5B1LA

The mouse nucleosome structure containing h3t
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lA00
5B32G 1AOID 2F8NA 5B0YD 3UTBD 2CV5D 5BT1D 1P3FA 1EQZD 1AOIA 1P3KA 3UTBA 3KWQD 5AV6B 5DNND 3REJC 5CPKC 3C1CC 3A6NC 4H9SA 3R45A 3KWQA 3W96A 4NFTA 3MGSB 2JSSA 5B32B 2PYOC 3TU4C 3AZHC 4Z5TB 5DNMC 1TZYC 3REHA 5GXQD 3AN2C 3MGPB 3W99D 1P3MB 4H9RB 4R8PD 3LZ0C 3LJAC 3AZGA 3AZNA 5FUGA 5CPJB 4QLCC 3X1UD 4HGAC 4JJND 3AV2B 3X1SC 3W97C 5AV9D 3WTPC 4H9NB 3LZ1A 3AZFC 3B6FB 5CP6B 2HIOD 1P3LB 4H9PA 3AZJB 2L5AA 4Z66B 5B24C 2FJ7D 5BS7A 1F1EA 1P3OC 3MVDC 3AZJA 3NQUB 4UUZB 1P3PB 3AZLC 1U35B 4KUDB 3UTAB 3V9RA 4X23C 1ZLAB 1M19B 1HQ3D 4UUZA 1ID3B 3AZEB 4Z2MH 2NZDC 3C1BC 1P3IB 5JA4B 4J8WC 3UT9D 3B0BA 3W98B 3KUYA 3AYWD 5B1MB 2AROB 3A6NB 3MNND 2CWEA 5B31D 3WAAC 1N1JB 3LELD 3MNNA 5B2IA 3KXBD 1P34D 2BYMA 1P3GD 3REJB 3B0CT 5CPKB 3C1CB 3KXBA 3WA9C 5F99A 5GSUD 4J8VD 5BNXA 5B1LC 4J8VA 1KX5C 4WU8D 2PYOB 2BYKB 3TU4B 5DNMB 1TZYB 5B0YC 2CV5C 1BH9B 4LD9D 5BT1C 1EQZC 3X1VD 1M1AC 5CHLB 5DNNC 3LZ0B 4J8UD 1P3BD 1M18D 3VH6T 3LJAB 4H9QB 4J8UA 4YS3D 5GT3A 4QLCB 4WNNA 4HGAB 3X1SB 3W97B 3WTPB 3AZFB 4XZQC 3REID 5GXQC 5JRGD 4H9OA 3W99C 4CSRA 5B24B 4R8PC 1KX4A 2RVQD 3X1TD 4KGCD 3RELC 1P3OB 3MVDB 3X1UC 2NQBC 5AVBD 4JJNC 3AZLB 5AV9C 4G92C 4J8XD 5E5AA 2HIOC 4WV4B 5CPID 4WU9D 4X23B 4ZUXB 4WU9A 2FJ7C 4CAYA 3AZMA 3AFAD 2NZDB 3C1BB 3O62A 4ZUXA 4J8WB 5AV8D 1H3OB 2F8ND 5KDMA 5GT0C 5B33A 5AV5D 1P3FD 1HQ3C 4WZSB 1P3KD 3B6GA 1S32D 1F66A 5AV5A 3WAAB 5AVCA 4YM6C 1S32A 3W96D 1JFIA 5G49B 2F8NH 3UT9C 3WA9B 3AYWC 1HTAA 5BNVB 3REHD 5B1LB 2HUEC 1KX5B 5AV6A 5B31C 2CV5B 1P3AC 3LELC 3AZIC 3AZGD 3AZND 1EQZB 1P34C 1M1AB 3MGSA 1P3GC 5DNNB 4XUJC 5B32A 4Z5TA 5GSUC 5B0ZC 1BH8B 3LZ1D 3MGPD 1R4VA 2YFWB 3WKJC 3MGRB 3MGPA 1B67A 4WU8C 4NE3A 4H9RA 1P3MA 4XZQB 5B40C 5CPJD 4E44A 3AV1B 4LD9C 5GXQB 3KSYA 3X1VC 5CPJA 3W99B 2IO5C 3AZJD 3AV2A 4R8PB 3MGRA 1P3BC 1M18C 4H9NA 5AY8C 3B6FA 5CP6A 3RELB 1P3LA 3AV1A 4YS3C 3X1UB 2NQBB 4JJNB 4Z66A 5AV9B 4G92B 4Z2MG 1KX3C 2HIOB 3REIC 5JRGC 3UTAD 3NQUA 1P3PA 1U35A 2FJ7B 4KUDA 2RVQC 3UTAA 3X1TC 5B2JC 1ZLAD 4KGCC 3MGQC 3REKC 3KUYD 1ZLAA 5AVBC 1M19A 4J8XC 3AZED 1P3ID 1ID3A 2YFVB 5CPIC 5GT0B 1BFMA 4NE5A 3AZEA 3VH5A 3AZKB 1P3IA 1HQ3B 3W98D 5JA4A 5B2ID 5B1MD 5B31G 3W98A 3AFAC 4YM6B 5B1MA 5F99D 2AROA 3A6NA 2LY8A 3UT9B 3AZKA 5AV8C 3AYWB 4KHAB 1N1JA 5CPKD 1P3FC 2HUEB 3AZHB 1AOIC 1P3KC 3REJA 3UTBC 5B31B 3C1CA 5CPKA 1P3AB 3LELB 3AZIB 4H9SC 3AN2B 3KWQC 3W96C 1P34B 1P3GB 4XUJB 5GT3D 2PYOA 2BYKA 3TU4A 3AZHA 5DNMA 5GSUB 1TZYA 5B0ZB 1BH9A 3WKJB 1TAFB 3REHC 3AN2A 4WU8B 5BO0B 5B40B 3LZ0A 3LJAA 4LD9B 4H9QA 1KX4D 3X1SD 3AZGC 3AZNC 3W97D 3AZFD 3X1VB 2IO5B 4QLCA 3X1SA 3W97A 4DRAA 3WTPA 3AZFA 1P3BB 1M18B 5AY8B 5E5AD 3LZ1C 4YS3B 5B24A 1KX3B 3REIB 5BS7C 1P3OA 1ULYA 4ZBJC 5JRGB 3MVDA 3AZMD 3O62D 3AZJC 3AZLA 4ZUXD 5B2JB 3X1TB 4KGCB 3MGQB 3REKB 1A7WA 4X23A 5B33D 4J8XB 2NZDD 3C1BD 3B6GD 5CPIB 1F66D 2F8NG 2NZDA 3C1BA 5AVCD 3NQJB 4EO5C 4J8WA 3B0DC 3AFAB 1H3OA 3KUYC 1B6WA 3VH5W 5AV8B 5AV6D 3WAAA 2F8NB 3MNNC 1P3FB 5G49A 5B2IC 1P3KB 1AOIB 5B0YB 3UTBB 3MGSD 3WA9A 5B32D 4Z5TD 3R45B 5F99C 3KXBC 3KWQB 1KX5D 3W96B 5BNVA 5B1LA 1KX5A 1Q9CA 4J8VC 4E45A 1WWSA 1P3MD 5B0YA 2CV5A 1M1AD 1EQZA 3REHB 1M1AA 5DNNA 3AV2D 3MGRD 1BH8A 3AZNB 3AZGB 3B6FD 2YFWA 5CP6D 1P3LD 4XZQD 4J8UC 5FUGB 3AV1D 5GT3C 4Z66D 4XZQA 3LZ1B 4H9PB 5GXQA 5C3IC 3W99A 3RELD 4R8PA 3AZKC 1P3PD 1U35D 4KUDD 1KX4C 2NQBD 3RELA 4ZBJB 3X1UA 2NQBA 4JJNA 5AV9A 1M19D 3VH6A 2HIOA 5E5AC 1ID3D 3V9RB 2FJ7A 4WU9C 3WTPE 3AZMC 4EO5B 3O62C 5GT0D 2AROD 4AWLC 4ZUXC 3A6ND 3B0DB 3AZKD 2YFVA 3KUYB 5GT0A 5B33C 1HQ3A 4YM6D 3B6GC 3REJD 1F66C 3C1CD 5AV5C 4YM6A 5AVCC 3MNNB 1S32C 5B2IB 4G91C 2BYMB 3UT9A 4M6BA 3AYWA 2PYOD 4KHAA 3TU4D 3KXBB 5DNMD 5F99B 1TZYD 3AZHD 5BNXB 1P3AD 3AZID 4J8VB 3AN2D 5B31A 5AV6C 1P3AA 3LZ0D 3LELA 3AZIA 3LJAD 4XUJD 1P34A 5B0ZD 1P3GA 3MGSC 3WKJD 4XUJA 4QLCD 5GSUA 5B32C 5B0ZA 3WTPD 4Z5TC 3WKJA 5B40D 1TAFA 4J8UB 4WU8A 5GT3B 4WNNB 5BO0A 3MGPC 5B40A 1P3MC 5B24D 4LD9A 3X1VA 5AY8D 5C3IB 1P3OD 3MVDD 5CPJC 4H9OB 1WWIA 4CSRB 1P3BA 1M18A 3AV2C 3B0CW 3MGRC 5AY8A 3AZLD 1KX4B 3B6FC 5CP6C 1P3LC 4YS3A 1KX3D 1KU5A 3AV1C 4X23D 3VH5T 4Z66C 1KX3A 2F8NK 5E5AB 3REIA 5AVBB 5JRGA 5B2JD 3MGQD 3REKD 1P3PC 4WU9B 1U35C 4DRBA 5B2JA 4J8WD 3X1TA 4KGCA 3UTAC 4KUDC 4CAYB 3VH6W 3MGQA 3REKA 3AZMB 3O62B 5AVBA 1ZLAC 4J8XA 4AWLB 1M19C 5CPIA 1ID3C 3WAAD 5KDMB 3NQJA 5B33B 3AZEC 1P3IC 3B6GB 1F66B 5AV5B 3AFAA 3W98C 3WA9D 4NE6A 5AVCB 5B1MC 1S32B 4G91B 1JFIB 2AROC 5B1LD 5AV8A
chains in the Genus database with same CATH superfamily
5B32G 1AOID 2F8NA 5B0YD 3UTBD 2CV5D 5BT1D 1P3FA 1EQZD 1AOIA 1P3KA 3UTBA 3KWQD 5AV6B 5DNND 3REJC 5CPKC 3C1CC 3A6NC 4H9SA 3R45A 3KWQA 3W96A 4NFTA 3MGSB 2JSSA 5B32B 2PYOC 3TU4C 3AZHC 4Z5TB 5DNMC 1TZYC 2Y2HA 3REHA 5GXQD 3AN2C 3MGPB 3W99D 1P3MB 4H9RB 4R8PD 3LZ0C 3LJAC 3AZGA 3AZNA 3P5JB 2XD5A 3EG5B 5FUGA 5CPJB 4QLCC 3X1UD 4HGAC 4JJND 3AV2B 3X1SC 3W97C 5AV9D 3WTPC 4H9NB 3LZ1A 3AZFC 3B6FB 5CP6B 2HIOD 1P3LB 4H9PA 3AZJB 2L5AA 4Z66B 5B24C 2FJ7D 5BS7A 1F1EA 1P3OC 3MVDC 3KFUG 3AZJA 3NQUB 4UUZB 1P3PB 3AZLC 1U35B 4KUDB 3UTAB 3V9RA 4X23C 1ZLAB 1M19B 1HQ3D 4UUZA 1ID3B 3AZEB 4Z2MH 2NZDC 3C1BC 1P3IB 5JA4B 3EPHA 4J8WC 3UT9D 3B0BA 3W98B 3KUYA 3AYWD 1W2EA 5B1MB 2AROB 3A6NB 3MNND 2CWEA 5B31D 2ZY2A 3WAAC 1N1JB 3LELD 3MNNA 5B2IA 3KXBD 1P34D 2BYMA 1P3GD 3REJB 3B0CT 5CPKB 3C1CB 3KXBA 3WA9C 5F99A 5GSUD 4J8VD 5BNXA 5B1LC 4J8VA 1KX5C 4WU8D 2PYOB 2BYKB 3TU4B 5DNMB 1TZYB 5B0YC 2CV5C 1BH9B 4LD9D 5BT1C 1EQZC 3X1VD 1M1AC 5CHLB 5DNNC 3LZ0B 4J8UD 1P3BD 1M18D 3VH6T 3LJAB 4H9QB 2ZY4A 4J8UA 4YS3D 5GT3A 4WNNA 4QLCB 2BG1A 4HGAB 3X1SB 3W97B 3WTPB 3AZFB 4XZQC 3REID 5GXQC 5JRGD 3H0RC 4H9OA 3W99C 4CSRA 5B24B 4R8PC 2VQRA 1KX4A 2RVQD 3X1TD 4KGCD 3RELC 1P3OB 3MVDB 3X1UC 2NQBC 5AVBD 2Y2OA 4JJNC 3AZLB 5AV9C 4G92C 4J8XD 5E5AA 2HIOC 4WV4B 5CPID 4WU9D 4X23B 4ZUXB 4WU9A 2FJ7C 4CAYA 3AZMA 3AFAD 2NZDB 3C1BB 3O62A 4ZUXA 4J8WB 2F2AC 5AV8D 1H3OB 2F8ND 5KDMA 5GT0C 5B33A 5AV5D 2Y2MA 1P3FD 1HQ3C 4WZSB 1P3KD 3B6GA 1S32D 1F66A 5AV5A 3WAAB 5AVCA 4YM6C 1S32A 2ZY3A 3W96D 1JFIA 5G49B 2F8NH 3UT9C 1Z2CB 3WA9B 3AYWC 2Y2IA 1HTAA 5BNVB 2W8SA 3REHD 5B1LB 2HUEC 1KX5B 5AV6A 5B31C 2CV5B 1P3AC 3LELC 3AZIC 3AZGD 3AZND 1EQZB 1P34C 1M1AB 3MGSA 1P3GC 5DNNB 4XUJC 5B32A 4Z5TA 5GSUC 5B0ZC 1BH8B 3LZ1D 3MGPD 1R4VA 2YFWB 3WKJC 3MGRB 3MGPA 1B67A 4WU8C 4NE3A 4H9RA 1P3MA 4XZQB 5B40C 5CPJD 4E44A 3AV1B 4LD9C 5GXQB 3KSYA 3X1VC 5CPJA 2DQNC 3W99B 2IO5C 3AZJD 3AV2A 4R8PB 3MGRA 1P3BC 1M18C 4H9NA 5AY8C 3B6FA 5CP6A 2Y2PA 3RELB 1P3LA 3AV1A 4YS3C 3X1UB 2NQBB 4JJNB 4Z66A 5AV9B 4G92B 4Z2MG 1KX3C 2HIOB 3REIC 4UPKA 5JRGC 3UTAD 3NQUA 1P3PA 1U35A 2FJ7B 4KUDA 2RVQC 3UTAA 3X1TC 5B2JC 1ZLAD 4KGCC 3EPKA 3MGQC 3REKC 3KUYD 1ZLAA 5AVBC 1M19A 4J8XC 3AZED 3IP4C 1P3ID 1ID3A 2YFVB 5CPIC 5GT0B 1BFMA 4NE5A 3AZEA 3VH5A 3AZKB 1P3IA 1HQ3B 3W98D 5JA4A 5B2ID 5B1MD 5B31G 3W98A 3AFAC 4YM6B 5B1MA 5F99D 2FFFB 2AROA 2Y2GA 3A6NA 2ZM5A 2LY8A 3UT9B 3AZKA 5AV8C 3AYWB 4KHAB 1N1JA 5CPKD 2ZY5A 1P3FC 2HUEB 3AZHB 1AOIC 1P3KC 3REJA 3H0MC 3UTBC 5B31B 3C1CA 5CPKA 1P3AB 3LELB 3AZIB 4H9SC 3AN2B 3KWQC 3W96C 1P34B 1P3GB 4XUJB 5GT3D 2PYOA 2BYKA 3TU4A 3AZHA 5DNMA 5GSUB 1TZYA 5B0ZB 1BH9A 3WKJB 1TAFB 3REHC 3AN2A 4WU8B 5BO0B 5B40B 3LZ0A 3LJAA 4LD9B 4H9QA 3A1IA 1KX4D 3X1SD 3AZGC 3AZNC 3W97D 3AZFD 3X1VB 2IO5B 4QLCA 3X1SA 3W97A 4DRAA 3WTPA 3AZFA 1P3BB 1M18B 5AY8B 5E5AD 3LZ1C 4YS3B 5B24A 1KX3B 3REIB 5BS7C 1P3OA 1ULYA 4ZBJC 5JRGB 3MVDA 3AZMD 3O62D 3AZJC 3AZLA 2JE5A 4ZUXD 5B2JB 3X1TB 4KGCB 3MGQB 3REKB 1A7WA 2RIQA 4X23A 5B33D 4J8XB 2NZDD 3C1BD 3B6GD 5CPIB 1F66D 2F8NG 2NZDA 3C1BA 5AVCD 3NQJB 3F6TA 4EO5C 4J8WA 3AL0C 3B0DC 3AFAB 1H3OA 3KUYC 1B6WA 3VH5W 5AV6D 5AV8B 3WAAA 2F8NB 3MNNC 1P3FB 5G49A 5B2IC 1P3KB 1AOIB 5B0YB 3UTBB 3MGSD 3WA9A 5B32D 4Z5TD 3R45B 5F99C 3KXBC 3KWQB 1KX5D 3W96B 5BNVA 5B1LA 1KX5A 1Q9CA 4J8VC 4E45A 1WWSA 1P3MD 5B0YA 2CV5A 1M1AD 1EQZA 3REHB 1M1AA 5DNNA 3AV2D 3MGRD 2G5IC 1BH8A 3AZNB 3AZGB 3B6FD 2DF4C 2YFWA 5CP6D 1P3LD 4XZQD 4J8UC 5FUGB 3AV1D 5GT3C 4Z66D 4XZQA 3LZ1B 4WJ3C 4H9PB 5GXQA 5C3IC 3W99A 3RELD 4R8PA 3AZKC 1P3PD 1U35D 4KUDD 1KX4C 2NQBD 3RELA 4ZBJB 3FDDA 3X1UA 2NQBA 4JJNA 5AV9A 1M19D 3VH6A 2HIOA 5E5AC 1ID3D 3H0LC 3V9RB 2XD1A 2FJ7A 4WU9C 2Y2NA 3WTPE 3AZMC 4EO5B 3O62C 5GT0D 2AROD 4AWLC 4ZUXC 3A6ND 3B0DB 3AZKD 2YFVA 3KUYB 5GT0A 3EPJA 5B33C 1HQ3A 4YM6D 3B6GC 3REJD 1F66C 3C1CD 5AV5C 4DQYB 4YM6A 5AVCC 3MNNB 1S32C 5B2IB 4G91C 2BYMB 2UWXA 3UT9A 4M6BA 3AYWA 2PYOD 4KHAA 3TU4D 3KXBB 5DNMD 5F99B 1TZYD 2Y2QA 5BNXB 3AZHD 2Y2JA 1P3AD 3AZID 4J8VB 3AN2D 5B31A 5AV6C 1P3AA 3LZ0D 3LELA 3AZIA 3LJAD 4XUJD 1P34A 5B0ZD 1P3GA 3MGSC 3WKJD 4XUJA 4QLCD 5GSUA 5B32C 5B0ZA 3WTPD 4Z5TC 3WKJA 4KUDC 5B40D 1TAFA 2Y2LA 4J8UB 4WU8A 5GT3B 4WNNB 2J8PA 5BO0A 2Y2KA 3MGPC 5B40A 1P3MC 5B24D 4LD9A 3X1VA 5AY8D 5C3IB 1P3OD 3MVDD 5CPJC 4H9OB 1WWIA 4CSRB 1P3BA 1M18A 3AV2C 3B0CW 3MGRC 5AY8A 3AZLD 1KX4B 1PZRA 3B6FC 5CP6C 1P3LC 4YS3A 1KX3D 1KU5A 3AV1C 4X23D 3VH5T 2G5HC 4Z66C 1KX3A 2F8NK 5E5AB 3REIA 5AVBB 5JRGA 5B2JD 1T3UA 3MGQD 3REKD 1P3PC 4WU9B 1U35C 4DRBA 5B2JA 4J8WD 2JCHA 3X1TA 3UTAC 4KGCA 4CAYB 3VH6W 3MGQA 3REKA 3AZMB 3O62B 5AVBA 1ZLAC 3EPLA 4J8XA 4AWLB 1M19C 3A1KA 5CPIA 1ID3C 3WAAD 5KDMB 3NQJA 5B33B 3AZEC 1P3IC 3B6GB 1F66B 5AV5B 3AFAA 3W98C 3WA9D 4NE6A 5AVCB 5B1MC 1S32B 4G91B 1JFIB 2AROC 5B1LD 5AV8A
chains in the Genus database with same CATH topology
5B32G 1AOID 2F8NA 5B0YD 3UTBD 2CV5D 5BT1D 1P3FA 1EQZD 1AOIA 1P3KA 3UTBA 3KWQD 5AV6B 5DNND 3REJC 5CPKC 3C1CC 3A6NC 4H9SA 3R45A 3KWQA 3W96A 4NFTA 3MGSB 2JSSA 5B32B 2PYOC 3TU4C 3AZHC 4Z5TB 5DNMC 1TZYC 2Y2HA 3REHA 5GXQD 3AN2C 3MGPB 3W99D 1P3MB 4H9RB 4R8PD 3LZ0C 3LJAC 3AZGA 3AZNA 3P5JB 2XD5A 3EG5B 5FUGA 5CPJB 4QLCC 3X1UD 4HGAC 4JJND 3AV2B 3X1SC 3W97C 5AV9D 3WTPC 4H9NB 3LZ1A 3AZFC 3B6FB 5CP6B 2HIOD 1P3LB 4H9PA 3AZJB 2L5AA 4Z66B 5B24C 2FJ7D 5BS7A 1F1EA 1P3OC 3MVDC 3KFUG 3AZJA 3NQUB 4UUZB 1P3PB 3AZLC 1U35B 4KUDB 3UTAB 3V9RA 4X23C 1ZLAB 1M19B 1HQ3D 4UUZA 1ID3B 3AZEB 4Z2MH 2NZDC 3C1BC 1P3IB 5JA4B 3EPHA 4J8WC 3UT9D 3B0BA 3W98B 3KUYA 3AYWD 1W2EA 5B1MB 2AROB 3A6NB 3MNND 2CWEA 5B31D 2ZY2A 3WAAC 1N1JB 3LELD 3MNNA 5B2IA 3KXBD 1P34D 2BYMA 1P3GD 3REJB 3B0CT 5CPKB 3C1CB 3KXBA 3WA9C 5F99A 5GSUD 4J8VD 5BNXA 5B1LC 4J8VA 1KX5C 4WU8D 2PYOB 2BYKB 3TU4B 5DNMB 1TZYB 5B0YC 2CV5C 1BH9B 4LD9D 5BT1C 1EQZC 3X1VD 1M1AC 5CHLB 5DNNC 3LZ0B 4J8UD 1P3BD 1M18D 3VH6T 3LJAB 4H9QB 2ZY4A 4J8UA 4YS3D 5GT3A 4WNNA 4QLCB 2BG1A 4HGAB 3X1SB 3W97B 3WTPB 3AZFB 4XZQC 3REID 5GXQC 5JRGD 3H0RC 4H9OA 3W99C 4CSRA 5B24B 4R8PC 2VQRA 1KX4A 2RVQD 3X1TD 4KGCD 3RELC 1P3OB 3MVDB 3X1UC 2NQBC 5AVBD 2Y2OA 4JJNC 3AZLB 5AV9C 4G92C 4J8XD 5E5AA 2HIOC 4WV4B 5CPID 4WU9D 4X23B 4ZUXB 4WU9A 2FJ7C 4CAYA 3AZMA 3AFAD 2NZDB 3C1BB 3O62A 4ZUXA 4J8WB 2F2AC 5AV8D 1H3OB 2F8ND 5KDMA 5GT0C 5B33A 5AV5D 2Y2MA 1P3FD 1HQ3C 4WZSB 1P3KD 3B6GA 1S32D 1F66A 5AV5A 3WAAB 5AVCA 4YM6C 1S32A 2ZY3A 3W96D 1JFIA 5G49B 2F8NH 3UT9C 1Z2CB 3WA9B 3AYWC 2Y2IA 1HTAA 5BNVB 2W8SA 3REHD 5B1LB 2HUEC 1KX5B 5AV6A 5B31C 2CV5B 1P3AC 3LELC 3AZIC 3AZGD 3AZND 1EQZB 1P34C 1M1AB 3MGSA 1P3GC 5DNNB 4XUJC 5B32A 4Z5TA 5GSUC 5B0ZC 1BH8B 3LZ1D 3MGPD 1R4VA 2YFWB 3WKJC 3MGRB 3MGPA 1B67A 4WU8C 4NE3A 4H9RA 1P3MA 4XZQB 5B40C 5CPJD 4E44A 3AV1B 4LD9C 5GXQB 3KSYA 3X1VC 5CPJA 2DQNC 3W99B 2IO5C 3AZJD 3AV2A 4R8PB 3MGRA 1P3BC 1M18C 4H9NA 5AY8C 3B6FA 5CP6A 2Y2PA 3RELB 1P3LA 3AV1A 4YS3C 3X1UB 2NQBB 4JJNB 4Z66A 5AV9B 4G92B 4Z2MG 1KX3C 2HIOB 3REIC 4UPKA 5JRGC 3UTAD 3NQUA 1P3PA 1U35A 2FJ7B 4KUDA 2RVQC 3UTAA 3X1TC 5B2JC 1ZLAD 4KGCC 3EPKA 3MGQC 3REKC 3KUYD 1ZLAA 5AVBC 1M19A 4J8XC 3AZED 3IP4C 1P3ID 1ID3A 2YFVB 5CPIC 5GT0B 1BFMA 4NE5A 3AZEA 3VH5A 3AZKB 1P3IA 1HQ3B 3W98D 5JA4A 5B2ID 5B1MD 5B31G 3W98A 3AFAC 4YM6B 5B1MA 5F99D 2FFFB 2AROA 2Y2GA 3A6NA 2ZM5A 2LY8A 3UT9B 3AZKA 5AV8C 3AYWB 4KHAB 1N1JA 5CPKD 2ZY5A 1P3FC 2HUEB 3AZHB 1AOIC 1P3KC 3REJA 3H0MC 3UTBC 5B31B 3C1CA 5CPKA 1P3AB 3LELB 3AZIB 4H9SC 3AN2B 3KWQC 3W96C 1P34B 1P3GB 4XUJB 5GT3D 2PYOA 2BYKA 3TU4A 3AZHA 5DNMA 5GSUB 1TZYA 5B0ZB 1BH9A 3WKJB 1TAFB 3REHC 3AN2A 4WU8B 5BO0B 5B40B 3LZ0A 3LJAA 4LD9B 4H9QA 3A1IA 1KX4D 3X1SD 3AZGC 3AZNC 3W97D 3AZFD 3X1VB 2IO5B 4QLCA 3X1SA 3W97A 4DRAA 3WTPA 3AZFA 1P3BB 1M18B 5AY8B 5E5AD 3LZ1C 4YS3B 5B24A 1KX3B 3REIB 5BS7C 1P3OA 1ULYA 4ZBJC 5JRGB 3MVDA 3AZMD 3O62D 3AZJC 3AZLA 2JE5A 4ZUXD 5B2JB 3X1TB 4KGCB 3MGQB 3REKB 1A7WA 2RIQA 4X23A 5B33D 4J8XB 2NZDD 3C1BD 3B6GD 5CPIB 1F66D 2F8NG 2NZDA 3C1BA 5AVCD 3NQJB 3F6TA 4EO5C 4J8WA 3AL0C 3B0DC 3AFAB 1H3OA 3KUYC 1B6WA 3VH5W 5AV6D 5AV8B 3WAAA 2F8NB 3MNNC 1P3FB 5G49A 5B2IC 1P3KB 1AOIB 5B0YB 3UTBB 3MGSD 3WA9A 5B32D 4Z5TD 3R45B 5F99C 3KXBC 3KWQB 1KX5D 3W96B 5BNVA 5B1LA 1KX5A 1Q9CA 4J8VC 4E45A 1WWSA 1P3MD 5B0YA 2CV5A 1M1AD 1EQZA 3REHB 1M1AA 5DNNA 3AV2D 3MGRD 2G5IC 1BH8A 3AZNB 3AZGB 3B6FD 2DF4C 2YFWA 5CP6D 1P3LD 4XZQD 4J8UC 5FUGB 3AV1D 5GT3C 4Z66D 4XZQA 3LZ1B 4WJ3C 4H9PB 5GXQA 5C3IC 3W99A 3RELD 4R8PA 3AZKC 1P3PD 1U35D 4KUDD 1KX4C 2NQBD 3RELA 4ZBJB 3FDDA 3X1UA 2NQBA 4JJNA 5AV9A 1M19D 3VH6A 2HIOA 5E5AC 1ID3D 3H0LC 3V9RB 2XD1A 2FJ7A 4WU9C 2Y2NA 3WTPE 3AZMC 4EO5B 3O62C 5GT0D 2AROD 4AWLC 4ZUXC 3A6ND 3B0DB 3AZKD 2YFVA 3KUYB 5GT0A 3EPJA 5B33C 1HQ3A 4YM6D 3B6GC 3REJD 1F66C 3C1CD 5AV5C 4DQYB 4YM6A 5AVCC 3MNNB 1S32C 5B2IB 4G91C 2BYMB 2UWXA 3UT9A 4M6BA 3AYWA 2PYOD 4KHAA 3TU4D 3KXBB 5DNMD 5F99B 1TZYD 2Y2QA 5BNXB 3AZHD 2Y2JA 1P3AD 3AZID 4J8VB 3AN2D 5B31A 5AV6C 1P3AA 3LZ0D 3LELA 3AZIA 3LJAD 4XUJD 1P34A 5B0ZD 1P3GA 3MGSC 3WKJD 4XUJA 4QLCD 5GSUA 5B32C 5B0ZA 3WTPD 4Z5TC 3WKJA 4KUDC 5B40D 1TAFA 2Y2LA 4J8UB 4WU8A 5GT3B 4WNNB 2J8PA 5BO0A 2Y2KA 3MGPC 5B40A 1P3MC 5B24D 4LD9A 3X1VA 5AY8D 5C3IB 1P3OD 3MVDD 5CPJC 4H9OB 1WWIA 4CSRB 1P3BA 1M18A 3AV2C 3B0CW 3MGRC 5AY8A 3AZLD 1KX4B 1PZRA 3B6FC 5CP6C 1P3LC 4YS3A 1KX3D 1KU5A 3AV1C 4X23D 3VH5T 2G5HC 4Z66C 1KX3A 2F8NK 5E5AB 3REIA 5AVBB 5JRGA 5B2JD 1T3UA 3MGQD 3REKD 1P3PC 4WU9B 1U35C 4DRBA 5B2JA 4J8WD 2JCHA 3X1TA 3UTAC 4KGCA 4CAYB 3VH6W 3MGQA 3REKA 3AZMB 3O62B 5AVBA 1ZLAC 3EPLA 4J8XA 4AWLB 1M19C 3A1KA 5CPIA 1ID3C 3WAAD 5KDMB 3NQJA 5B33B 3AZEC 1P3IC 3B6GB 1F66B 5AV5B 3AFAA 3W98C 3WA9D 4NE6A 5AVCB 5B1MC 1S32B 4G91B 1JFIB 2AROC 5B1LD 5AV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 G;  1AOI D;  2F8N A;  5B0Y D;  3UTB D;  2CV5 D;  5BT1 D;  1P3F A;  1EQZ D;  1AOI A;  1P3K A;  3UTB A;  3KWQ D;  5AV6 B;  5DNN D;  3REJ C;  5CPK C;  3C1C C;  3A6N C;  4H9S A;  3R45 A;  3KWQ A;  3W96 A;  4NFT A;  3MGS B;  2JSS A;  5B32 B;  2PYO C;  3TU4 C;  3AZH C;  4Z5T B;  5DNM C;  1TZY C;  3REH A;  5GXQ D;  3AN2 C;  3MGP B;  3W99 D;  1P3M B;  4H9R B;  4R8P D;  3LZ0 C;  3LJA C;  3AZG A;  3AZN A;  5FUG A;  5CPJ B;  4QLC C;  3X1U D;  4HGA C;  4JJN D;  3AV2 B;  3X1S C;  3W97 C;  5AV9 D;  3WTP C;  4H9N B;  3LZ1 A;  3AZF C;  3B6F B;  5CP6 B;  2HIO D;  1P3L B;  4H9P A;  3AZJ B;  2L5A A;  4Z66 B;  5B24 C;  2FJ7 D;  5BS7 A;  1F1E A;  1P3O C;  3MVD C;  3AZJ A;  3NQU B;  4UUZ B;  1P3P B;  3AZL C;  1U35 B;  4KUD B;  3UTA B;  3V9R A;  4X23 C;  1ZLA B;  1M19 B;  1HQ3 D;  4UUZ A;  1ID3 B;  3AZE B;  4Z2M H;  2NZD C;  3C1B C;  1P3I B;  5JA4 B;  4J8W C;  3UT9 D;  3B0B A;  3W98 B;  3KUY A;  3AYW D;  5B1M B;  2ARO B;  3A6N B;  3MNN D;  2CWE A;  5B31 D;  3WAA C;  1N1J B;  3LEL D;  3MNN A;  5B2I A;  3KXB D;  1P34 D;  2BYM A;  1P3G D;  3REJ B;  3B0C T;  5CPK B;  3C1C B;  3KXB A;  3WA9 C;  5F99 A;  5GSU D;  4J8V D;  5BNX A;  5B1L C;  4J8V A;  1KX5 C;  4WU8 D;  2PYO B;  2BYK B;  3TU4 B;  5DNM B;  1TZY B;  5B0Y C;  2CV5 C;  1BH9 B;  4LD9 D;  5BT1 C;  1EQZ C;  3X1V D;  1M1A C;  5CHL B;  5DNN C;  3LZ0 B;  4J8U D;  1P3B D;  1M18 D;  3VH6 T;  3LJA B;  4H9Q B;  4J8U A;  4YS3 D;  5GT3 A;  4QLC B;  4WNN A;  4HGA B;  3X1S B;  3W97 B;  3WTP B;  3AZF B;  4XZQ C;  3REI D;  5GXQ C;  5JRG D;  4H9O A;  3W99 C;  4CSR A;  5B24 B;  4R8P C;  1KX4 A;  2RVQ D;  3X1T D;  4KGC D;  3REL C;  1P3O B;  3MVD B;  3X1U C;  2NQB C;  5AVB D;  4JJN C;  3AZL B;  5AV9 C;  4G92 C;  4J8X D;  5E5A A;  2HIO C;  4WV4 B;  5CPI D;  4WU9 D;  4X23 B;  4ZUX B;  4WU9 A;  2FJ7 C;  4CAY A;  3AZM A;  3AFA D;  2NZD B;  3C1B B;  3O62 A;  4ZUX A;  4J8W B;  5AV8 D;  1H3O B;  2F8N D;  5KDM A;  5GT0 C;  5B33 A;  5AV5 D;  1P3F D;  1HQ3 C;  4WZS B;  1P3K D;  3B6G A;  1S32 D;  1F66 A;  5AV5 A;  3WAA B;  5AVC A;  4YM6 C;  1S32 A;  3W96 D;  1JFI A;  5G49 B;  2F8N H;  3UT9 C;  3WA9 B;  3AYW C;  1HTA A;  5BNV B;  3REH D;  5B1L B;  2HUE C;  1KX5 B;  5AV6 A;  5B31 C;  2CV5 B;  1P3A C;  3LEL C;  3AZI C;  3AZG D;  3AZN D;  1EQZ B;  1P34 C;  1M1A B;  3MGS A;  1P3G C;  5DNN B;  4XUJ C;  5B32 A;  4Z5T A;  5GSU C;  5B0Z C;  1BH8 B;  3LZ1 D;  3MGP D;  1R4V A;  2YFW B;  3WKJ C;  3MGR B;  3MGP A;  1B67 A;  4WU8 C;  4NE3 A;  4H9R A;  1P3M A;  4XZQ B;  5B40 C;  5CPJ D;  4E44 A;  3AV1 B;  4LD9 C;  5GXQ B;  3KSY A;  3X1V C;  5CPJ A;  3W99 B;  2IO5 C;  3AZJ D;  3AV2 A;  4R8P B;  3MGR A;  1P3B C;  1M18 C;  4H9N A;  5AY8 C;  3B6F A;  5CP6 A;  3REL B;  1P3L A;  3AV1 A;  4YS3 C;  3X1U B;  2NQB B;  4JJN B;  4Z66 A;  5AV9 B;  4G92 B;  4Z2M G;  1KX3 C;  2HIO B;  3REI C;  5JRG C;  3UTA D;  3NQU A;  1P3P A;  1U35 A;  2FJ7 B;  4KUD A;  2RVQ C;  3UTA A;  3X1T C;  5B2J C;  1ZLA D;  4KGC C;  3MGQ C;  3REK C;  3KUY D;  1ZLA A;  5AVB C;  1M19 A;  4J8X C;  3AZE D;  1P3I D;  1ID3 A;  2YFV B;  5CPI C;  5GT0 B;  1BFM A;  4NE5 A;  3AZE A;  3VH5 A;  3AZK B;  1P3I A;  1HQ3 B;  3W98 D;  5JA4 A;  5B2I D;  5B1M D;  5B31 G;  3W98 A;  3AFA C;  4YM6 B;  5B1M A;  5F99 D;  2ARO A;  3A6N A;  2LY8 A;  3UT9 B;  3AZK A;  5AV8 C;  3AYW B;  4KHA B;  1N1J A;  5CPK D;  1P3F C;  2HUE B;  3AZH B;  1AOI C;  1P3K C;  3REJ A;  3UTB C;  5B31 B;  3C1C A;  5CPK A;  1P3A B;  3LEL B;  3AZI B;  4H9S C;  3AN2 B;  3KWQ C;  3W96 C;  1P34 B;  1P3G B;  4XUJ B;  5GT3 D;  2PYO A;  2BYK A;  3TU4 A;  3AZH A;  5DNM A;  5GSU B;  1TZY A;  5B0Z B;  1BH9 A;  3WKJ B;  1TAF B;  3REH C;  3AN2 A;  4WU8 B;  5BO0 B;  5B40 B;  3LZ0 A;  3LJA A;  4LD9 B;  4H9Q A;  1KX4 D;  3X1S D;  3AZG C;  3AZN C;  3W97 D;  3AZF D;  3X1V B;  2IO5 B;  4QLC A;  3X1S A;  3W97 A;  4DRA A;  3WTP A;  3AZF A;  1P3B B;  1M18 B;  5AY8 B;  5E5A D;  3LZ1 C;  4YS3 B;  5B24 A;  1KX3 B;  3REI B;  5BS7 C;  1P3O A;  1ULY A;  4ZBJ C;  5JRG B;  3MVD A;  3AZM D;  3O62 D;  3AZJ C;  3AZL A;  4ZUX D;  5B2J B;  3X1T B;  4KGC B;  3MGQ B;  3REK B;  1A7W A;  4X23 A;  5B33 D;  4J8X B;  2NZD D;  3C1B D;  3B6G D;  5CPI B;  1F66 D;  2F8N G;  2NZD A;  3C1B A;  5AVC D;  3NQJ B;  4EO5 C;  4J8W A;  3B0D C;  3AFA B;  1H3O A;  3KUY C;  1B6W A;  3VH5 W;  5AV8 B;  5AV6 D;  3WAA A;  2F8N B;  3MNN C;  1P3F B;  5G49 A;  5B2I C;  1P3K B;  1AOI B;  5B0Y B;  3UTB B;  3MGS D;  3WA9 A;  5B32 D;  4Z5T D;  3R45 B;  5F99 C;  3KXB C;  3KWQ B;  1KX5 D;  3W96 B;  5BNV A;  5B1L A;  1KX5 A;  1Q9C A;  4J8V C;  4E45 A;  1WWS A;  1P3M D;  5B0Y A;  2CV5 A;  1M1A D;  1EQZ A;  3REH B;  1M1A A;  5DNN A;  3AV2 D;  3MGR D;  1BH8 A;  3AZN B;  3AZG B;  3B6F D;  2YFW A;  5CP6 D;  1P3L D;  4XZQ D;  4J8U C;  5FUG B;  3AV1 D;  5GT3 C;  4Z66 D;  4XZQ A;  3LZ1 B;  4H9P B;  5GXQ A;  5C3I C;  3W99 A;  3REL D;  4R8P A;  3AZK C;  1P3P D;  1U35 D;  4KUD D;  1KX4 C;  2NQB D;  3REL A;  4ZBJ B;  3X1U A;  2NQB A;  4JJN A;  5AV9 A;  1M19 D;  3VH6 A;  2HIO A;  5E5A C;  1ID3 D;  3V9R B;  2FJ7 A;  4WU9 C;  3WTP E;  3AZM C;  4EO5 B;  3O62 C;  5GT0 D;  2ARO D;  4AWL C;  4ZUX C;  3A6N D;  3B0D B;  3AZK D;  2YFV A;  3KUY B;  5GT0 A;  5B33 C;  1HQ3 A;  4YM6 D;  3B6G C;  3REJ D;  1F66 C;  3C1C D;  5AV5 C;  4YM6 A;  5AVC C;  3MNN B;  1S32 C;  5B2I B;  4G91 C;  2BYM B;  3UT9 A;  4M6B A;  3AYW A;  2PYO D;  4KHA A;  3TU4 D;  3KXB B;  5DNM D;  5F99 B;  1TZY D;  3AZH D;  5BNX B;  1P3A D;  3AZI D;  4J8V B;  3AN2 D;  5B31 A;  5AV6 C;  1P3A A;  3LZ0 D;  3LEL A;  3AZI A;  3LJA D;  4XUJ D;  1P34 A;  5B0Z D;  1P3G A;  3MGS C;  3WKJ D;  4XUJ A;  4QLC D;  5GSU A;  5B32 C;  5B0Z A;  3WTP D;  4Z5T C;  3WKJ A;  5B40 D;  1TAF A;  4J8U B;  4WU8 A;  5GT3 B;  4WNN B;  5BO0 A;  3MGP C;  5B40 A;  1P3M C;  5B24 D;  4LD9 A;  3X1V A;  5AY8 D;  5C3I B;  1P3O D;  3MVD D;  5CPJ C;  4H9O B;  1WWI A;  4CSR B;  1P3B A;  1M18 A;  3AV2 C;  3B0C W;  3MGR C;  5AY8 A;  3AZL D;  1KX4 B;  3B6F C;  5CP6 C;  1P3L C;  4YS3 A;  1KX3 D;  1KU5 A;  3AV1 C;  4X23 D;  3VH5 T;  4Z66 C;  1KX3 A;  2F8N K;  5E5A B;  3REI A;  5AVB B;  5JRG A;  5B2J D;  3MGQ D;  3REK D;  1P3P C;  4WU9 B;  1U35 C;  4DRB A;  5B2J A;  4J8W D;  3X1T A;  4KGC A;  3UTA C;  4KUD C;  4CAY B;  3VH6 W;  3MGQ A;  3REK A;  3AZM B;  3O62 B;  5AVB A;  1ZLA C;  4J8X A;  4AWL B;  1M19 C;  5CPI A;  1ID3 C;  3WAA D;  5KDM B;  3NQJ A;  5B33 B;  3AZE C;  1P3I C;  3B6G B;  1F66 B;  5AV5 B;  3AFA A;  3W98 C;  3WA9 D;  4NE6 A;  5AVC B;  5B1M C;  1S32 B;  4G91 B;  1JFI B;  2ARO C;  5B1L D;  5AV8 A; 
#chains in the Genus database with same CATH topology
 5B32 G;  1AOI D;  2F8N A;  5B0Y D;  3UTB D;  2CV5 D;  5BT1 D;  1P3F A;  1EQZ D;  1AOI A;  1P3K A;  3UTB A;  3KWQ D;  5AV6 B;  5DNN D;  3REJ C;  5CPK C;  3C1C C;  3A6N C;  4H9S A;  3R45 A;  3KWQ A;  3W96 A;  4NFT A;  3MGS B;  2JSS A;  5B32 B;  2PYO C;  3TU4 C;  3AZH C;  4Z5T B;  5DNM C;  1TZY C;  2Y2H A;  3REH A;  5GXQ D;  3AN2 C;  3MGP B;  3W99 D;  1P3M B;  4H9R B;  4R8P D;  3LZ0 C;  3LJA C;  3AZG A;  3AZN A;  3P5J B;  2XD5 A;  3EG5 B;  5FUG A;  5CPJ B;  4QLC C;  3X1U D;  4HGA C;  4JJN D;  3AV2 B;  3X1S C;  3W97 C;  5AV9 D;  3WTP C;  4H9N B;  3LZ1 A;  3AZF C;  3B6F B;  5CP6 B;  2HIO D;  1P3L B;  4H9P A;  3AZJ B;  2L5A A;  4Z66 B;  5B24 C;  2FJ7 D;  5BS7 A;  1F1E A;  1P3O C;  3MVD C;  3KFU G;  3AZJ A;  3NQU B;  4UUZ B;  1P3P B;  3AZL C;  1U35 B;  4KUD B;  3UTA B;  3V9R A;  4X23 C;  1ZLA B;  1M19 B;  1HQ3 D;  4UUZ A;  1ID3 B;  3AZE B;  4Z2M H;  2NZD C;  3C1B C;  1P3I B;  5JA4 B;  3EPH A;  4J8W C;  3UT9 D;  3B0B A;  3W98 B;  3KUY A;  3AYW D;  1W2E A;  5B1M B;  2ARO B;  3A6N B;  3MNN D;  2CWE A;  5B31 D;  2ZY2 A;  3WAA C;  1N1J B;  3LEL D;  3MNN A;  5B2I A;  3KXB D;  1P34 D;  2BYM A;  1P3G D;  3REJ B;  3B0C T;  5CPK B;  3C1C B;  3KXB A;  3WA9 C;  5F99 A;  5GSU D;  4J8V D;  5BNX A;  5B1L C;  4J8V A;  1KX5 C;  4WU8 D;  2PYO B;  2BYK B;  3TU4 B;  5DNM B;  1TZY B;  5B0Y C;  2CV5 C;  1BH9 B;  4LD9 D;  5BT1 C;  1EQZ C;  3X1V D;  1M1A C;  5CHL B;  5DNN C;  3LZ0 B;  4J8U D;  1P3B D;  1M18 D;  3VH6 T;  3LJA B;  4H9Q B;  2ZY4 A;  4J8U A;  4YS3 D;  5GT3 A;  4WNN A;  4QLC B;  2BG1 A;  4HGA B;  3X1S B;  3W97 B;  3WTP B;  3AZF B;  4XZQ C;  3REI D;  5GXQ C;  5JRG D;  3H0R C;  4H9O A;  3W99 C;  4CSR A;  5B24 B;  4R8P C;  2VQR A;  1KX4 A;  2RVQ D;  3X1T D;  4KGC D;  3REL C;  1P3O B;  3MVD B;  3X1U C;  2NQB C;  5AVB D;  2Y2O A;  4JJN C;  3AZL B;  5AV9 C;  4G92 C;  4J8X D;  5E5A A;  2HIO C;  4WV4 B;  5CPI D;  4WU9 D;  4X23 B;  4ZUX B;  4WU9 A;  2FJ7 C;  4CAY A;  3AZM A;  3AFA D;  2NZD B;  3C1B B;  3O62 A;  4ZUX A;  4J8W B;  2F2A C;  5AV8 D;  1H3O B;  2F8N D;  5KDM A;  5GT0 C;  5B33 A;  5AV5 D;  2Y2M A;  1P3F D;  1HQ3 C;  4WZS B;  1P3K D;  3B6G A;  1S32 D;  1F66 A;  5AV5 A;  3WAA B;  5AVC A;  4YM6 C;  1S32 A;  2ZY3 A;  3W96 D;  1JFI A;  5G49 B;  2F8N H;  3UT9 C;  1Z2C B;  3WA9 B;  3AYW C;  2Y2I A;  1HTA A;  5BNV B;  2W8S A;  3REH D;  5B1L B;  2HUE C;  1KX5 B;  5AV6 A;  5B31 C;  2CV5 B;  1P3A C;  3LEL C;  3AZI C;  3AZG D;  3AZN D;  1EQZ B;  1P34 C;  1M1A B;  3MGS A;  1P3G C;  5DNN B;  4XUJ C;  5B32 A;  4Z5T A;  5GSU C;  5B0Z C;  1BH8 B;  3LZ1 D;  3MGP D;  1R4V A;  2YFW B;  3WKJ C;  3MGR B;  3MGP A;  1B67 A;  4WU8 C;  4NE3 A;  4H9R A;  1P3M A;  4XZQ B;  5B40 C;  5CPJ D;  4E44 A;  3AV1 B;  4LD9 C;  5GXQ B;  3KSY A;  3X1V C;  5CPJ A;  2DQN C;  3W99 B;  2IO5 C;  3AZJ D;  3AV2 A;  4R8P B;  3MGR A;  1P3B C;  1M18 C;  4H9N A;  5AY8 C;  3B6F A;  5CP6 A;  2Y2P A;  3REL B;  1P3L A;  3AV1 A;  4YS3 C;  3X1U B;  2NQB B;  4JJN B;  4Z66 A;  5AV9 B;  4G92 B;  4Z2M G;  1KX3 C;  2HIO B;  3REI C;  4UPK A;  5JRG C;  3UTA D;  3NQU A;  1P3P A;  1U35 A;  2FJ7 B;  4KUD A;  2RVQ C;  3UTA A;  3X1T C;  5B2J C;  1ZLA D;  4KGC C;  3EPK A;  3MGQ C;  3REK C;  3KUY D;  1ZLA A;  5AVB C;  1M19 A;  4J8X C;  3AZE D;  3IP4 C;  1P3I D;  1ID3 A;  2YFV B;  5CPI C;  5GT0 B;  1BFM A;  4NE5 A;  3AZE A;  3VH5 A;  3AZK B;  1P3I A;  1HQ3 B;  3W98 D;  5JA4 A;  5B2I D;  5B1M D;  5B31 G;  3W98 A;  3AFA C;  4YM6 B;  5B1M A;  5F99 D;  2FFF B;  2ARO A;  2Y2G A;  3A6N A;  2ZM5 A;  2LY8 A;  3UT9 B;  3AZK A;  5AV8 C;  3AYW B;  4KHA B;  1N1J A;  5CPK D;  2ZY5 A;  1P3F C;  2HUE B;  3AZH B;  1AOI C;  1P3K C;  3REJ A;  3H0M C;  3UTB C;  5B31 B;  3C1C A;  5CPK A;  1P3A B;  3LEL B;  3AZI B;  4H9S C;  3AN2 B;  3KWQ C;  3W96 C;  1P34 B;  1P3G B;  4XUJ B;  5GT3 D;  2PYO A;  2BYK A;  3TU4 A;  3AZH A;  5DNM A;  5GSU B;  1TZY A;  5B0Z B;  1BH9 A;  3WKJ B;  1TAF B;  3REH C;  3AN2 A;  4WU8 B;  5BO0 B;  5B40 B;  3LZ0 A;  3LJA A;  4LD9 B;  4H9Q A;  3A1I A;  1KX4 D;  3X1S D;  3AZG C;  3AZN C;  3W97 D;  3AZF D;  3X1V B;  2IO5 B;  4QLC A;  3X1S A;  3W97 A;  4DRA A;  3WTP A;  3AZF A;  1P3B B;  1M18 B;  5AY8 B;  5E5A D;  3LZ1 C;  4YS3 B;  5B24 A;  1KX3 B;  3REI B;  5BS7 C;  1P3O A;  1ULY A;  4ZBJ C;  5JRG B;  3MVD A;  3AZM D;  3O62 D;  3AZJ C;  3AZL A;  2JE5 A;  4ZUX D;  5B2J B;  3X1T B;  4KGC B;  3MGQ B;  3REK B;  1A7W A;  2RIQ A;  4X23 A;  5B33 D;  4J8X B;  2NZD D;  3C1B D;  3B6G D;  5CPI B;  1F66 D;  2F8N G;  2NZD A;  3C1B A;  5AVC D;  3NQJ B;  3F6T A;  4EO5 C;  4J8W A;  3AL0 C;  3B0D C;  3AFA B;  1H3O A;  3KUY C;  1B6W A;  3VH5 W;  5AV6 D;  5AV8 B;  3WAA A;  2F8N B;  3MNN C;  1P3F B;  5G49 A;  5B2I C;  1P3K B;  1AOI B;  5B0Y B;  3UTB B;  3MGS D;  3WA9 A;  5B32 D;  4Z5T D;  3R45 B;  5F99 C;  3KXB C;  3KWQ B;  1KX5 D;  3W96 B;  5BNV A;  5B1L A;  1KX5 A;  1Q9C A;  4J8V C;  4E45 A;  1WWS A;  1P3M D;  5B0Y A;  2CV5 A;  1M1A D;  1EQZ A;  3REH B;  1M1A A;  5DNN A;  3AV2 D;  3MGR D;  2G5I C;  1BH8 A;  3AZN B;  3AZG B;  3B6F D;  2DF4 C;  2YFW A;  5CP6 D;  1P3L D;  4XZQ D;  4J8U C;  5FUG B;  3AV1 D;  5GT3 C;  4Z66 D;  4XZQ A;  3LZ1 B;  4WJ3 C;  4H9P B;  5GXQ A;  5C3I C;  3W99 A;  3REL D;  4R8P A;  3AZK C;  1P3P D;  1U35 D;  4KUD D;  1KX4 C;  2NQB D;  3REL A;  4ZBJ B;  3FDD A;  3X1U A;  2NQB A;  4JJN A;  5AV9 A;  1M19 D;  3VH6 A;  2HIO A;  5E5A C;  1ID3 D;  3H0L C;  3V9R B;  2XD1 A;  2FJ7 A;  4WU9 C;  2Y2N A;  3WTP E;  3AZM C;  4EO5 B;  3O62 C;  5GT0 D;  2ARO D;  4AWL C;  4ZUX C;  3A6N D;  3B0D B;  3AZK D;  2YFV A;  3KUY B;  5GT0 A;  3EPJ A;  5B33 C;  1HQ3 A;  4YM6 D;  3B6G C;  3REJ D;  1F66 C;  3C1C D;  5AV5 C;  4DQY B;  4YM6 A;  5AVC C;  3MNN B;  1S32 C;  5B2I B;  4G91 C;  2BYM B;  2UWX A;  3UT9 A;  4M6B A;  3AYW A;  2PYO D;  4KHA A;  3TU4 D;  3KXB B;  5DNM D;  5F99 B;  1TZY D;  2Y2Q A;  5BNX B;  3AZH D;  2Y2J A;  1P3A D;  3AZI D;  4J8V B;  3AN2 D;  5B31 A;  5AV6 C;  1P3A A;  3LZ0 D;  3LEL A;  3AZI A;  3LJA D;  4XUJ D;  1P34 A;  5B0Z D;  1P3G A;  3MGS C;  3WKJ D;  4XUJ A;  4QLC D;  5GSU A;  5B32 C;  5B0Z A;  3WTP D;  4Z5T C;  3WKJ A;  4KUD C;  5B40 D;  1TAF A;  2Y2L A;  4J8U B;  4WU8 A;  5GT3 B;  4WNN B;  2J8P A;  5BO0 A;  2Y2K A;  3MGP C;  5B40 A;  1P3M C;  5B24 D;  4LD9 A;  3X1V A;  5AY8 D;  5C3I B;  1P3O D;  3MVD D;  5CPJ C;  4H9O B;  1WWI A;  4CSR B;  1P3B A;  1M18 A;  3AV2 C;  3B0C W;  3MGR C;  5AY8 A;  3AZL D;  1KX4 B;  1PZR A;  3B6F C;  5CP6 C;  1P3L C;  4YS3 A;  1KX3 D;  1KU5 A;  3AV1 C;  4X23 D;  3VH5 T;  2G5H C;  4Z66 C;  1KX3 A;  2F8N K;  5E5A B;  3REI A;  5AVB B;  5JRG A;  5B2J D;  1T3U A;  3MGQ D;  3REK D;  1P3P C;  4WU9 B;  1U35 C;  4DRB A;  5B2J A;  4J8W D;  2JCH A;  3X1T A;  3UTA C;  4KGC A;  4CAY B;  3VH6 W;  3MGQ A;  3REK A;  3AZM B;  3O62 B;  5AVB A;  1ZLA C;  3EPL A;  4J8X A;  4AWL B;  1M19 C;  3A1K A;  5CPI A;  1ID3 C;  3WAA D;  5KDM B;  3NQJ A;  5B33 B;  3AZE C;  1P3I C;  3B6G B;  1F66 B;  5AV5 B;  3AFA A;  3W98 C;  3WA9 D;  4NE6 A;  5AVC B;  5B1M C;  1S32 B;  4G91 B;  1JFI B;  2ARO C;  5B1L D;  5AV8 A; 
#chains in the Genus database with same CATH homology
 5B32 G;  1AOI D;  2F8N A;  5B0Y D;  3UTB D;  2CV5 D;  5BT1 D;  1P3F A;  1EQZ D;  1AOI A;  1P3K A;  3UTB A;  3KWQ D;  5AV6 B;  5DNN D;  3REJ C;  5CPK C;  3C1C C;  3A6N C;  4H9S A;  3R45 A;  3KWQ A;  3W96 A;  4NFT A;  3MGS B;  2JSS A;  5B32 B;  2PYO C;  3TU4 C;  3AZH C;  4Z5T B;  5DNM C;  1TZY C;  2Y2H A;  3REH A;  5GXQ D;  3AN2 C;  3MGP B;  3W99 D;  1P3M B;  4H9R B;  4R8P D;  3LZ0 C;  3LJA C;  3AZG A;  3AZN A;  3P5J B;  2XD5 A;  3EG5 B;  5FUG A;  5CPJ B;  4QLC C;  3X1U D;  4HGA C;  4JJN D;  3AV2 B;  3X1S C;  3W97 C;  5AV9 D;  3WTP C;  4H9N B;  3LZ1 A;  3AZF C;  3B6F B;  5CP6 B;  2HIO D;  1P3L B;  4H9P A;  3AZJ B;  2L5A A;  4Z66 B;  5B24 C;  2FJ7 D;  5BS7 A;  1F1E A;  1P3O C;  3MVD C;  3KFU G;  3AZJ A;  3NQU B;  4UUZ B;  1P3P B;  3AZL C;  1U35 B;  4KUD B;  3UTA B;  3V9R A;  4X23 C;  1ZLA B;  1M19 B;  1HQ3 D;  4UUZ A;  1ID3 B;  3AZE B;  4Z2M H;  2NZD C;  3C1B C;  1P3I B;  5JA4 B;  3EPH A;  4J8W C;  3UT9 D;  3B0B A;  3W98 B;  3KUY A;  3AYW D;  1W2E A;  5B1M B;  2ARO B;  3A6N B;  3MNN D;  2CWE A;  5B31 D;  2ZY2 A;  3WAA C;  1N1J B;  3LEL D;  3MNN A;  5B2I A;  3KXB D;  1P34 D;  2BYM A;  1P3G D;  3REJ B;  3B0C T;  5CPK B;  3C1C B;  3KXB A;  3WA9 C;  5F99 A;  5GSU D;  4J8V D;  5BNX A;  5B1L C;  4J8V A;  1KX5 C;  4WU8 D;  2PYO B;  2BYK B;  3TU4 B;  5DNM B;  1TZY B;  5B0Y C;  2CV5 C;  1BH9 B;  4LD9 D;  5BT1 C;  1EQZ C;  3X1V D;  1M1A C;  5CHL B;  5DNN C;  3LZ0 B;  4J8U D;  1P3B D;  1M18 D;  3VH6 T;  3LJA B;  4H9Q B;  2ZY4 A;  4J8U A;  4YS3 D;  5GT3 A;  4WNN A;  4QLC B;  2BG1 A;  4HGA B;  3X1S B;  3W97 B;  3WTP B;  3AZF B;  4XZQ C;  3REI D;  5GXQ C;  5JRG D;  3H0R C;  4H9O A;  3W99 C;  4CSR A;  5B24 B;  4R8P C;  2VQR A;  1KX4 A;  2RVQ D;  3X1T D;  4KGC D;  3REL C;  1P3O B;  3MVD B;  3X1U C;  2NQB C;  5AVB D;  2Y2O A;  4JJN C;  3AZL B;  5AV9 C;  4G92 C;  4J8X D;  5E5A A;  2HIO C;  4WV4 B;  5CPI D;  4WU9 D;  4X23 B;  4ZUX B;  4WU9 A;  2FJ7 C;  4CAY A;  3AZM A;  3AFA D;  2NZD B;  3C1B B;  3O62 A;  4ZUX A;  4J8W B;  2F2A C;  5AV8 D;  1H3O B;  2F8N D;  5KDM A;  5GT0 C;  5B33 A;  5AV5 D;  2Y2M A;  1P3F D;  1HQ3 C;  4WZS B;  1P3K D;  3B6G A;  1S32 D;  1F66 A;  5AV5 A;  3WAA B;  5AVC A;  4YM6 C;  1S32 A;  2ZY3 A;  3W96 D;  1JFI A;  5G49 B;  2F8N H;  3UT9 C;  1Z2C B;  3WA9 B;  3AYW C;  2Y2I A;  1HTA A;  5BNV B;  2W8S A;  3REH D;  5B1L B;  2HUE C;  1KX5 B;  5AV6 A;  5B31 C;  2CV5 B;  1P3A C;  3LEL C;  3AZI C;  3AZG D;  3AZN D;  1EQZ B;  1P34 C;  1M1A B;  3MGS A;  1P3G C;  5DNN B;  4XUJ C;  5B32 A;  4Z5T A;  5GSU C;  5B0Z C;  1BH8 B;  3LZ1 D;  3MGP D;  1R4V A;  2YFW B;  3WKJ C;  3MGR B;  3MGP A;  1B67 A;  4WU8 C;  4NE3 A;  4H9R A;  1P3M A;  4XZQ B;  5B40 C;  5CPJ D;  4E44 A;  3AV1 B;  4LD9 C;  5GXQ B;  3KSY A;  3X1V C;  5CPJ A;  2DQN C;  3W99 B;  2IO5 C;  3AZJ D;  3AV2 A;  4R8P B;  3MGR A;  1P3B C;  1M18 C;  4H9N A;  5AY8 C;  3B6F A;  5CP6 A;  2Y2P A;  3REL B;  1P3L A;  3AV1 A;  4YS3 C;  3X1U B;  2NQB B;  4JJN B;  4Z66 A;  5AV9 B;  4G92 B;  4Z2M G;  1KX3 C;  2HIO B;  3REI C;  4UPK A;  5JRG C;  3UTA D;  3NQU A;  1P3P A;  1U35 A;  2FJ7 B;  4KUD A;  2RVQ C;  3UTA A;  3X1T C;  5B2J C;  1ZLA D;  4KGC C;  3EPK A;  3MGQ C;  3REK C;  3KUY D;  1ZLA A;  5AVB C;  1M19 A;  4J8X C;  3AZE D;  3IP4 C;  1P3I D;  1ID3 A;  2YFV B;  5CPI C;  5GT0 B;  1BFM A;  4NE5 A;  3AZE A;  3VH5 A;  3AZK B;  1P3I A;  1HQ3 B;  3W98 D;  5JA4 A;  5B2I D;  5B1M D;  5B31 G;  3W98 A;  3AFA C;  4YM6 B;  5B1M A;  5F99 D;  2FFF B;  2ARO A;  2Y2G A;  3A6N A;  2ZM5 A;  2LY8 A;  3UT9 B;  3AZK A;  5AV8 C;  3AYW B;  4KHA B;  1N1J A;  5CPK D;  2ZY5 A;  1P3F C;  2HUE B;  3AZH B;  1AOI C;  1P3K C;  3REJ A;  3H0M C;  3UTB C;  5B31 B;  3C1C A;  5CPK A;  1P3A B;  3LEL B;  3AZI B;  4H9S C;  3AN2 B;  3KWQ C;  3W96 C;  1P34 B;  1P3G B;  4XUJ B;  5GT3 D;  2PYO A;  2BYK A;  3TU4 A;  3AZH A;  5DNM A;  5GSU B;  1TZY A;  5B0Z B;  1BH9 A;  3WKJ B;  1TAF B;  3REH C;  3AN2 A;  4WU8 B;  5BO0 B;  5B40 B;  3LZ0 A;  3LJA A;  4LD9 B;  4H9Q A;  3A1I A;  1KX4 D;  3X1S D;  3AZG C;  3AZN C;  3W97 D;  3AZF D;  3X1V B;  2IO5 B;  4QLC A;  3X1S A;  3W97 A;  4DRA A;  3WTP A;  3AZF A;  1P3B B;  1M18 B;  5AY8 B;  5E5A D;  3LZ1 C;  4YS3 B;  5B24 A;  1KX3 B;  3REI B;  5BS7 C;  1P3O A;  1ULY A;  4ZBJ C;  5JRG B;  3MVD A;  3AZM D;  3O62 D;  3AZJ C;  3AZL A;  2JE5 A;  4ZUX D;  5B2J B;  3X1T B;  4KGC B;  3MGQ B;  3REK B;  1A7W A;  2RIQ A;  4X23 A;  5B33 D;  4J8X B;  2NZD D;  3C1B D;  3B6G D;  5CPI B;  1F66 D;  2F8N G;  2NZD A;  3C1B A;  5AVC D;  3NQJ B;  3F6T A;  4EO5 C;  4J8W A;  3AL0 C;  3B0D C;  3AFA B;  1H3O A;  3KUY C;  1B6W A;  3VH5 W;  5AV6 D;  5AV8 B;  3WAA A;  2F8N B;  3MNN C;  1P3F B;  5G49 A;  5B2I C;  1P3K B;  1AOI B;  5B0Y B;  3UTB B;  3MGS D;  3WA9 A;  5B32 D;  4Z5T D;  3R45 B;  5F99 C;  3KXB C;  3KWQ B;  1KX5 D;  3W96 B;  5BNV A;  5B1L A;  1KX5 A;  1Q9C A;  4J8V C;  4E45 A;  1WWS A;  1P3M D;  5B0Y A;  2CV5 A;  1M1A D;  1EQZ A;  3REH B;  1M1A A;  5DNN A;  3AV2 D;  3MGR D;  2G5I C;  1BH8 A;  3AZN B;  3AZG B;  3B6F D;  2DF4 C;  2YFW A;  5CP6 D;  1P3L D;  4XZQ D;  4J8U C;  5FUG B;  3AV1 D;  5GT3 C;  4Z66 D;  4XZQ A;  3LZ1 B;  4WJ3 C;  4H9P B;  5GXQ A;  5C3I C;  3W99 A;  3REL D;  4R8P A;  3AZK C;  1P3P D;  1U35 D;  4KUD D;  1KX4 C;  2NQB D;  3REL A;  4ZBJ B;  3FDD A;  3X1U A;  2NQB A;  4JJN A;  5AV9 A;  1M19 D;  3VH6 A;  2HIO A;  5E5A C;  1ID3 D;  3H0L C;  3V9R B;  2XD1 A;  2FJ7 A;  4WU9 C;  2Y2N A;  3WTP E;  3AZM C;  4EO5 B;  3O62 C;  5GT0 D;  2ARO D;  4AWL C;  4ZUX C;  3A6N D;  3B0D B;  3AZK D;  2YFV A;  3KUY B;  5GT0 A;  3EPJ A;  5B33 C;  1HQ3 A;  4YM6 D;  3B6G C;  3REJ D;  1F66 C;  3C1C D;  5AV5 C;  4DQY B;  4YM6 A;  5AVC C;  3MNN B;  1S32 C;  5B2I B;  4G91 C;  2BYM B;  2UWX A;  3UT9 A;  4M6B A;  3AYW A;  2PYO D;  4KHA A;  3TU4 D;  3KXB B;  5DNM D;  5F99 B;  1TZY D;  2Y2Q A;  5BNX B;  3AZH D;  2Y2J A;  1P3A D;  3AZI D;  4J8V B;  3AN2 D;  5B31 A;  5AV6 C;  1P3A A;  3LZ0 D;  3LEL A;  3AZI A;  3LJA D;  4XUJ D;  1P34 A;  5B0Z D;  1P3G A;  3MGS C;  3WKJ D;  4XUJ A;  4QLC D;  5GSU A;  5B32 C;  5B0Z A;  3WTP D;  4Z5T C;  3WKJ A;  4KUD C;  5B40 D;  1TAF A;  2Y2L A;  4J8U B;  4WU8 A;  5GT3 B;  4WNN B;  2J8P A;  5BO0 A;  2Y2K A;  3MGP C;  5B40 A;  1P3M C;  5B24 D;  4LD9 A;  3X1V A;  5AY8 D;  5C3I B;  1P3O D;  3MVD D;  5CPJ C;  4H9O B;  1WWI A;  4CSR B;  1P3B A;  1M18 A;  3AV2 C;  3B0C W;  3MGR C;  5AY8 A;  3AZL D;  1KX4 B;  1PZR A;  3B6F C;  5CP6 C;  1P3L C;  4YS3 A;  1KX3 D;  1KU5 A;  3AV1 C;  4X23 D;  3VH5 T;  2G5H C;  4Z66 C;  1KX3 A;  2F8N K;  5E5A B;  3REI A;  5AVB B;  5JRG A;  5B2J D;  1T3U A;  3MGQ D;  3REK D;  1P3P C;  4WU9 B;  1U35 C;  4DRB A;  5B2J A;  4J8W D;  2JCH A;  3X1T A;  3UTA C;  4KGC A;  4CAY B;  3VH6 W;  3MGQ A;  3REK A;  3AZM B;  3O62 B;  5AVB A;  1ZLA C;  3EPL A;  4J8X A;  4AWL B;  1M19 C;  3A1K A;  5CPI A;  1ID3 C;  3WAA D;  5KDM B;  3NQJ A;  5B33 B;  3AZE C;  1P3I C;  3B6G B;  1F66 B;  5AV5 B;  3AFA A;  3W98 C;  3WA9 D;  4NE6 A;  5AVC B;  5B1M C;  1S32 B;  4G91 B;  1JFI B;  2ARO C;  5B1L D;  5AV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...