP6 B;  4ZBJ C;  4QLC C;  3W97 B;  3WAA D;  3REH B;  1P3O B;  4ZUX A;  2ARO A;  5AVC B;  1P3G A;  4J8W A;  3LZ0 A;  3LEL C;  5B1L C;  1M18 C;  4ZUX B;  3X1S B;  3REJ D;  2ARO B;  3AZE D;  4J8W B;  3O62 C;  3AZM C;  3LZ0 B;  3UTB D;  5B2I C;  1P3F A;  4WU9 C;  5AVB A;  5CPK A;  3MGQ C;  4H9P B;  5B32 C;  1P3I A;  5B40 A;  3C1B A;  2HUE B;  1P3F B;  4R8P D;  1WWI A;  5AVB B;  5CPK B;  2FJ7 B;  3WA9 A;  4CAY A;  4J8U D;  3B6G D;  3B0D B;  3AZG D;  5B40 B;  3X1V A;  3C1B B;  1P3L D;  3KWQ D;  5BT1 D;  3MGR C;  1TZY D;  4CAY B;  3X1V B;  3AZL D;  1BFM A;  4XZQ D;  3LJA D;  5AV9 D;  1AOI C;  1TAF B;  1P3B A;  3VH6 W;  3W98 B;  2NZD C;  1HQ3 A;  3MNN C;  3MGP D;  3R45 A;  4X23 D;  4KHA A;  4Z66 A;  3AZF B;  4LD9 D;  2CWE A;  1P3B B;  3W99 A;  3TU4 A;  1HQ3 B;  1EQZ D;  5AV5 D;  3AFA D;  3R45 B;  1A7W A;  5AY8 A;  3AV1 A;  5CP6 D;  1P3A D;  1P3P A;  3W97 D;  4Z66 B;  3X1T D;  3REH D;  5AV8 C;  3W99 B;  5B31 G;  4E45 A;  3TU4 B;  1P3O D;  3WTP C;  5AVC D;  5C3I C;  5AY8 B;  3AV1 B;  1P3P B;  3W96 B;  1KX4 A;  2F8N G;  3B6F A;  5B0Y C;  5B1M C;  4ZUX D;  2ARO D;  4KGC B;  1ID3 A;  3AN2 C;  4J8W D;  1KX4 B;  3LZ0 D;  3VH5 T;  3B6F B;  1ULY A;  1H3O A;  2F8N K;  1ID3 B;  5B33 C;  3AYW C;  1M19 C;  3MGS A;  1P3F D;  1KX3 C;  5AVB D;  5CPK D;  1H3O B;  3AZJ C;  1P3I D;  5B40 D;  1M1A C;  3MGS B;  3C1B D;  5E5A A;  4H9Q B;  4M6B A;  4JJN A;  4Z2M G;  5DNN A;  3UTB B;  3UTA A;  4AWL B;  3WA9 D;  4J8V C;  3X1V D;  3X1U C;  1P3K A;  3C1C C;  5E5A B;  3LEL A;  2IO5 C;  4JJN B;  5DNN B;  3UTA B;  5DNM C;  4H9R A;  1P3K B;  4G91 B;  4XUJ C;  5B2I A;  4WU9 A;  5JRG C;  3AZF D;  1P3B D;  4H9R B;  2PYO A;  4H9N A;  1WWS A;  3WKJ C;  5BNX A;  1HQ3 D;  5G49 A;  3REK A;  4WU9 B;  3AZL B;  4Z66 D;  4H9S C;  4G92 B;  4YS3 A;  4XZQ B;  5B24 C;  3W99 D;  2PYO B;  5AV9 B;  4H9N B;  3TU4 D;  5BNX B;  5G49 B;  1P34 A;  3VH5 A;  5GT3 C;  5AY8 D;  3REK B;  3AV1 D;  1P3P D;  2RVQ C;  5B31 C;  4YS3 B;  2LY8 A;  4KUD A;  3A6N A;  1ZLA C;  1P34 B;  1B6W A;  5JA4 B;  5CPI C;  1KX4 D;  3UT9 C;  4WU8 C;  1EQZ B;  4UUZ A;  5BO0 A;  3REI C;  3REL C;  3B6F D;  3A6N B;  4KUD B;  5CPJ A;  3X1T B;  3WAA C;  1ID3 D;  4UUZ B;  5BO0 B;  5CPJ B;  3B0B A;  4HGA C;  3LZ1 C;  3MVD A;  3MGS D;  1P3G B;  3REJ C;  3AZE C;  4NFT A;  5AV8 A;  1P3M A;  3MVD B;  5E5A D;  4JJN D;  1P3M B;  5B0Y A;  5DNN D;  3UTA D;  4R8P C;  1U35 A;  3AN2 A;  1P3K D;  3AZN A;  4J8U C;  3LEL D;  5BS7 C;  1P3I B;  3B6G C;  3AZG C;  4EO5 B;  1U35 B;  5BT1 C;  1M19 A;  5B0Z A;  3WA9 B;  4CSR A;  1TZY C;  3AZN B;  4DRA A;  4WU9 D;  2YFV A;  3AZJ A;  2PYO D;  3LJA C;  5B0Z B;  4CSR B;  4WNN A;  4J8X A;  5GSU A;  3REK D;  2BYM A;  4YS3 D;  1KX5 A;  3MGP C;  3KXB A;  3AZJ B;  5B2J A;  4J8V A;  5GT0 A;  1P34 D;  4LD9 C;  4WNN B;  4J8X B;  5GSU B;  4NE5 A;  3AZK A;  2BYM B;  1KX5 B;  5AV5 C;  3AFA C;  3NQU A;  3KXB B;  3A6N D;  1P3A C;  4KUD D;  4KHA B;  5CP6 C;  5B2J B;  3W97 C;  3REH C;  5GT0 B;  4XUJ A;  3AZH A;  2NQB A;  1P3O C;  3AZK B;  4Z5T C;  5JRG A;  2HIO A;  3NQU B;  5AV6 A;  5CPJ D;  3AZH B;  2NQB B;  5F99 A;  4ZUX C;  1P3G D;  3X1S C;  1F1E A;  2ARO C;  2HIO B;  3KUY A;  5AV6 B;  4YM6 A;  4J8W C;  3LZ0 C;  3AZI A;  3MVD D;  3AV2 A;  5F99 B;  3KUY B;  5FUG A;  5AV8 D;  4YM6 B;  1P3M D;  2HUE C;  3AZI B;  2CV5 A;  1P3F C;  5AVB C;  1B67 A;  3AV2 B;  5CPK C;  2FJ7 C;  5CPI A;  5GXQ A;  1S32 A;  3B0D C;  5FUG B;  4QLC A;  5B0Y D;  5B40 C;  3C1B C;  2L5A A;  2CV5 B;  1U35 D;  3AN2 D;  5CPI B;  5GXQ B;  3AZN D;  3V9R A;  1S32 B;  4ZBJ B;  3X1V C;  4QLC B;  5B1L A;  3LZ1 A;  3VH6 A;  1M18 A;  1M19 D;  5B0Z D;  3V9R B;  3W98 C;  3O62 A;  3AZM A;  3LEL B;  5B1L B;  3LZ1 B;  3AZJ D;  1M18 B;  3MGQ A;  3AZF C;  4J8X D;  5B32 A;  5GSU D;  3O62 B;  3AZM B;  4H9O A;  1HQ3 C;  1KX5 D;  2JSS A;  5B2I B;  3KXB D;  5B2J D;  4J8V D;  4Z66 C;  3MGQ B;  5GT0 D;  3W99 C;  5B32 B;  3AZK D;  3TU4 C;  3B6G A;  4H9O B;  3W96 C;  5AY8 C;  3AV1 C;  1P3P C;  3MGR A;  4XUJ D;  3AZH D;  2NQB D;  3B0C T;  5JRG D;  2HIO D;  1F66 C;  4KGC C;  5AV6 D;  3KSY A;  3MGR B;  1KX4 C;  1AOI A;  5F99 D;  2NZD A;  3MNN A;  3KUY D;  1ID3 C;  4YM6 D;  1AOI B;  3AZI D;  3AV2 D;  2NZD B;  3MNN B;  3MGS C;  5KDM A;  2CV5 D;  3UTB C;  1P3O A;  5CPI D;  5GXQ D;  4Z5T A;  3WTP A;  4AWL C;  1S32 D;  4NE3 A;  2YFW A;  4QLC D;  1BH8 A;  5KDM B;  5E5A C;  5AV8 B;  4JJN C;  5B1M A;  5DNN C;  3UTA C;  1Q9C A;  3WTP B;  4Z5T B;  3X1S A;  4WZS B;  5C3I B;  2YFW B;  1BH8 B;  1P3K C;  4G91 C;  5B1L D;  3LZ1 D;  5B0Y B;  1M18 D;  1BH9 A;  1P3L C;  5B1M B;  3KWQ C;  4H9P A;  5B33 A;  3AYW A;  3AN2 B;  3O62 D;  3AZM D;  5B2I D;  1KX3 A;  4E44 A;  2FJ7 A;  1BH9 B;  3AZL C;  4G92 C;  3MGQ D;  4XZQ C;  3WTP E;  5B32 D;  5B33 B;  5AV9 C;  3AYW B;  1M19 B;  1M1A A;  2PYO C;  1KX3 B;  3REK C;  4YS3 C;  2YFV B;  4X23 C;  1M1A B;  3X1U A;  3C1C A;  3VH6 T;  1P34 C;  1KU5 A;  5DNM A;  3MGR D;  1EQZ C;  4KUD C;  1TAF A;  3A6N C;  3NQJ A;  4J8V B;  3X1T C;  3X1U B;  3W98 A;  3C1C B;  2BYK A;  2IO5 B;  1AOI D;  5AVC C;  5DNM B;  3AZF A;  3NQJ B;  3WKJ A;  5CPJ C;  2NZD D;  1R4V A;  4XUJ B;  2BYK B;  3MNN D;  5JRG B;  4H9S A;  1P3G C;  5B24 A;  4NE6 A;  3WKJ B;  2F8N H;  5GT3 A;  3MVD C;  3W96 A;  5B31 A;  5B24 B;  1N1J A;  1P3M C;  1ZLA A;  4Z5T D;  3WTP D;  5GT3 B;  4KGC A;  1F66 A;  2F8N A;  4WU8 A;  3UT9 A;  5B31 B;  3REI A;  3VH5 W;  3REL A;  1P3I C;  1N1J B;  1ZLA B;  5B1M D;  3WAA A;  4EO5 C;  3X1S D;  1F66 B;  1U35 C;  2F8N B;  4WU8 B;  3UT9 B;  3WA9 C;  3AZN C;  3REI B;  3REL B;  3WAA B;  5B33 D;  3AYW D;  4Z2M H;  1JFI A;  5B0Z C;  3REJ A;  3AZE A;  1KX3 D;  4H9Q A;  2FJ7 D;  4WV4 B;  3UTB A;  4HGA B;  1M1A D;  1JFI B;  1P3B C;  3REJ B;  3AZE B;  4J8X C;  5GSU C;  5B32 G;  1KX5 C;  4R8P A;  3KXB C;  5B2J C;  3X1U D;  3C1C D;  5GT0 C;  4J8U A;  5BS7 A;  3AZG A;  3AZK C;  5DNM D;  1P3L A;  4R8P B;  3KWQ A;  3W98 D;  1TZY A;  4J8U B;  3AZH C;  2NQB C;  3B6G B;  3AZG B;  1P3L B;  3AZL A;  2HIO C;  4XZQ A;  3KWQ B;  5CHL B;  5AV6 C;  3LJA A;  3WKJ D;  5AV9 A;  1TZY B;  3B6F C;  5F99 C;  3MGP A;  5B24 D;  3KUY C; 
#chains in the Genus database with same CATH topology
 4X23 A;  1HTA A;  3LJA B;  2F2A C;  4YM6 C;  3B0C W;  3AZI C;  4LD9 A;  2Y2O A;  5GT3 D;  5JA4 A;  3AV2 C;  2RVQ D;  3W96 D;  5B31 D;  1EQZ A;  5AV5 A;  3AFA A;  3MGP B;  1P3A A;  4X23 B;  5BNV A;  5CP6 A;  3W97 A;  1ZLA D;  3X1T A;  3REH A;  3FDD A;  2CV5 C;  4LD9 B;  4KGC D;  1F66 D;  2F8N D;  3UT9 D;  4WU8 D;  5GXQ C;  5AVC A;  4DRB A;  3REI D;  5AV5 B;  3AFA B;  3REL D;  1S32 C;  1P3A B;  5BNV B;  5CP6 B;  4ZBJ C;  4QLC C;  3W97 B;  3WAA D;  3REH B;  1P3O B;  4ZUX A;  1PZR A;  2ARO A;  5AVC B;  1P3G A;  4J8W A;  3LZ0 A;  3LEL C;  5B1L C;  1M18 C;  4ZUX B;  3X1S B;  3REJ D;  2ARO B;  3AZE D;  4J8W B;  3O62 C;  3AZM C;  3LZ0 B;  3UTB D;  5B2I C;  1P3F A;  4WU9 C;  5AVB A;  5CPK A;  3MGQ C;  4H9P B;  5B32 C;  1P3I A;  5B40 A;  3C1B A;  2HUE B;  1P3F B;  4R8P D;  1WWI A;  5AVB B;  5CPK B;  2FJ7 B;  3WA9 A;  4CAY A;  4J8U D;  3B6G D;  3B0D B;  3AZG D;  5B40 B;  3X1V A;  3C1B B;  1P3L D;  3KWQ D;  5BT1 D;  3MGR C;  1TZY D;  4CAY B;  3X1V B;  3AZL D;  1BFM A;  4XZQ D;  3LJA D;  3EPL A;  5AV9 D;  1AOI C;  1TAF B;  1P3B A;  3VH6 W;  3W98 B;  2NZD C;  1HQ3 A;  3MNN C;  3MGP D;  3R45 A;  4X23 D;  2DQN C;  4KHA A;  4Z66 A;  3AZF B;  4LD9 D;  2CWE A;  3EG5 B;  1P3B B;  3W99 A;  3TU4 A;  2Y2G A;  1HQ3 B;  1EQZ D;  5AV5 D;  3AFA D;  3R45 B;  1A7W A;  5AY8 A;  3AV1 A;  5CP6 D;  1P3A D;  1P3P A;  3W97 D;  4Z66 B;  3X1T D;  3REH D;  5AV8 C;  3W99 B;  5B31 G;  4E45 A;  3TU4 B;  1P3O D;  3WTP C;  5AVC D;  3IP4 C;  5C3I C;  5AY8 B;  3AV1 B;  1P3P B;  3W96 B;  1KX4 A;  2F8N G;  3B6F A;  5B0Y C;  5B1M C;  4ZUX D;  2Y2K A;  2ARO D;  4KGC B;  1ID3 A;  3AN2 C;  4J8W D;  3F6T A;  1KX4 B;  3LZ0 D;  2Y2N A;  3VH5 T;  3B6F B;  1ULY A;  1H3O A;  2F8N K;  1ID3 B;  5B33 C;  3AYW C;  1M19 C;  3MGS A;  1P3F D;  1KX3 C;  5AVB D;  5CPK D;  1H3O B;  2W8S A;  3AZJ C;  1P3I D;  5B40 D;  1M1A C;  3MGS B;  3C1B D;  5E5A A;  4H9Q B;  4M6B A;  4JJN A;  4Z2M G;  5DNN A;  3UTB B;  3UTA A;  4AWL B;  3WA9 D;  4J8V C;  3X1V D;  3X1U C;  1P3K A;  3C1C C;  5E5A B;  3LEL A;  2IO5 C;  4JJN B;  5DNN B;  3UTA B;  5DNM C;  2Y2I A;  2BG1 A;  2Y2M A;  3P5J B;  4H9R A;  1P3K B;  4G91 B;  4XUJ C;  5B2I A;  4WU9 A;  5JRG C;  3AZF D;  1P3B D;  4H9R B;  2PYO A;  4H9N A;  1WWS A;  3WKJ C;  5BNX A;  1HQ3 D;  5G49 A;  3REK A;  4WU9 B;  3EPK A;  3AZL B;  4Z66 D;  4H9S C;  4G92 B;  4YS3 A;  4XZQ B;  5B24 C;  3W99 D;  2PYO B;  5AV9 B;  4H9N B;  3TU4 D;  5BNX B;  5G49 B;  1P34 A;  3H0L C;  3VH5 A;  5GT3 C;  5AY8 D;  3REK B;  3AV1 D;  1P3P D;  2RVQ C;  5B31 C;  4YS3 B;  2LY8 A;  4KUD A;  3A6N A;  3A1I A;  1ZLA C;  1P34 B;  1B6W A;  5JA4 B;  5CPI C;  1KX4 D;  3UT9 C;  4WU8 C;  1EQZ B;  4UUZ A;  5BO0 A;  3REI C;  3REL C;  3B6F D;  3A6N B;  4KUD B;  5CPJ A;  3X1T B;  3WAA C;  1ID3 D;  4UUZ B;  5BO0 B;  5CPJ B;  3B0B A;  4HGA C;  3LZ1 C;  3MVD A;  3MGS D;  1P3G B;  3REJ C;  3AZE C;  4NFT A;  5AV8 A;  1P3M A;  2Y2P A;  3MVD B;  5E5A D;  2Y2Q A;  4JJN D;  2XD1 A;  5B0Y A;  5DNN D;  3UTA D;  1P3M B;  4R8P C;  1U35 A;  3AN2 A;  2VQR A;  1P3K D;  3AZN A;  4J8U C;  2Y2H A;  3LEL D;  5BS7 C;  1P3I B;  3B6G C;  3AZG C;  4EO5 B;  1U35 B;  5BT1 C;  1M19 A;  5B0Z A;  3WA9 B;  4CSR A;  1TZY C;  3AZN B;  4DRA A;  4WU9 D;  2ZY3 A;  2YFV A;  3AZJ A;  2RIQ A;  3LJA C;  2PYO D;  5B0Z B;  4CSR B;  4WNN A;  4J8X A;  5GSU A;  3REK D;  2BYM A;  4YS3 D;  1KX5 A;  3MGP C;  3KXB A;  3AZJ B;  3H0R C;  5B2J A;  4J8V A;  5GT0 A;  1P34 D;  4LD9 C;  4WNN B;  4J8X B;  5GSU B;  4NE5 A;  3AZK A;  2BYM B;  1KX5 B;  5AV5 C;  1T3U A;  3NQU A;  3KXB B;  3A6N D;  3AFA C;  1P3A C;  4KHA B;  5CP6 C;  5B2J B;  3W97 C;  4KUD D;  3REH C;  5GT0 B;  4XUJ A;  3AZH A;  2NQB A;  2Y2J A;  1P3O C;  3AZK B;  4Z5T C;  5JRG A;  2HIO A;  1Z2C B;  3NQU B;  5AV6 A;  5CPJ D;  3AZH B;  2NQB B;  5F99 A;  4ZUX C;  1P3G D;  3X1S C;  1F1E A;  2ARO C;  2HIO B;  3KUY A;  5AV6 B;  4YM6 A;  4J8W C;  3LZ0 C;  3AZI A;  3MVD D;  3AV2 A;  5F99 B;  3KUY B;  5FUG A;  5AV8 D;  4YM6 B;  1P3M D;  2HUE C;  3AZI B;  2CV5 A;  1P3F C;  5AVB C;  1B67 A;  3AV2 B;  5CPK C;  2FJ7 C;  5CPI A;  5GXQ A;  1S32 A;  1W2E A;  3B0D C;  5FUG B;  4QLC A;  5B0Y D;  5B40 C;  3C1B C;  2L5A A;  2CV5 B;  2ZY4 A;  1U35 D;  3AN2 D;  5CPI B;  5GXQ B;  3AZN D;  3V9R A;  1S32 B;  4ZBJ B;  3X1V C;  4QLC B;  5B1L A;  3LZ1 A;  3VH6 A;  1M18 A;  1M19 D;  5B0Z D;  3V9R B;  3W98 C;  3O62 A;  3AZM A;  3LEL B;  5B1L B;  3LZ1 B;  3AZJ D;  1M18 B;  3MGQ A;  3AZF C;  4J8X D;  5B32 A;  5GSU D;  3O62 B;  3AZM B;  4H9O A;  1HQ3 C;  1KX5 D;  2JSS A;  5B2I B;  3KXB D;  5B2J D;  4J8V D;  4Z66 C;  3MGQ B;  5GT0 D;  3W99 C;  5B32 B;  3AZK D;  3TU4 C;  3B6G A;  4H9O B;  3W96 C;  5AY8 C;  3AV1 C;  1P3P C;  3KFU G;  3MGR A;  4XUJ D;  3AZH D;  2NQB D;  3B0C T;  5JRG D;  2HIO D;  1F66 C;  2ZM5 A;  4KGC C;  2FFF B;  5AV6 D;  3KSY A;  3MGR B;  1KX4 C;  1AOI A;  2DF4 C;  5F99 D;  2NZD A;  2ZY2 A;  3MNN A;  3KUY D;  1ID3 C;  4YM6 D;  1AOI B;  3AZI D;  3AV2 D;  2NZD B;  3MNN B;  3MGS C;  5KDM A;  2CV5 D;  3A1K A;  3UTB C;  1P3O A;  5CPI D;  5GXQ D;  4Z5T A;  3WTP A;  4AWL C;  1S32 D;  4NE3 A;  2YFW A;  4QLC D;  1BH8 A;  5KDM B;  5E5A C;  5AV8 B;  4JJN C;  5B1M A;  5DNN C;  3UTA C;  1Q9C A;  2ZY5 A;  3WTP B;  4Z5T B;  3X1S A;  4WZS B;  5C3I B;  2YFW B;  1BH8 B;  1P3K C;  4G91 C;  5B1L D;  2JE5 A;  3LZ1 D;  5B0Y B;  1M18 D;  1BH9 A;  1P3L C;  5B1M B;  3KWQ C;  4H9P A;  5B33 A;  3AYW A;  3AN2 B;  3O62 D;  3EPJ A;  3AZM D;  5B2I D;  1KX3 A;  4E44 A;  2FJ7 A;  1BH9 B;  2G5H C;  3AZL C;  4G92 C;  3MGQ D;  4UPK A;  4XZQ C;  3WTP E;  5B32 D;  5B33 B;  5AV9 C;  3AYW B;  2Y2L A;  1M19 B;  1M1A A;  2PYO C;  1KX3 B;  3REK C;  4YS3 C;  2YFV B;  4X23 C;  1M1A B;  3X1U A;  3C1C A;  3VH6 T;  1P34 C;  1KU5 A;  5DNM A;  3MGR D;  1EQZ C;  4KUD C;  1TAF A;  3A6N C;  3NQJ A;  4J8V B;  3X1T C;  3X1U B;  3W98 A;  3C1C B;  2BYK A;  2IO5 B;  1AOI D;  5AVC C;  5DNM B;  3AZF A;  3NQJ B;  3WKJ A;  5CPJ C;  2NZD D;  1R4V A;  4XUJ B;  2BYK B;  2JCH A;  3MNN D;  5JRG B;  4H9S A;  1P3G C;  5B24 A;  4NE6 A;  3WKJ B;  2F8N H;  3AL0 C;  5GT3 A;  3MVD C;  3W96 A;  5B31 A;  5B24 B;  1N1J A;  1P3M C;  1ZLA A;  4Z5T D;  3WTP D;  5GT3 B;  4KGC A;  1F66 A;  2F8N A;  4WU8 A;  3UT9 A;  5B31 B;  3REI A;  3VH5 W;  3REL A;  1P3I C;  1N1J B;  1ZLA B;  5B1M D;  3WAA A;  4EO5 C;  3X1S D;  1F66 B;  1U35 C;  2F8N B;  4WU8 B;  4DQY B;  3UT9 B;  3WA9 C;  3AZN C;  3REI B;  3REL B;  3WAA B;  5B33 D;  3AYW D;  4Z2M H;  1JFI A;  5B0Z C;  3H0M C;  3REJ A;  3AZE A;  1KX3 D;  4H9Q A;  2FJ7 D;  4WV4 B;  3UTB A;  4HGA B;  1M1A D;  1JFI B;  1P3B C;  3REJ B;  3AZE B;  4J8X C;  5GSU C;  2J8P A;  5B32 G;  1KX5 C;  4WJ3 C;  4R8P A;  3KXB C;  5B2J C;  3X1U D;  3C1C D;  5GT0 C;  4J8U A;  5BS7 A;  3AZG A;  3AZK C;  5DNM D;  2UWX A;  1P3L A;  4R8P B;  3KWQ A;  3W98 D;  1TZY A;  4J8U B;  3AZH C;  2NQB C;  3B6G B;  3AZG B;  1P3L B;  3AZL A;  2HIO C;  4XZQ A;  3KWQ B;  2G5I C;  5CHL B;  5AV6 C;  3LJA A;  3WKJ D;  5AV9 A;  1TZY B;  3B6F C;  2XD5 A;  5F99 C;  3EPH A;  3MGP A;  5B24 D;  3KUY C; 
#chains in the Genus database with same CATH homology
 4X23 A;  1HTA A;  3LJA B;  2F2A C;  4YM6 C;  3B0C W;  3AZI C;  4LD9 A;  2Y2O A;  5GT3 D;  5JA4 A;  3AV2 C;  2RVQ D;  3W96 D;  5B31 D;  1EQZ A;  5AV5 A;  3AFA A;  3MGP B;  1P3A A;  4X23 B;  5BNV A;  5CP6 A;  3W97 A;  1ZLA D;  3X1T A;  3REH A;  3FDD A;  2CV5 C;  4LD9 B;  4KGC D;  1F66 D;  2F8N D;  3UT9 D;  4WU8 D;  5GXQ C;  5AVC A;  4DRB A;  3REI D;  5AV5 B;  3AFA B;  3REL D;  1S32 C;  1P3A B;  5BNV B;  5CP6 B;  4ZBJ C;  4QLC C;  3W97 B;  3WAA D;  3REH B;  1P3O B;  4ZUX A;  1PZR A;  2ARO A;  5AVC B;  1P3G A;  4J8W A;  3LZ0 A;  3LEL C;  5B1L C;  1M18 C;  4ZUX B;  3X1S B;  3REJ D;  2ARO B;  3AZE D;  4J8W B;  3O62 C;  3AZM C;  3LZ0 B;  3UTB D;  5B2I C;  1P3F A;  4WU9 C;  5AVB A;  5CPK A;  3MGQ C;  4H9P B;  5B32 C;  1P3I A;  5B40 A;  3C1B A;  2HUE B;  1P3F B;  4R8P D;  1WWI A;  5AVB B;  5CPK B;  2FJ7 B;  3WA9 A;  4CAY A;  4J8U D;  3B6G D;  3B0D B;  3AZG D;  5B40 B;  3X1V A;  3C1B B;  1P3L D;  3KWQ D;  5BT1 D;  3MGR C;  1TZY D;  4CAY B;  3X1V B;  3AZL D;  1BFM A;  4XZQ D;  3LJA D;  3EPL A;  5AV9 D;  1AOI C;  1TAF B;  1P3B A;  3VH6 W;  3W98 B;  2NZD C;  1HQ3 A;  3MNN C;  3MGP D;  3R45 A;  4X23 D;  2DQN C;  4KHA A;  4Z66 A;  3AZF B;  4LD9 D;  2CWE A;  3EG5 B;  1P3B B;  3W99 A;  3TU4 A;  2Y2G A;  1HQ3 B;  1EQZ D;  5AV5 D;  3AFA D;  3R45 B;  1A7W A;  5AY8 A;  3AV1 A;  5CP6 D;  1P3A D;  1P3P A;  3W97 D;  4Z66 B;  3X1T D;  3REH D;  5AV8 C;  3W99 B;  5B31 G;  4E45 A;  3TU4 B;  1P3O D;  3WTP C;  5AVC D;  3IP4 C;  5C3I C;  5AY8 B;  3AV1 B;  1P3P B;  3W96 B;  1KX4 A;  2F8N G;  3B6F A;  5B0Y C;  5B1M C;  4ZUX D;  2Y2K A;  2ARO D;  4KGC B;  1ID3 A;  3AN2 C;  4J8W D;  3F6T A;  1KX4 B;  3LZ0 D;  2Y2N A;  3VH5 T;  3B6F B;  1ULY A;  1H3O A;  2F8N K;  1ID3 B;  5B33 C;  3AYW C;  1M19 C;  3MGS A;  1P3F D;  1KX3 C;  5AVB D;  5CPK D;  1H3O B;  2W8S A;  3AZJ C;  1P3I D;  5B40 D;  1M1A C;  3MGS B;  3C1B D;  5E5A A;  4H9Q B;  4M6B A;  4JJN A;  4Z2M G;  5DNN A;  3UTB B;  3UTA A;  4AWL B;  3WA9 D;  4J8V C;  3X1V D;  3X1U C;  1P3K A;  3C1C C;  5E5A B;  3LEL A;  2IO5 C;  4JJN B;  5DNN B;  3UTA B;  5DNM C;  2Y2I A;  2BG1 A;  2Y2M A;  3P5J B;  4H9R A;  1P3K B;  4G91 B;  4XUJ C;  5B2I A;  4WU9 A;  5JRG C;  3AZF D;  1P3B D;  4H9R B;  2PYO A;  4H9N A;  1WWS A;  3WKJ C;  5BNX A;  1HQ3 D;  5G49 A;  3REK A;  4WU9 B;  3EPK A;  3AZL B;  4Z66 D;  4H9S C;  4G92 B;  4YS3 A;  4XZQ B;  5B24 C;  3W99 D;  2PYO B;  5AV9 B;  4H9N B;  3TU4 D;  5BNX B;  5G49 B;  1P34 A;  3H0L C;  3VH5 A;  5GT3 C;  5AY8 D;  3REK B;  3AV1 D;  1P3P D;  2RVQ C;  5B31 C;  4YS3 B;  2LY8 A;  4KUD A;  3A6N A;  3A1I A;  1ZLA C;  1P34 B;  1B6W A;  5JA4 B;  5CPI C;  1KX4 D;  3UT9 C;  4WU8 C;  1EQZ B;  4UUZ A;  5BO0 A;  3REI C;  3REL C;  3B6F D;  3A6N B;  4KUD B;  5CPJ A;  3X1T B;  3WAA C;  1ID3 D;  4UUZ B;  5BO0 B;  5CPJ B;  3B0B A;  4HGA C;  3LZ1 C;  3MVD A;  3MGS D;  1P3G B;  3REJ C;  3AZE C;  4NFT A;  5AV8 A;  1P3M A;  2Y2P A;  3MVD B;  5E5A D;  2Y2Q A;  4JJN D;  2XD1 A;  5B0Y A;  5DNN D;  3UTA D;  1P3M B;  4R8P C;  1U35 A;  3AN2 A;  2VQR A;  1P3K D;  3AZN A;  4J8U C;  2Y2H A;  3LEL D;  5BS7 C;  1P3I B;  3B6G C;  3AZG C;  4EO5 B;  1U35 B;  5BT1 C;  1M19 A;  5B0Z A;  3WA9 B;  4CSR A;  1TZY C;  3AZN B;  4DRA A;  4WU9 D;  2ZY3 A;  2YFV A;  3AZJ A;  2RIQ A;  3LJA C;  2PYO D;  5B0Z B;  4CSR B;  4WNN A;  4J8X A;  5GSU A;  3REK D;  2BYM A;  4YS3 D;  1KX5 A;  3MGP C;  3KXB A;  3AZJ B;  3H0R C;  5B2J A;  4J8V A;  5GT0 A;  1P34 D;  4LD9 C;  4WNN B;  4J8X B;  5GSU B;  4NE5 A;  3AZK A;  2BYM B;  1KX5 B;  5AV5 C;  1T3U A;  3NQU A;  3KXB B;  3A6N D;  3AFA C;  1P3A C;  4KHA B;  5CP6 C;  5B2J B;  3W97 C;  4KUD D;  3REH C;  5GT0 B;  4XUJ A;  3AZH A;  2NQB A;  2Y2J A;  1P3O C;  3AZK B;  4Z5T C;  5JRG A;  2HIO A;  1Z2C B;  3NQU B;  5AV6 A;  5CPJ D;  3AZH B;  2NQB B;  5F99 A;  4ZUX C;  1P3G D;  3X1S C;  1F1E A;  2ARO C;  2HIO B;  3KUY A;  5AV6 B;  4YM6 A;  4J8W C;  3LZ0 C;  3AZI A;  3MVD D;  3AV2 A;  5F99 B;  3KUY B;  5FUG A;  5AV8 D;  4YM6 B;  1P3M D;  2HUE C;  3AZI B;  2CV5 A;  1P3F C;  5AVB C;  1B67 A;  3AV2 B;  5CPK C;  2FJ7 C;  5CPI A;  5GXQ A;  1S32 A;  1W2E A;  3B0D C;  5FUG B;  4QLC A;  5B0Y D;  5B40 C;  3C1B C;  2L5A A;  2CV5 B;  2ZY4 A;  1U35 D;  3AN2 D;  5CPI B;  5GXQ B;  3AZN D;  3V9R A;  1S32 B;  4ZBJ B;  3X1V C;  4QLC B;  5B1L A;  3LZ1 A;  3VH6 A;  1M18 A;  1M19 D;  5B0Z D;  3V9R B;  3W98 C;  3O62 A;  3AZM A;  3LEL B;  5B1L B;  3LZ1 B;  3AZJ D;  1M18 B;  3MGQ A;  3AZF C;  4J8X D;  5B32 A;  5GSU D;  3O62 B;  3AZM B;  4H9O A;  1HQ3 C;  1KX5 D;  2JSS A;  5B2I B;  3KXB D;  5B2J D;  4J8V D;  4Z66 C;  3MGQ B;  5GT0 D;  3W99 C;  5B32 B;  3AZK D;  3TU4 C;  3B6G A;  4H9O B;  3W96 C;  5AY8 C;  3AV1 C;  1P3P C;  3KFU G;  3MGR A;  4XUJ D;  3AZH D;  2NQB D;  3B0C T;  5JRG D;  2HIO D;  1F66 C;  2ZM5 A;  4KGC C;  2FFF B;  5AV6 D;  3KSY A;  3MGR B;  1KX4 C;  1AOI A;  2DF4 C;  5F99 D;  2NZD A;  2ZY2 A;  3MNN A;  3KUY D;  1ID3 C;  4YM6 D;  1AOI B;  3AZI D;  3AV2 D;  2NZD B;  3MNN B;  3MGS C;  5KDM A;  2CV5 D;  3A1K A;  3UTB C;  1P3O A;  5CPI D;  5GXQ D;  4Z5T A;  3WTP A;  4AWL C;  1S32 D;  4NE3 A;  2YFW A;  4QLC D;  1BH8 A;  5KDM B;  5E5A C;  5AV8 B;  4JJN C;  5B1M A;  5DNN C;  3UTA C;  1Q9C A;  2ZY5 A;  3WTP B;  4Z5T B;  3X1S A;  4WZS B;  5C3I B;  2YFW B;  1BH8 B;  1P3K C;  4G91 C;  5B1L D;  2JE5 A;  3LZ1 D;  5B0Y B;  1M18 D;  1BH9 A;  1P3L C;  5B1M B;  3KWQ C;  4H9P A;  5B33 A;  3AYW A;  3AN2 B;  3O62 D;  3EPJ A;  3AZM D;  5B2I D;  1KX3 A;  4E44 A;  2FJ7 A;  1BH9 B;  2G5H C;  3AZL C;  4G92 C;  3MGQ D;  4UPK A;  4XZQ C;  3WTP E;  5B32 D;  5B33 B;  5AV9 C;  3AYW B;  2Y2L A;  1M19 B;  1M1A A;  2PYO C;  1KX3 B;  3REK C;  4YS3 C;  2YFV B;  4X23 C;  1M1A B;  3X1U A;  3C1C A;  3VH6 T;  1P34 C;  1KU5 A;  5DNM A;  3MGR D;  1EQZ C;  4KUD C;  1TAF A;  3A6N C;  3NQJ A;  4J8V B;  3X1T C;  3X1U B;  3W98 A;  3C1C B;  2BYK A;  2IO5 B;  1AOI D;  5AVC C;  5DNM B;  3AZF A;  3NQJ B;  3WKJ A;  5CPJ C;  2NZD D;  1R4V A;  4XUJ B;  2BYK B;  2JCH A;  3MNN D;  5JRG B;  4H9S A;  1P3G C;  5B24 A;  4NE6 A;  3WKJ B;  2F8N H;  3AL0 C;  5GT3 A;  3MVD C;  3W96 A;  5B31 A;  5B24 B;  1N1J A;  1P3M C;  1ZLA A;  4Z5T D;  3WTP D;  5GT3 B;  4KGC A;  1F66 A;  2F8N A;  4WU8 A;  3UT9 A;  5B31 B;  3REI A;  3VH5 W;  3REL A;  1P3I C;  1N1J B;  1ZLA B;  5B1M D;  3WAA A;  4EO5 C;  3X1S D;  1F66 B;  1U35 C;  2F8N B;  4WU8 B;  4DQY B;  3UT9 B;  3WA9 C;  3AZN C;  3REI B;  3REL B;  3WAA B;  5B33 D;  3AYW D;  4Z2M H;  1JFI A;  5B0Z C;  3H0M C;  3REJ A;  3AZE A;  1KX3 D;  4H9Q A;  2FJ7 D;  4WV4 B;  3UTB A;  4HGA B;  1M1A D;  1JFI B;  1P3B C;  3REJ B;  3AZE B;  4J8X C;  5GSU C;  2J8P A;  5B32 G;  1KX5 C;  4WJ3 C;  4R8P A;  3KXB C;  5B2J C;  3X1U D;  3C1C D;  5GT0 C;  4J8U A;  5BS7 A;  3AZG A;  3AZK C;  5DNM D;  2UWX A;  1P3L A;  4R8P B;  3KWQ A;  3W98 D;  1TZY A;  4J8U B;  3AZH C;  2NQB C;  3B6G B;  3AZG B;  1P3L B;  3AZL A;  2HIO C;  4XZQ A;  3KWQ B;  2G5I C;  5CHL B;  5AV6 C;  3LJA A;  3WKJ D;  5AV9 A;  1TZY B;  3B6F C;  2XD5 A;  5F99 C;  3EPH A;  3MGP A;  5B24 D;  3KUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...