5B1LA

The mouse nucleosome structure containing h3t
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
molecule keywords Histone H3t
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lA00
4Z66B 3MVDD 3O62A 4Z66A 4Z2MH 3A6NC 5BS7A 3UT9D 2LY8A 3REKC 1N1JB 4H9SC 5F99A 5B33A 1P3BD 3MGPB 3MGSC 5CPKC 3LELB 5B40D 5B31D 5B2JD 1TZYA 5C3IB 5AV5B 3MVDC 1TZYB 1Q9CA 3UTAA 1F1EA 2BYKB 4NE5A 3X1UC 5AV6A 3RELC 3AV1C 3WTPC 1KX3D 3REHB 2IO5C 4KUDC 5B33B 4ZUXA 5B40C 5B2JC 3KWQB 3LZ0C 3X1SD 5AV5C 4Z5TB 3KWQA 4R8PC 3AZKD 1P3OB 2L5AA 3LZ1D 4XUJC 4EO5B 4X23A 4JJNB 3AZFB 3WA9B 1P3OA 3AN2D 3X1SA 5B40B 3REID 5BO0A 5JA4B 5CP6D 5AV6B 3AZKA 4KGCC 3B6FB 3B0CT 5KDMB 1P3IB 3LZ0D 5AY8C 4UUZB 4J8UA 3AZNB 2FJ7B 1HQ3A 5FUGA 5AV6D 1JFIA 1EQZB 4Z2MG 3AZNC 3TU4B 3REIB 2CV5D 1R4VA 3UTAD 3AZHC 4LD9D 1M19C 3WA9D 4J8XD 5CP6C 5BNXB 3REJA 2PYOC 3VH5A 3W96C 3AZKB 3C1CD 4JJNC 3X1TC 1P3IA 2AROB 3WAAB 5GXQC 4Z5TC 1KX4B 1P3KA 4G92C 1P3KB 3WKJC 4LD9C 5F99B 2NZDA 5E5AB 3X1TD 3MGRC 3AZMA 5GT0A 1P3LC 5B32A 5B1MB 5AV8A 3AZEC 3X1VA 3WKJD 2NQBA 5B0ZD 1P34D 3MGRB 1ID3D 1F66D 4WU9C 2NQBB 1H3OA 1P3KD 4H9QA 3AZIA 4WZSB 3KXBC 5B24B 1KX4D 3W99A 3UTBA 5JRGD 3MGQC 3C1BC 4DRBA 3AFAD 4XZQB 3WA9A 5AVCD 3AFAB 1U35D 4J8WA 4J8VC 5JRGB 3W99C 3AZIC 3AZFC 3W98A 4WU9A 3REHA 5B2IA 5B24A 3MGQD 3VH6T 1P3PD 3AZLC 5AV8C 3AZEA 5B32C 3AZJA 3X1UB 4YS3B 5B1MD 5DNNA 3V9RA 5BNVA 5B31C 5BNVB 3B6FA 4XUJB 4ZUXD 3AZLD 4H9RB 3REKD 5GXQA 3O62B 1HTAA 3AZGC 1B67A 2NZDB 5B1LB 1KX3C 5BNXA 1TZYD 1M19A 3AZHA 3LJAA 5AV5D 1KX5C 4M6BA 3X1UD 2AROA 3MGPD 3LZ1A 3LZ1C 3X1VB 5AY8B 3LJAC 3UT9B 5AY8A 5B1LC 3W98D 4KGCA 4CAYA 5AY8D 5CP6B 3AZHB 3KUYC 2BYMB 3AN2B 5B0YD 5AV9A 3LZ1B 3NQJA 2RVQC 5AV9B 1M1AB 1AOIA 4X23B 5B24C 1M19D 1KX5B 3REHC 4KUDB 4H9PA 5B1LD 3AV2C 5B40A 3X1SB 3W98C 3W97B 4KUDA 4E45A 5B33D 5AV6C 3RELA 5DNNC 3KUYD 3AZIB 1F66A 3W99B 5DNMD 4WU8D 3UTAC 2NQBD 3AZLB 2BYMA 4EO5C 3WA9C 3AZLA 3MVDA 5DNNB 5B2IC 4AWLB 3MGSA 5B31B 3W97C 3LELD 5F99C 3W97A 2F8NB 1P3BB 5BT1D 3B0BA 5E5AD 4J8VA 5BO0B 4WU9B 3B6GB 4J8WC 1M18D 3VH6W 2NQBC 3A6NA 2HIOB 2YFWB 5DNMB 3C1BA 3MVDB 3MGQA 1F66C 1HQ3B 5GT0C 3UTBC 3VH5W 3W97D 5B31G 1P3AB 3AV2A 5AVCB 5BT1C 4LD9A 1AOIC 4WV4B 3X1VC 4NFTA 1P3KC 5AV9C 2YFWA 1EQZD 1HQ3D 4H9NA 3KUYA 1P3IC 5AVBB 3UTBD 4H9NB 3AZMC 3MGRA 3C1BD 2PYOA 1P34B 5B1LA 5CP6A 2NZDC 1P3MC 1AOID 4DRAA 1M18A 4CSRA 3X1VD 3WTPE 3LJAB 3NQJB 3AZFD 2AROC 1HQ3C 1KX5A 5B32D 3X1TA 4JJNA 5CPJB 3RELB 1KX3A 5GSUD 4KGCB 1ZLAB 3X1SC 1KX3B 3AZGA 5CPIA 4CSRB 4R8PD 5G49B 3RELD 3WAAD 3WTPD 4ZUXB 4KUDD 3C1CB 5G49A 5AV5A 4E44A 3AN2C 4J8UC 5B2JA 3C1CA 3B6FC 5B31A 4ZUXC 1BH9A 5B2JB 3UTAB 1P3MB 3AZKC 3WTPA 3W96B 4J8XA 4HGAB 3AZJC 2F8NG 1P3OC 5CPIB 3W98B 3AZND 3MGQB 3KWQC 4J8UD 3LZ0A 3R45B 3AZFA 4H9SA 3B0DB 4WNNB 4HGAC 1P3OD 5BS7C 3AYWD 4G91C 4J8VB 1P3AD 3O62C 4YM6D 5GT3D 3A6NB 5C3IC 2PYOD 3KWQD 5AVBA 4R8PB 5CHLB 3REHD 3KXBA 3B6GC 1EQZA 5B0YC 2HIOD 5B33C 5GXQD 3KXBB 1M18B 3REKA 4H9OA 1ULYA 3AV1B 3WKJB 4H9QB 5AVCA 3AYWC 3B0CW 4G92B 1P3AC 4ZBJB 3AV2D 4Z66C 5AV8B 4YS3D 5B1MA 5DNND 1ID3C 3X1TB 1P3LA 1KX4A 5DNMC 2HUEB 3LELC 2HIOC 1P3LB 4ZBJC 1ZLAA 1P34A 3MNND 3TU4C 4H9OB 3WKJA 5AVBD 3UTBB 5E5AA 5B2ID 3MNNA 3AFAC 3VH6A 1M1AC 4Z5TA 2FJ7C 4XZQA 1P3FC 1P3FA 1BH9B 2F8NH 1BH8A 4QLCB 1P3GB 3W96A 1P3BC 4J8XB 3AZJB 4YS3A 3REJC 1BH8B 4QLCA 1P3GA 3MNNC 2CV5B 1H3OB 5B2IB 4AWLC 1WWIA 3UT9C 4UUZA 1TAFA 4J8UB 3AZNA 3MNNB 2FJ7D 1BFMA 3LZ0B 5DNMA 1P3ID 5B0ZB 5CPKD 5B1MC 3REJD 4WNNA 1P3PC 1P3MD 2JSSA 5AV8D 1P3AA 2CV5A 5CPJC 5JA4A 4XUJA 3V9RB 4X23C 3AZMD 1A7WA 3WAAA 2F8NA 4H9RA 3AV1D 5B0YA 4R8PA 3B6GA 3AZGD 2NZDD 4WU8B 3VH5T 5GSUA 1S32A 5FUGB 1JFIB 4KGCD 4G91B 5GSUB 3REKB 3AV1A 3REIA 2IO5B 2AROD 3KSYA 3X1UA 5CPJD 4XUJD 5GT3B 4YM6B 1M19B 1KX5D 4X23D 3AZMB 1N1JA 5B32B 3REIC 3MGPA 5B0YB 5GSUC 1TZYC 3LJAD 3AZHD 5CPKA 1AOIB 3MGPC 3WAAC 5CPKB 5CPID 2CV5C 3B6FD 4J8XC 4CAYB 3B0DC 2RVQD 1S32C 3W96D 1B6WA 1P3FB 3C1CC 4JJND 3AZJD 1U35B 3AN2A 4XZQD 4NE3A 4Z5TD 1WWSA 3UT9A 3WTPB 4NE6A 5CPIC 5CPJA 1KU5A 5B24D 2BYKA 5GT3C 4YM6C 3O62D 3AZED 5KDMA 1ZLAD 2HUEC 1P3PA 1S32D 2F8NK 3AZGB 5B0ZC 1F66B 2YFVA 3MGRD 1ID3B 1P3LD 4WU9D 3NQUB 3B6GD 2CWEA 4WU8C 1U35A 4XZQC 4KHAA 3NQUA 2F8ND 1M1AA 3AFAA 3R45A 4J8WB 4KHAB 4H9PB 5E5AC 5JRGA 5JRGC 4J8WD 1M18C 3AV2B 1P34C 3REJB 1P3MA 1ZLAC 4QLCC 1P3GC 4YS3C 1TAFB 2HIOA 5F99D 1P3BA 1P3PB 4WU8A 1U35C 5GXQB 3KXBD 1KX4C 3C1BB 2YFVB 1S32B 1ID3A 5B0ZA 3W99D 3KUYB 3AZID 2FJ7A 3AZEB 4Z66D 5GT3A 4YM6A 2PYOB 3MGSB 3A6ND 5AVCC 3AYWA 3TU4A 4J8VD 5GT0D 3AYWB 1M1AD 4QLCD 5B32G 5AV9D 1P3GD 5GT0B 1EQZC 3LELA 4LD9B 1P3FD 3MGSD 3TU4D 5AVBC
chains in the Genus database with same CATH superfamily
4Z66B 3MVDD 3O62A 4Z66A 4Z2MH 3A6NC 5BS7A 2W8SA 3UT9D 2LY8A 3REKC 1N1JB 4H9SC 5F99A 5B33A 1P3BD 3MGPB 3MGSC 5CPKC 3LELB 5B40D 5B31D 5B2JD 1TZYA 5C3IB 5AV5B 3MVDC 1TZYB 2ZY5A 1Q9CA 3UTAA 1F1EA 2BYKB 4NE5A 2Y2PA 3X1UC 5AV6A 2DF4C 3RELC 3WTPC 3AV1C 1KX3D 3REHB 2IO5C 4KUDC 5B33B 4ZUXA 5B40C 5B2JC 3KWQB 3LZ0C 3X1SD 5AV5C 4Z5TB 2Y2MA 3KWQA 4R8PC 3H0MC 3AZKD 4UPKA 1P3OB 2L5AA 3LZ1D 4XUJC 4EO5B 4X23A 4JJNB 3AZFB 3WA9B 1P3OA 3AN2D 3P5JB 3X1SA 5B40B 3REID 5BO0A 5JA4B 5CP6D 5AV6B 3AZKA 4KGCC 3B6FB 3B0CT 5KDMB 1P3IB 3LZ0D 5AY8C 4UUZB 4J8UA 3AZNB 2FJ7B 1HQ3A 3EPHA 5FUGA 5AV6D 1JFIA 1EQZB 4Z2MG 3AZNC 3TU4B 3REIB 2CV5D 1R4VA 3UTAD 3AZHC 4LD9D 1M19C 3WA9D 4J8XD 5CP6C 5BNXB 3REJA 2PYOC 3VH5A 3W96C 3AZKB 3C1CD 4JJNC 3X1TC 1P3IA 2AROB 3WAAB 2G5IC 4Z5TC 5GXQC 1P3KA 1KX4B 4G92C 1P3KB 4WJ3C 3WKJC 4LD9C 5F99B 2NZDA 5E5AB 3X1TD 2ZY3A 3MGRC 3AZMA 5GT0A 1P3LC 5B32A 5B1MB 3FDDA 5AV8A 3AZEC 3X1VA 3WKJD 2NQBA 5B0ZD 1P34D 3MGRB 1ID3D 1F66D 4WU9C 2NQBB 1H3OA 1P3KD 4H9QA 3AZIA 4WZSB 3KXBC 5B24B 1KX4D 3W99A 3UTBA 5JRGD 3MGQC 3C1BC 4DRBA 3AFAD 4XZQB 3WA9A 5AVCD 3AFAB 1U35D 4J8WA 4J8VC 5JRGB 3W99C 3AZIC 3AZFC 3W98A 4WU9A 3REHA 5B2IA 5B24A 2Y2KA 3MGQD 3VH6T 1P3PD 3AZLC 5AV8C 3AZEA 5B32C 3AZJA 3X1UB 4YS3B 5B1MD 5DNNA 3EG5B 3V9RA 5BNVA 5B31C 5BNVB 3B6FA 4XUJB 4ZUXD 3AZLD 4H9RB 3REKD 5GXQA 3O62B 1HTAA 3AZGC 1B67A 2NZDB 5B1LB 1KX3C 5BNXA 1TZYD 1M19A 3AZHA 3LJAA 5AV5D 1KX5C 4M6BA 2Y2NA 3X1UD 2AROA 3MGPD 3LZ1A 3LZ1C 3X1VB 5AY8B 3LJAC 3UT9B 5AY8A 5B1LC 3W98D 4KGCA 4CAYA 5AY8D 5CP6B 3AZHB 2ZM5A 3KUYC 2BYMB 3AN2B 5B0YD 5AV9A 1T3UA 3LZ1B 3NQJA 2RVQC 5AV9B 1M1AB 1AOIA 4X23B 5B24C 1M19D 1KX5B 3REHC 4KUDB 4H9PA 5B1LD 3AV2C 5B40A 3X1SB 3W98C 3W97B 4KUDA 4E45A 5B33D 5AV6C 3RELA 5DNNC 3KUYD 3AZIB 1F66A 3W99B 5DNMD 4WU8D 3UTAC 2NQBD 3AZLB 2BYMA 4EO5C 3WA9C 3AZLA 3MVDA 3H0LC 5DNNB 5B2IC 4AWLB 3MGSA 5B31B 3W97C 3LELD 5F99C 3W97A 2F8NB 1P3BB 5BT1D 3B0BA 5E5AD 4J8VA 5BO0B 4WU9B 3B6GB 4J8WC 1Z2CB 3VH6W 1M18D 2NQBC 3A6NA 2Y2QA 2HIOB 2YFWB 3AL0C 5DNMB 3C1BA 3MVDB 2RIQA 3MGQA 1F66C 1HQ3B 5GT0C 3UTBC 3VH5W 3W97D 5B31G 1P3AB 3AV2A 5AVCB 5BT1C 4LD9A 1AOIC 4WV4B 3X1VC 2JCHA 4NFTA 1P3KC 5AV9C 2YFWA 2J8PA 1EQZD 1HQ3D 4H9NA 3KUYA 1P3IC 5AVBB 3UTBD 4H9NB 3AZMC 3MGRA 3C1BD 2PYOA 1P34B 5B1LA 5CP6A 2NZDC 1P3MC 1AOID 4DRAA 1M18A 4CSRA 3X1VD 3WTPE 3LJAB 3NQJB 3AZFD 2AROC 1HQ3C 1KX5A 2FFFB 5B32D 3X1TA 4JJNA 2Y2OA 5CPJB 3RELB 3F6TA 3EPLA 1KX3A 5GSUD 4KGCB 1ZLAB 3A1IA 3X1SC 1KX3B 3AZGA 2G5HC 5CPIA 4CSRB 4R8PD 5G49B 3RELD 3WAAD 3WTPD 4ZUXB 4KUDD 3C1CB 5G49A 5AV5A 4E44A 2VQRA 3AN2C 4J8UC 5B2JA 3C1CA 3B6FC 5B31A 4ZUXC 1BH9A 3H0RC 5B2JB 3UTAB 1P3MB 3AZKC 3WTPA 3W96B 4J8XA 2UWXA 4HGAB 3AZJC 2F8NG 1P3OC 5CPIB 3W98B 3AZND 3MGQB 3KWQC 4J8UD 3LZ0A 3R45B 3AZFA 4H9SA 3B0DB 4WNNB 4HGAC 1P3OD 5BS7C 3AYWD 4G91C 4J8VB 1P3AD 4YM6D 5GT3D 3O62C 3A6NB 5C3IC 2PYOD 3KWQD 5AVBA 4R8PB 5CHLB 3REHD 3KXBA 3B6GC 1EQZA 5B0YC 2HIOD 5B33C 5GXQD 3KXBB 1M18B 3REKA 4H9OA 1ULYA 3AV1B 3WKJB 4H9QB 5AVCA 3AYWC 3B0CW 4G92B 1P3AC 4ZBJB 3AV2D 4Z66C 5AV8B 4YS3D 5B1MA 5DNND 1ID3C 2XD1A 3X1TB 1P3LA 1KX4A 5DNMC 2HUEB 3LELC 2HIOC 1P3LB 4ZBJC 1ZLAA 1P34A 3MNND 3TU4C 4H9OB 3WKJA 5AVBD 3UTBB 5E5AA 3EPJA 5B2ID 3MNNA 3AFAC 3VH6A 1M1AC 4Z5TA 2FJ7C 4XZQA 1P3FC 1P3FA 1BH9B 2F8NH 1BH8A 4QLCB 2Y2GA 3W96A 1P3GB 1P3BC 4J8XB 1PZRA 3AZJB 4YS3A 3REJC 1BH8B 4QLCA 1P3GA 3MNNC 2CV5B 1H3OB 5B2IB 4AWLC 1WWIA 3UT9C 4UUZA 1TAFA 4J8UB 3AZNA 3MNNB 2FJ7D 1BFMA 3LZ0B 5DNMA 1P3ID 5B0ZB 5CPKD 5B1MC 2JE5A 3REJD 4WNNA 1P3PC 1P3MD 2JSSA 5AV8D 1P3AA 2CV5A 5CPJC 5JA4A 4XUJA 3V9RB 4X23C 3AZMD 1A7WA 3WAAA 2F8NA 4H9RA 3AV1D 5B0YA 4R8PA 3B6GA 3AZGD 2NZDD 4WU8B 3VH5T 5GSUA 1S32A 5FUGB 1W2EA 1JFIB 4KGCD 4G91B 5GSUB 3REKB 3AV1A 3REIA 2IO5B 2AROD 3KSYA 3X1UA 5CPJD 4XUJD 4YM6B 5GT3B 4DQYB 1M19B 4X23D 1KX5D 3AZMB 1N1JA 5B32B 3REIC 3MGPA 5B0YB 5GSUC 1TZYC 3LJAD 2F2AC 3AZHD 5CPKA 3EPKA 1AOIB 3MGPC 3WAAC 5CPKB 5CPID 2CV5C 3B6FD 2Y2IA 4J8XC 4CAYB 3B0DC 2RVQD 1S32C 3W96D 1B6WA 1P3FB 3C1CC 4JJND 3AZJD 1U35B 3AN2A 4XZQD 4NE3A 4Z5TD 3KFUG 1WWSA 3UT9A 3WTPB 4NE6A 5CPIC 5CPJA 1KU5A 5B24D 2BYKA 5GT3C 4YM6C 3O62D 3AZED 5KDMA 2BG1A 1ZLAD 2HUEC 2Y2LA 1P3PA 1S32D 2F8NK 3AZGB 5B0ZC 1F66B 2YFVA 3MGRD 1ID3B 1P3LD 4WU9D 2DQNC 3NQUB 2CWEA 3B6GD 4WU8C 2XD5A 1U35A 4XZQC 4KHAA 3NQUA 2F8ND 1M1AA 3AFAA 3R45A 4J8WB 4KHAB 4H9PB 5E5AC 5JRGA 5JRGC 4J8WD 1M18C 3AV2B 1P34C 3REJB 1P3MA 1ZLAC 4QLCC 1P3GC 4YS3C 1TAFB 2HIOA 5F99D 1P3BA 1P3PB 4WU8A 1U35C 5GXQB 3KXBD 1KX4C 3C1BB 2YFVB 1S32B 1ID3A 5B0ZA 2Y2JA 3W99D 3KUYB 3AZID 2ZY2A 2FJ7A 3AZEB 3IP4C 4Z66D 5GT3A 4YM6A 2Y2HA 3MGSB 3A6ND 5AVCC 3AYWA 2PYOB 2ZY4A 3TU4A 3A1KA 4J8VD 5GT0D 3AYWB 1M1AD 4QLCD 5B32G 5AV9D 1P3GD 5GT0B 1EQZC 3LELA 4LD9B 1P3FD 3MGSD 3TU4D 5AVBC
chains in the Genus database with same CATH topology
4Z66B 3MVDD 3O62A 4Z66A 4Z2MH 3A6NC 5BS7A 2W8SA 3UT9D 2LY8A 3REKC 1N1JB 4H9SC 5F99A 5B33A 1P3BD 3MGPB 3MGSC 5CPKC 3LELB 5B40D 5B31D 5B2JD 1TZYA 5C3IB 5AV5B 3MVDC 1TZYB 2ZY5A 1Q9CA 3UTAA 1F1EA 2BYKB 4NE5A 2Y2PA 3X1UC 5AV6A 2DF4C 3RELC 3WTPC 3AV1C 1KX3D 3REHB 2IO5C 4KUDC 5B33B 4ZUXA 5B40C 5B2JC 3KWQB 3LZ0C 3X1SD 5AV5C 4Z5TB 2Y2MA 3KWQA 4R8PC 3H0MC 3AZKD 4UPKA 1P3OB 2L5AA 3LZ1D 4XUJC 4EO5B 4X23A 4JJNB 3AZFB 3WA9B 1P3OA 3AN2D 3P5JB 3X1SA 5B40B 3REID 5BO0A 5JA4B 5CP6D 5AV6B 3AZKA 4KGCC 3B6FB 3B0CT 5KDMB 1P3IB 3LZ0D 5AY8C 4UUZB 4J8UA 3AZNB 2FJ7B 1HQ3A 3EPHA 5FUGA 5AV6D 1JFIA 1EQZB 4Z2MG 3AZNC 3TU4B 3REIB 2CV5D 1R4VA 3UTAD 3AZHC 4LD9D 1M19C 3WA9D 4J8XD 5CP6C 5BNXB 3REJA 2PYOC 3VH5A 3W96C 3AZKB 3C1CD 4JJNC 3X1TC 1P3IA 2AROB 3WAAB 2G5IC 4Z5TC 5GXQC 1P3KA 1KX4B 4G92C 1P3KB 4WJ3C 3WKJC 4LD9C 5F99B 2NZDA 5E5AB 3X1TD 2ZY3A 3MGRC 3AZMA 5GT0A 1P3LC 5B32A 5B1MB 3FDDA 5AV8A 3AZEC 3X1VA 3WKJD 2NQBA 5B0ZD 1P34D 3MGRB 1ID3D 1F66D 4WU9C 2NQBB 1H3OA 1P3KD 4H9QA 3AZIA 4WZSB 3KXBC 5B24B 1KX4D 3W99A 3UTBA 5JRGD 3MGQC 3C1BC 4DRBA 3AFAD 4XZQB 3WA9A 5AVCD 3AFAB 1U35D 4J8WA 4J8VC 5JRGB 3W99C 3AZIC 3AZFC 3W98A 4WU9A 3REHA 5B2IA 5B24A 2Y2KA 3MGQD 3VH6T 1P3PD 3AZLC 5AV8C 3AZEA 5B32C 3AZJA 3X1UB 4YS3B 5B1MD 5DNNA 3EG5B 3V9RA 5BNVA 5B31C 5BNVB 3B6FA 4XUJB 4ZUXD 3AZLD 4H9RB 3REKD 5GXQA 3O62B 1HTAA 3AZGC 1B67A 2NZDB 5B1LB 1KX3C 5BNXA 1TZYD 1M19A 3AZHA 3LJAA 5AV5D 1KX5C 4M6BA 2Y2NA 3X1UD 2AROA 3MGPD 3LZ1A 3LZ1C 3X1VB 5AY8B 3LJAC 3UT9B 5AY8A 5B1LC 3W98D 4KGCA 4CAYA 5AY8D 5CP6B 3AZHB 2ZM5A 3KUYC 2BYMB 3AN2B 5B0YD 5AV9A 1T3UA 3LZ1B 3NQJA 2RVQC 5AV9B 1M1AB 1AOIA 4X23B 5B24C 1M19D 1KX5B 3REHC 4KUDB 4H9PA 5B1LD 3AV2C 5B40A 3X1SB 3W98C 3W97B 4KUDA 4E45A 5B33D 5AV6C 3RELA 5DNNC 3KUYD 3AZIB 1F66A 3W99B 5DNMD 4WU8D 3UTAC 2NQBD 3AZLB 2BYMA 4EO5C 3WA9C 3AZLA 3MVDA 3H0LC 5DNNB 5B2IC 4AWLB 3MGSA 5B31B 3W97C 3LELD 5F99C 3W97A 2F8NB 1P3BB 5BT1D 3B0BA 5E5AD 4J8VA 5BO0B 4WU9B 3B6GB 4J8WC 1Z2CB 3VH6W 1M18D 2NQBC 3A6NA 2Y2QA 2HIOB 2YFWB 3AL0C 5DNMB 3C1BA 3MVDB 2RIQA 3MGQA 1F66C 1HQ3B 5GT0C 3UTBC 3VH5W 3W97D 5B31G 1P3AB 3AV2A 5AVCB 5BT1C 4LD9A 1AOIC 4WV4B 3X1VC 2JCHA 4NFTA 1P3KC 5AV9C 2YFWA 2J8PA 1EQZD 1HQ3D 4H9NA 3KUYA 1P3IC 5AVBB 3UTBD 4H9NB 3AZMC 3MGRA 3C1BD 2PYOA 1P34B 5B1LA 5CP6A 2NZDC 1P3MC 1AOID 4DRAA 1M18A 4CSRA 3X1VD 3WTPE 3LJAB 3NQJB 3AZFD 2AROC 1HQ3C 1KX5A 2FFFB 5B32D 3X1TA 4JJNA 2Y2OA 5CPJB 3RELB 3F6TA 3EPLA 1KX3A 5GSUD 4KGCB 1ZLAB 3A1IA 3X1SC 1KX3B 3AZGA 2G5HC 5CPIA 4CSRB 4R8PD 5G49B 3RELD 3WAAD 3WTPD 4ZUXB 4KUDD 3C1CB 5G49A 5AV5A 4E44A 2VQRA 3AN2C 4J8UC 5B2JA 3C1CA 3B6FC 5B31A 4ZUXC 1BH9A 3H0RC 5B2JB 3UTAB 1P3MB 3AZKC 3WTPA 3W96B 4J8XA 2UWXA 4HGAB 3AZJC 2F8NG 1P3OC 5CPIB 3W98B 3AZND 3MGQB 3KWQC 4J8UD 3LZ0A 3R45B 3AZFA 4H9SA 3B0DB 4WNNB 4HGAC 1P3OD 5BS7C 3AYWD 4G91C 4J8VB 1P3AD 4YM6D 5GT3D 3O62C 3A6NB 5C3IC 2PYOD 3KWQD 5AVBA 4R8PB 5CHLB 3REHD 3KXBA 3B6GC 1EQZA 5B0YC 2HIOD 5B33C 5GXQD 3KXBB 1M18B 3REKA 4H9OA 1ULYA 3AV1B 3WKJB 4H9QB 5AVCA 3AYWC 3B0CW 4G92B 1P3AC 4ZBJB 3AV2D 4Z66C 5AV8B 4YS3D 5B1MA 5DNND 1ID3C 2XD1A 3X1TB 1P3LA 1KX4A 5DNMC 2HUEB 3LELC 2HIOC 1P3LB 4ZBJC 1ZLAA 1P34A 3MNND 3TU4C 4H9OB 3WKJA 5AVBD 3UTBB 5E5AA 3EPJA 5B2ID 3MNNA 3AFAC 3VH6A 1M1AC 4Z5TA 2FJ7C 4XZQA 1P3FC 1P3FA 1BH9B 2F8NH 1BH8A 4QLCB 2Y2GA 3W96A 1P3GB 1P3BC 4J8XB 1PZRA 3AZJB 4YS3A 3REJC 1BH8B 4QLCA 1P3GA 3MNNC 2CV5B 1H3OB 5B2IB 4AWLC 1WWIA 3UT9C 4UUZA 1TAFA 4J8UB 3AZNA 3MNNB 2FJ7D 1BFMA 3LZ0B 5DNMA 1P3ID 5B0ZB 5CPKD 5B1MC 2JE5A 3REJD 4WNNA 1P3PC 1P3MD 2JSSA 5AV8D 1P3AA 2CV5A 5CPJC 5JA4A 4XUJA 3V9RB 4X23C 3AZMD 1A7WA 3WAAA 2F8NA 4H9RA 3AV1D 5B0YA 4R8PA 3B6GA 3AZGD 2NZDD 4WU8B 3VH5T 5GSUA 1S32A 5FUGB 1W2EA 1JFIB 4KGCD 4G91B 5GSUB 3REKB 3AV1A 3REIA 2IO5B 2AROD 3KSYA 3X1UA 5CPJD 4XUJD 4YM6B 5GT3B 4DQYB 1M19B 4X23D 1KX5D 3AZMB 1N1JA 5B32B 3REIC 3MGPA 5B0YB 5GSUC 1TZYC 3LJAD 2F2AC 3AZHD 5CPKA 3EPKA 1AOIB 3MGPC 3WAAC 5CPKB 5CPID 2CV5C 3B6FD 2Y2IA 4J8XC 4CAYB 3B0DC 2RVQD 1S32C 3W96D 1B6WA 1P3FB 3C1CC 4JJND 3AZJD 1U35B 3AN2A 4XZQD 4NE3A 4Z5TD 3KFUG 1WWSA 3UT9A 3WTPB 4NE6A 5CPIC 5CPJA 1KU5A 5B24D 2BYKA 5GT3C 4YM6C 3O62D 3AZED 5KDMA 2BG1A 1ZLAD 2HUEC 2Y2LA 1P3PA 1S32D 2F8NK 3AZGB 5B0ZC 1F66B 2YFVA 3MGRD 1ID3B 1P3LD 4WU9D 2DQNC 3NQUB 2CWEA 3B6GD 4WU8C 2XD5A 1U35A 4XZQC 4KHAA 3NQUA 2F8ND 1M1AA 3AFAA 3R45A 4J8WB 4KHAB 4H9PB 5E5AC 5JRGA 5JRGC 4J8WD 1M18C 3AV2B 1P34C 3REJB 1P3MA 1ZLAC 4QLCC 1P3GC 4YS3C 1TAFB 2HIOA 5F99D 1P3BA 1P3PB 4WU8A 1U35C 5GXQB 3KXBD 1KX4C 3C1BB 2YFVB 1S32B 1ID3A 5B0ZA 2Y2JA 3W99D 3KUYB 3AZID 2ZY2A 2FJ7A 3AZEB 3IP4C 4Z66D 5GT3A 4YM6A 2Y2HA 3MGSB 3A6ND 5AVCC 3AYWA 2PYOB 2ZY4A 3TU4A 3A1KA 4J8VD 5GT0D 3AYWB 1M1AD 4QLCD 5B32G 5AV9D 1P3GD 5GT0B 1EQZC 3LELA 4LD9B 1P3FD 3MGSD 3TU4D 5AVBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 B;  3MVD D;  3O62 A;  4Z66 A;  4Z2M H;  3A6N C;  5BS7 A;  3UT9 D;  2LY8 A;  3REK C;  1N1J B;  4H9S C;  5F99 A;  5B33 A;  1P3B D;  3MGP B;  3MGS C;  5CPK C;  3LEL B;  5B40 D;  5B31 D;  5B2J D;  1TZY A;  5C3I B;  5AV5 B;  3MVD C;  1TZY B;  1Q9C A;  3UTA A;  1F1E A;  2BYK B;  4NE5 A;  3X1U C;  5AV6 A;  3REL C;  3AV1 C;  3WTP C;  1KX3 D;  3REH B;  2IO5 C;  4KUD C;  5B33 B;  4ZUX A;  5B40 C;  5B2J C;  3KWQ B;  3LZ0 C;  3X1S D;  5AV5 C;  4Z5T B;  3KWQ A;  4R8P C;  3AZK D;  1P3O B;  2L5A A;  3LZ1 D;  4XUJ C;  4EO5 B;  4X23 A;  4JJN B;  3AZF B;  3WA9 B;  1P3O A;  3AN2 D;  3X1S A;  5B40 B;  3REI D;  5BO0 A;  5JA4 B;  5CP6 D;  5AV6 B;  3AZK A;  4KGC C;  3B6F B;  3B0C T;  5KDM B;  1P3I B;  3LZ0 D;  5AY8 C;  4UUZ B;  4J8U A;  3AZN B;  2FJ7 B;  1HQ3 A;  5FUG A;  5AV6 D;  1JFI A;  1EQZ B;  4Z2M G;  3AZN C;  3TU4 B;  3REI B;  2CV5 D;  1R4V A;  3UTA D;  3AZH C;  4LD9 D;  1M19 C;  3WA9 D;  4J8X D;  5CP6 C;  5BNX B;  3REJ A;  2PYO C;  3VH5 A;  3W96 C;  3AZK B;  3C1C D;  4JJN C;  3X1T C;  1P3I A;  2ARO B;  3WAA B;  5GXQ C;  4Z5T C;  1KX4 B;  1P3K A;  4G92 C;  1P3K B;  3WKJ C;  4LD9 C;  5F99 B;  2NZD A;  5E5A B;  3X1T D;  3MGR C;  3AZM A;  5GT0 A;  1P3L C;  5B32 A;  5B1M B;  5AV8 A;  3AZE C;  3X1V A;  3WKJ D;  2NQB A;  5B0Z D;  1P34 D;  3MGR B;  1ID3 D;  1F66 D;  4WU9 C;  2NQB B;  1H3O A;  1P3K D;  4H9Q A;  3AZI A;  4WZS B;  3KXB C;  5B24 B;  1KX4 D;  3W99 A;  3UTB A;  5JRG D;  3MGQ C;  3C1B C;  4DRB A;  3AFA D;  4XZQ B;  3WA9 A;  5AVC D;  3AFA B;  1U35 D;  4J8W A;  4J8V C;  5JRG B;  3W99 C;  3AZI C;  3AZF C;  3W98 A;  4WU9 A;  3REH A;  5B2I A;  5B24 A;  3MGQ D;  3VH6 T;  1P3P D;  3AZL C;  5AV8 C;  3AZE A;  5B32 C;  3AZJ A;  3X1U B;  4YS3 B;  5B1M D;  5DNN A;  3V9R A;  5BNV A;  5B31 C;  5BNV B;  3B6F A;  4XUJ B;  4ZUX D;  3AZL D;  4H9R B;  3REK D;  5GXQ A;  3O62 B;  1HTA A;  3AZG C;  1B67 A;  2NZD B;  5B1L B;  1KX3 C;  5BNX A;  1TZY D;  1M19 A;  3AZH A;  3LJA A;  5AV5 D;  1KX5 C;  4M6B A;  3X1U D;  2ARO A;  3MGP D;  3LZ1 A;  3LZ1 C;  3X1V B;  5AY8 B;  3LJA C;  3UT9 B;  5AY8 A;  5B1L C;  3W98 D;  4KGC A;  4CAY A;  5AY8 D;  5CP6 B;  3AZH B;  3KUY C;  2BYM B;  3AN2 B;  5B0Y D;  5AV9 A;  3LZ1 B;  3NQJ A;  2RVQ C;  5AV9 B;  1M1A B;  1AOI A;  4X23 B;  5B24 C;  1M19 D;  1KX5 B;  3REH C;  4KUD B;  4H9P A;  5B1L D;  3AV2 C;  5B40 A;  3X1S B;  3W98 C;  3W97 B;  4KUD A;  4E45 A;  5B33 D;  5AV6 C;  3REL A;  5DNN C;  3KUY D;  3AZI B;  1F66 A;  3W99 B;  5DNM D;  4WU8 D;  3UTA C;  2NQB D;  3AZL B;  2BYM A;  4EO5 C;  3WA9 C;  3AZL A;  3MVD A;  5DNN B;  5B2I C;  4AWL B;  3MGS A;  5B31 B;  3W97 C;  3LEL D;  5F99 C;  3W97 A;  2F8N B;  1P3B B;  5BT1 D;  3B0B A;  5E5A D;  4J8V A;  5BO0 B;  4WU9 B;  3B6G B;  4J8W C;  1M18 D;  3VH6 W;  2NQB C;  3A6N A;  2HIO B;  2YFW B;  5DNM B;  3C1B A;  3MVD B;  3MGQ A;  1F66 C;  1HQ3 B;  5GT0 C;  3UTB C;  3VH5 W;  3W97 D;  5B31 G;  1P3A B;  3AV2 A;  5AVC B;  5BT1 C;  4LD9 A;  1AOI C;  4WV4 B;  3X1V C;  4NFT A;  1P3K C;  5AV9 C;  2YFW A;  1EQZ D;  1HQ3 D;  4H9N A;  3KUY A;  1P3I C;  5AVB B;  3UTB D;  4H9N B;  3AZM C;  3MGR A;  3C1B D;  2PYO A;  1P34 B;  5B1L A;  5CP6 A;  2NZD C;  1P3M C;  1AOI D;  4DRA A;  1M18 A;  4CSR A;  3X1V D;  3WTP E;  3LJA B;  3NQJ B;  3AZF D;  2ARO C;  1HQ3 C;  1KX5 A;  5B32 D;  3X1T A;  4JJN A;  5CPJ B;  3REL B;  1KX3 A;  5GSU D;  4KGC B;  1ZLA B;  3X1S C;  1KX3 B;  3AZG A;  5CPI A;  4CSR B;  4R8P D;  5G49 B;  3REL D;  3WAA D;  3WTP D;  4ZUX B;  4KUD D;  3C1C B;  5G49 A;  5AV5 A;  4E44 A;  3AN2 C;  4J8U C;  5B2J A;  3C1C A;  3B6F C;  5B31 A;  4ZUX C;  1BH9 A;  5B2J B;  3UTA B;  1P3M B;  3AZK C;  3WTP A;  3W96 B;  4J8X A;  4HGA B;  3AZJ C;  2F8N G;  1P3O C;  5CPI B;  3W98 B;  3AZN D;  3MGQ B;  3KWQ C;  4J8U D;  3LZ0 A;  3R45 B;  3AZF A;  4H9S A;  3B0D B;  4WNN B;  4HGA C;  1P3O D;  5BS7 C;  3AYW D;  4G91 C;  4J8V B;  1P3A D;  3O62 C;  4YM6 D;  5GT3 D;  3A6N B;  5C3I C;  2PYO D;  3KWQ D;  5AVB A;  4R8P B;  5CHL B;  3REH D;  3KXB A;  3B6G C;  1EQZ A;  5B0Y C;  2HIO D;  5B33 C;  5GXQ D;  3KXB B;  1M18 B;  3REK A;  4H9O A;  1ULY A;  3AV1 B;  3WKJ B;  4H9Q B;  5AVC A;  3AYW C;  3B0C W;  4G92 B;  1P3A C;  4ZBJ B;  3AV2 D;  4Z66 C;  5AV8 B;  4YS3 D;  5B1M A;  5DNN D;  1ID3 C;  3X1T B;  1P3L A;  1KX4 A;  5DNM C;  2HUE B;  3LEL C;  2HIO C;  1P3L B;  4ZBJ C;  1ZLA A;  1P34 A;  3MNN D;  3TU4 C;  4H9O B;  3WKJ A;  5AVB D;  3UTB B;  5E5A A;  5B2I D;  3MNN A;  3AFA C;  3VH6 A;  1M1A C;  4Z5T A;  2FJ7 C;  4XZQ A;  1P3F C;  1P3F A;  1BH9 B;  2F8N H;  1BH8 A;  4QLC B;  1P3G B;  3W96 A;  1P3B C;  4J8X B;  3AZJ B;  4YS3 A;  3REJ C;  1BH8 B;  4QLC A;  1P3G A;  3MNN C;  2CV5 B;  1H3O B;  5B2I B;  4AWL C;  1WWI A;  3UT9 C;  4UUZ A;  1TAF A;  4J8U B;  3AZN A;  3MNN B;  2FJ7 D;  1BFM A;  3LZ0 B;  5DNM A;  1P3I D;  5B0Z B;  5CPK D;  5B1M C;  3REJ D;  4WNN A;  1P3P C;  1P3M D;  2JSS A;  5AV8 D;  1P3A A;  2CV5 A;  5CPJ C;  5JA4 A;  4XUJ A;  3V9R B;  4X23 C;  3AZM D;  1A7W A;  3WAA A;  2F8N A;  4H9R A;  3AV1 D;  5B0Y A;  4R8P A;  3B6G A;  3AZG D;  2NZD D;  4WU8 B;  3VH5 T;  5GSU A;  1S32 A;  5FUG B;  1JFI B;  4KGC D;  4G91 B;  5GSU B;  3REK B;  3AV1 A;  3REI A;  2IO5 B;  2ARO D;  3KSY A;  3X1U A;  5CPJ D;  4XUJ D;  5GT3 B;  4YM6 B;  1M19 B;  1KX5 D;  4X23 D;  3AZM B;  1N1J A;  5B32 B;  3REI C;  3MGP A;  5B0Y B;  5GSU C;  1TZY C;  3LJA D;  3AZH D;  5CPK A;  1AOI B;  3MGP C;  3WAA C;  5CPK B;  5CPI D;  2CV5 C;  3B6F D;  4J8X C;  4CAY B;  3B0D C;  2RVQ D;  1S32 C;  3W96 D;  1B6W A;  1P3F B;  3C1C C;  4JJN D;  3AZJ D;  1U35 B;  3AN2 A;  4XZQ D;  4NE3 A;  4Z5T D;  1WWS A;  3UT9 A;  3WTP B;  4NE6 A;  5CPI C;  5CPJ A;  1KU5 A;  5B24 D;  2BYK A;  5GT3 C;  4YM6 C;  3O62 D;  3AZE D;  5KDM A;  1ZLA D;  2HUE C;  1P3P A;  1S32 D;  2F8N K;  3AZG B;  5B0Z C;  1F66 B;  2YFV A;  3MGR D;  1ID3 B;  1P3L D;  4WU9 D;  3NQU B;  3B6G D;  2CWE A;  4WU8 C;  1U35 A;  4XZQ C;  4KHA A;  3NQU A;  2F8N D;  1M1A A;  3AFA A;  3R45 A;  4J8W B;  4KHA B;  4H9P B;  5E5A C;  5JRG A;  5JRG C;  4J8W D;  1M18 C;  3AV2 B;  1P34 C;  3REJ B;  1P3M A;  1ZLA C;  4QLC C;  1P3G C;  4YS3 C;  1TAF B;  2HIO A;  5F99 D;  1P3B A;  1P3P B;  4WU8 A;  1U35 C;  5GXQ B;  3KXB D;  1KX4 C;  3C1B B;  2YFV B;  1S32 B;  1ID3 A;  5B0Z A;  3W99 D;  3KUY B;  3AZI D;  2FJ7 A;  3AZE B;  4Z66 D;  5GT3 A;  4YM6 A;  2PYO B;  3MGS B;  3A6N D;  5AVC C;  3AYW A;  3TU4 A;  4J8V D;  5GT0 D;  3AYW B;  1M1A D;  4QLC D;  5B32 G;  5AV9 D;  1P3G D;  5GT0 B;  1EQZ C;  3LEL A;  4LD9 B;  1P3F D;  3MGS D;  3TU4 D;  5AVB C; 
#chains in the Genus database with same CATH topology
 4Z66 B;  3MVD D;  3O62 A;  4Z66 A;  4Z2M H;  3A6N C;  5BS7 A;  2W8S A;  3UT9 D;  2LY8 A;  3REK C;  1N1J B;  4H9S C;  5F99 A;  5B33 A;  1P3B D;  3MGP B;  3MGS C;  5CPK C;  3LEL B;  5B40 D;  5B31 D;  5B2J D;  1TZY A;  5C3I B;  5AV5 B;  3MVD C;  1TZY B;  2ZY5 A;  1Q9C A;  3UTA A;  1F1E A;  2BYK B;  4NE5 A;  2Y2P A;  3X1U C;  5AV6 A;  2DF4 C;  3REL C;  3WTP C;  3AV1 C;  1KX3 D;  3REH B;  2IO5 C;  4KUD C;  5B33 B;  4ZUX A;  5B40 C;  5B2J C;  3KWQ B;  3LZ0 C;  3X1S D;  5AV5 C;  4Z5T B;  2Y2M A;  3KWQ A;  4R8P C;  3H0M C;  3AZK D;  4UPK A;  1P3O B;  2L5A A;  3LZ1 D;  4XUJ C;  4EO5 B;  4X23 A;  4JJN B;  3AZF B;  3WA9 B;  1P3O A;  3AN2 D;  3P5J B;  3X1S A;  5B40 B;  3REI D;  5BO0 A;  5JA4 B;  5CP6 D;  5AV6 B;  3AZK A;  4KGC C;  3B6F B;  3B0C T;  5KDM B;  1P3I B;  3LZ0 D;  5AY8 C;  4UUZ B;  4J8U A;  3AZN B;  2FJ7 B;  1HQ3 A;  3EPH A;  5FUG A;  5AV6 D;  1JFI A;  1EQZ B;  4Z2M G;  3AZN C;  3TU4 B;  3REI B;  2CV5 D;  1R4V A;  3UTA D;  3AZH C;  4LD9 D;  1M19 C;  3WA9 D;  4J8X D;  5CP6 C;  5BNX B;  3REJ A;  2PYO C;  3VH5 A;  3W96 C;  3AZK B;  3C1C D;  4JJN C;  3X1T C;  1P3I A;  2ARO B;  3WAA B;  2G5I C;  4Z5T C;  5GXQ C;  1P3K A;  1KX4 B;  4G92 C;  1P3K B;  4WJ3 C;  3WKJ C;  4LD9 C;  5F99 B;  2NZD A;  5E5A B;  3X1T D;  2ZY3 A;  3MGR C;  3AZM A;  5GT0 A;  1P3L C;  5B32 A;  5B1M B;  3FDD A;  5AV8 A;  3AZE C;  3X1V A;  3WKJ D;  2NQB A;  5B0Z D;  1P34 D;  3MGR B;  1ID3 D;  1F66 D;  4WU9 C;  2NQB B;  1H3O A;  1P3K D;  4H9Q A;  3AZI A;  4WZS B;  3KXB C;  5B24 B;  1KX4 D;  3W99 A;  3UTB A;  5JRG D;  3MGQ C;  3C1B C;  4DRB A;  3AFA D;  4XZQ B;  3WA9 A;  5AVC D;  3AFA B;  1U35 D;  4J8W A;  4J8V C;  5JRG B;  3W99 C;  3AZI C;  3AZF C;  3W98 A;  4WU9 A;  3REH A;  5B2I A;  5B24 A;  2Y2K A;  3MGQ D;  3VH6 T;  1P3P D;  3AZL C;  5AV8 C;  3AZE A;  5B32 C;  3AZJ A;  3X1U B;  4YS3 B;  5B1M D;  5DNN A;  3EG5 B;  3V9R A;  5BNV A;  5B31 C;  5BNV B;  3B6F A;  4XUJ B;  4ZUX D;  3AZL D;  4H9R B;  3REK D;  5GXQ A;  3O62 B;  1HTA A;  3AZG C;  1B67 A;  2NZD B;  5B1L B;  1KX3 C;  5BNX A;  1TZY D;  1M19 A;  3AZH A;  3LJA A;  5AV5 D;  1KX5 C;  4M6B A;  2Y2N A;  3X1U D;  2ARO A;  3MGP D;  3LZ1 A;  3LZ1 C;  3X1V B;  5AY8 B;  3LJA C;  3UT9 B;  5AY8 A;  5B1L C;  3W98 D;  4KGC A;  4CAY A;  5AY8 D;  5CP6 B;  3AZH B;  2ZM5 A;  3KUY C;  2BYM B;  3AN2 B;  5B0Y D;  5AV9 A;  1T3U A;  3LZ1 B;  3NQJ A;  2RVQ C;  5AV9 B;  1M1A B;  1AOI A;  4X23 B;  5B24 C;  1M19 D;  1KX5 B;  3REH C;  4KUD B;  4H9P A;  5B1L D;  3AV2 C;  5B40 A;  3X1S B;  3W98 C;  3W97 B;  4KUD A;  4E45 A;  5B33 D;  5AV6 C;  3REL A;  5DNN C;  3KUY D;  3AZI B;  1F66 A;  3W99 B;  5DNM D;  4WU8 D;  3UTA C;  2NQB D;  3AZL B;  2BYM A;  4EO5 C;  3WA9 C;  3AZL A;  3MVD A;  3H0L C;  5DNN B;  5B2I C;  4AWL B;  3MGS A;  5B31 B;  3W97 C;  3LEL D;  5F99 C;  3W97 A;  2F8N B;  1P3B B;  5BT1 D;  3B0B A;  5E5A D;  4J8V A;  5BO0 B;  4WU9 B;  3B6G B;  4J8W C;  1Z2C B;  3VH6 W;  1M18 D;  2NQB C;  3A6N A;  2Y2Q A;  2HIO B;  2YFW B;  3AL0 C;  5DNM B;  3C1B A;  3MVD B;  2RIQ A;  3MGQ A;  1F66 C;  1HQ3 B;  5GT0 C;  3UTB C;  3VH5 W;  3W97 D;  5B31 G;  1P3A B;  3AV2 A;  5AVC B;  5BT1 C;  4LD9 A;  1AOI C;  4WV4 B;  3X1V C;  2JCH A;  4NFT A;  1P3K C;  5AV9 C;  2YFW A;  2J8P A;  1EQZ D;  1HQ3 D;  4H9N A;  3KUY A;  1P3I C;  5AVB B;  3UTB D;  4H9N B;  3AZM C;  3MGR A;  3C1B D;  2PYO A;  1P34 B;  5B1L A;  5CP6 A;  2NZD C;  1P3M C;  1AOI D;  4DRA A;  1M18 A;  4CSR A;  3X1V D;  3WTP E;  3LJA B;  3NQJ B;  3AZF D;  2ARO C;  1HQ3 C;  1KX5 A;  2FFF B;  5B32 D;  3X1T A;  4JJN A;  2Y2O A;  5CPJ B;  3REL B;  3F6T A;  3EPL A;  1KX3 A;  5GSU D;  4KGC B;  1ZLA B;  3A1I A;  3X1S C;  1KX3 B;  3AZG A;  2G5H C;  5CPI A;  4CSR B;  4R8P D;  5G49 B;  3REL D;  3WAA D;  3WTP D;  4ZUX B;  4KUD D;  3C1C B;  5G49 A;  5AV5 A;  4E44 A;  2VQR A;  3AN2 C;  4J8U C;  5B2J A;  3C1C A;  3B6F C;  5B31 A;  4ZUX C;  1BH9 A;  3H0R C;  5B2J B;  3UTA B;  1P3M B;  3AZK C;  3WTP A;  3W96 B;  4J8X A;  2UWX A;  4HGA B;  3AZJ C;  2F8N G;  1P3O C;  5CPI B;  3W98 B;  3AZN D;  3MGQ B;  3KWQ C;  4J8U D;  3LZ0 A;  3R45 B;  3AZF A;  4H9S A;  3B0D B;  4WNN B;  4HGA C;  1P3O D;  5BS7 C;  3AYW D;  4G91 C;  4J8V B;  1P3A D;  4YM6 D;  5GT3 D;  3O62 C;  3A6N B;  5C3I C;  2PYO D;  3KWQ D;  5AVB A;  4R8P B;  5CHL B;  3REH D;  3KXB A;  3B6G C;  1EQZ A;  5B0Y C;  2HIO D;  5B33 C;  5GXQ D;  3KXB B;  1M18 B;  3REK A;  4H9O A;  1ULY A;  3AV1 B;  3WKJ B;  4H9Q B;  5AVC A;  3AYW C;  3B0C W;  4G92 B;  1P3A C;  4ZBJ B;  3AV2 D;  4Z66 C;  5AV8 B;  4YS3 D;  5B1M A;  5DNN D;  1ID3 C;  2XD1 A;  3X1T B;  1P3L A;  1KX4 A;  5DNM C;  2HUE B;  3LEL C;  2HIO C;  1P3L B;  4ZBJ C;  1ZLA A;  1P34 A;  3MNN D;  3TU4 C;  4H9O B;  3WKJ A;  5AVB D;  3UTB B;  5E5A A;  3EPJ A;  5B2I D;  3MNN A;  3AFA C;  3VH6 A;  1M1A C;  4Z5T A;  2FJ7 C;  4XZQ A;  1P3F C;  1P3F A;  1BH9 B;  2F8N H;  1BH8 A;  4QLC B;  2Y2G A;  3W96 A;  1P3G B;  1P3B C;  4J8X B;  1PZR A;  3AZJ B;  4YS3 A;  3REJ C;  1BH8 B;  4QLC A;  1P3G A;  3MNN C;  2CV5 B;  1H3O B;  5B2I B;  4AWL C;  1WWI A;  3UT9 C;  4UUZ A;  1TAF A;  4J8U B;  3AZN A;  3MNN B;  2FJ7 D;  1BFM A;  3LZ0 B;  5DNM A;  1P3I D;  5B0Z B;  5CPK D;  5B1M C;  2JE5 A;  3REJ D;  4WNN A;  1P3P C;  1P3M D;  2JSS A;  5AV8 D;  1P3A A;  2CV5 A;  5CPJ C;  5JA4 A;  4XUJ A;  3V9R B;  4X23 C;  3AZM D;  1A7W A;  3WAA A;  2F8N A;  4H9R A;  3AV1 D;  5B0Y A;  4R8P A;  3B6G A;  3AZG D;  2NZD D;  4WU8 B;  3VH5 T;  5GSU A;  1S32 A;  5FUG B;  1W2E A;  1JFI B;  4KGC D;  4G91 B;  5GSU B;  3REK B;  3AV1 A;  3REI A;  2IO5 B;  2ARO D;  3KSY A;  3X1U A;  5CPJ D;  4XUJ D;  4YM6 B;  5GT3 B;  4DQY B;  1M19 B;  4X23 D;  1KX5 D;  3AZM B;  1N1J A;  5B32 B;  3REI C;  3MGP A;  5B0Y B;  5GSU C;  1TZY C;  3LJA D;  2F2A C;  3AZH D;  5CPK A;  3EPK A;  1AOI B;  3MGP C;  3WAA C;  5CPK B;  5CPI D;  2CV5 C;  3B6F D;  2Y2I A;  4J8X C;  4CAY B;  3B0D C;  2RVQ D;  1S32 C;  3W96 D;  1B6W A;  1P3F B;  3C1C C;  4JJN D;  3AZJ D;  1U35 B;  3AN2 A;  4XZQ D;  4NE3 A;  4Z5T D;  3KFU G;  1WWS A;  3UT9 A;  3WTP B;  4NE6 A;  5CPI C;  5CPJ A;  1KU5 A;  5B24 D;  2BYK A;  5GT3 C;  4YM6 C;  3O62 D;  3AZE D;  5KDM A;  2BG1 A;  1ZLA D;  2HUE C;  2Y2L A;  1P3P A;  1S32 D;  2F8N K;  3AZG B;  5B0Z C;  1F66 B;  2YFV A;  3MGR D;  1ID3 B;  1P3L D;  4WU9 D;  2DQN C;  3NQU B;  2CWE A;  3B6G D;  4WU8 C;  2XD5 A;  1U35 A;  4XZQ C;  4KHA A;  3NQU A;  2F8N D;  1M1A A;  3AFA A;  3R45 A;  4J8W B;  4KHA B;  4H9P B;  5E5A C;  5JRG A;  5JRG C;  4J8W D;  1M18 C;  3AV2 B;  1P34 C;  3REJ B;  1P3M A;  1ZLA C;  4QLC C;  1P3G C;  4YS3 C;  1TAF B;  2HIO A;  5F99 D;  1P3B A;  1P3P B;  4WU8 A;  1U35 C;  5GXQ B;  3KXB D;  1KX4 C;  3C1B B;  2YFV B;  1S32 B;  1ID3 A;  5B0Z A;  2Y2J A;  3W99 D;  3KUY B;  3AZI D;  2ZY2 A;  2FJ7 A;  3AZE B;  3IP4 C;  4Z66 D;  5GT3 A;  4YM6 A;  2Y2H A;  3MGS B;  3A6N D;  5AVC C;  3AYW A;  2PYO B;  2ZY4 A;  3TU4 A;  3A1K A;  4J8V D;  5GT0 D;  3AYW B;  1M1A D;  4QLC D;  5B32 G;  5AV9 D;  1P3G D;  5GT0 B;  1EQZ C;  3LEL A;  4LD9 B;  1P3F D;  3MGS D;  3TU4 D;  5AVB C; 
#chains in the Genus database with same CATH homology
 4Z66 B;  3MVD D;  3O62 A;  4Z66 A;  4Z2M H;  3A6N C;  5BS7 A;  2W8S A;  3UT9 D;  2LY8 A;  3REK C;  1N1J B;  4H9S C;  5F99 A;  5B33 A;  1P3B D;  3MGP B;  3MGS C;  5CPK C;  3LEL B;  5B40 D;  5B31 D;  5B2J D;  1TZY A;  5C3I B;  5AV5 B;  3MVD C;  1TZY B;  2ZY5 A;  1Q9C A;  3UTA A;  1F1E A;  2BYK B;  4NE5 A;  2Y2P A;  3X1U C;  5AV6 A;  2DF4 C;  3REL C;  3WTP C;  3AV1 C;  1KX3 D;  3REH B;  2IO5 C;  4KUD C;  5B33 B;  4ZUX A;  5B40 C;  5B2J C;  3KWQ B;  3LZ0 C;  3X1S D;  5AV5 C;  4Z5T B;  2Y2M A;  3KWQ A;  4R8P C;  3H0M C;  3AZK D;  4UPK A;  1P3O B;  2L5A A;  3LZ1 D;  4XUJ C;  4EO5 B;  4X23 A;  4JJN B;  3AZF B;  3WA9 B;  1P3O A;  3AN2 D;  3P5J B;  3X1S A;  5B40 B;  3REI D;  5BO0 A;  5JA4 B;  5CP6 D;  5AV6 B;  3AZK A;  4KGC C;  3B6F B;  3B0C T;  5KDM B;  1P3I B;  3LZ0 D;  5AY8 C;  4UUZ B;  4J8U A;  3AZN B;  2FJ7 B;  1HQ3 A;  3EPH A;  5FUG A;  5AV6 D;  1JFI A;  1EQZ B;  4Z2M G;  3AZN C;  3TU4 B;  3REI B;  2CV5 D;  1R4V A;  3UTA D;  3AZH C;  4LD9 D;  1M19 C;  3WA9 D;  4J8X D;  5CP6 C;  5BNX B;  3REJ A;  2PYO C;  3VH5 A;  3W96 C;  3AZK B;  3C1C D;  4JJN C;  3X1T C;  1P3I A;  2ARO B;  3WAA B;  2G5I C;  4Z5T C;  5GXQ C;  1P3K A;  1KX4 B;  4G92 C;  1P3K B;  4WJ3 C;  3WKJ C;  4LD9 C;  5F99 B;  2NZD A;  5E5A B;  3X1T D;  2ZY3 A;  3MGR C;  3AZM A;  5GT0 A;  1P3L C;  5B32 A;  5B1M B;  3FDD A;  5AV8 A;  3AZE C;  3X1V A;  3WKJ D;  2NQB A;  5B0Z D;  1P34 D;  3MGR B;  1ID3 D;  1F66 D;  4WU9 C;  2NQB B;  1H3O A;  1P3K D;  4H9Q A;  3AZI A;  4WZS B;  3KXB C;  5B24 B;  1KX4 D;  3W99 A;  3UTB A;  5JRG D;  3MGQ C;  3C1B C;  4DRB A;  3AFA D;  4XZQ B;  3WA9 A;  5AVC D;  3AFA B;  1U35 D;  4J8W A;  4J8V C;  5JRG B;  3W99 C;  3AZI C;  3AZF C;  3W98 A;  4WU9 A;  3REH A;  5B2I A;  5B24 A;  2Y2K A;  3MGQ D;  3VH6 T;  1P3P D;  3AZL C;  5AV8 C;  3AZE A;  5B32 C;  3AZJ A;  3X1U B;  4YS3 B;  5B1M D;  5DNN A;  3EG5 B;  3V9R A;  5BNV A;  5B31 C;  5BNV B;  3B6F A;  4XUJ B;  4ZUX D;  3AZL D;  4H9R B;  3REK D;  5GXQ A;  3O62 B;  1HTA A;  3AZG C;  1B67 A;  2NZD B;  5B1L B;  1KX3 C;  5BNX A;  1TZY D;  1M19 A;  3AZH A;  3LJA A;  5AV5 D;  1KX5 C;  4M6B A;  2Y2N A;  3X1U D;  2ARO A;  3MGP D;  3LZ1 A;  3LZ1 C;  3X1V B;  5AY8 B;  3LJA C;  3UT9 B;  5AY8 A;  5B1L C;  3W98 D;  4KGC A;  4CAY A;  5AY8 D;  5CP6 B;  3AZH B;  2ZM5 A;  3KUY C;  2BYM B;  3AN2 B;  5B0Y D;  5AV9 A;  1T3U A;  3LZ1 B;  3NQJ A;  2RVQ C;  5AV9 B;  1M1A B;  1AOI A;  4X23 B;  5B24 C;  1M19 D;  1KX5 B;  3REH C;  4KUD B;  4H9P A;  5B1L D;  3AV2 C;  5B40 A;  3X1S B;  3W98 C;  3W97 B;  4KUD A;  4E45 A;  5B33 D;  5AV6 C;  3REL A;  5DNN C;  3KUY D;  3AZI B;  1F66 A;  3W99 B;  5DNM D;  4WU8 D;  3UTA C;  2NQB D;  3AZL B;  2BYM A;  4EO5 C;  3WA9 C;  3AZL A;  3MVD A;  3H0L C;  5DNN B;  5B2I C;  4AWL B;  3MGS A;  5B31 B;  3W97 C;  3LEL D;  5F99 C;  3W97 A;  2F8N B;  1P3B B;  5BT1 D;  3B0B A;  5E5A D;  4J8V A;  5BO0 B;  4WU9 B;  3B6G B;  4J8W C;  1Z2C B;  3VH6 W;  1M18 D;  2NQB C;  3A6N A;  2Y2Q A;  2HIO B;  2YFW B;  3AL0 C;  5DNM B;  3C1B A;  3MVD B;  2RIQ A;  3MGQ A;  1F66 C;  1HQ3 B;  5GT0 C;  3UTB C;  3VH5 W;  3W97 D;  5B31 G;  1P3A B;  3AV2 A;  5AVC B;  5BT1 C;  4LD9 A;  1AOI C;  4WV4 B;  3X1V C;  2JCH A;  4NFT A;  1P3K C;  5AV9 C;  2YFW A;  2J8P A;  1EQZ D;  1HQ3 D;  4H9N A;  3KUY A;  1P3I C;  5AVB B;  3UTB D;  4H9N B;  3AZM C;  3MGR A;  3C1B D;  2PYO A;  1P34 B;  5B1L A;  5CP6 A;  2NZD C;  1P3M C;  1AOI D;  4DRA A;  1M18 A;  4CSR A;  3X1V D;  3WTP E;  3LJA B;  3NQJ B;  3AZF D;  2ARO C;  1HQ3 C;  1KX5 A;  2FFF B;  5B32 D;  3X1T A;  4JJN A;  2Y2O A;  5CPJ B;  3REL B;  3F6T A;  3EPL A;  1KX3 A;  5GSU D;  4KGC B;  1ZLA B;  3A1I A;  3X1S C;  1KX3 B;  3AZG A;  2G5H C;  5CPI A;  4CSR B;  4R8P D;  5G49 B;  3REL D;  3WAA D;  3WTP D;  4ZUX B;  4KUD D;  3C1C B;  5G49 A;  5AV5 A;  4E44 A;  2VQR A;  3AN2 C;  4J8U C;  5B2J A;  3C1C A;  3B6F C;  5B31 A;  4ZUX C;  1BH9 A;  3H0R C;  5B2J B;  3UTA B;  1P3M B;  3AZK C;  3WTP A;  3W96 B;  4J8X A;  2UWX A;  4HGA B;  3AZJ C;  2F8N G;  1P3O C;  5CPI B;  3W98 B;  3AZN D;  3MGQ B;  3KWQ C;  4J8U D;  3LZ0 A;  3R45 B;  3AZF A;  4H9S A;  3B0D B;  4WNN B;  4HGA C;  1P3O D;  5BS7 C;  3AYW D;  4G91 C;  4J8V B;  1P3A D;  4YM6 D;  5GT3 D;  3O62 C;  3A6N B;  5C3I C;  2PYO D;  3KWQ D;  5AVB A;  4R8P B;  5CHL B;  3REH D;  3KXB A;  3B6G C;  1EQZ A;  5B0Y C;  2HIO D;  5B33 C;  5GXQ D;  3KXB B;  1M18 B;  3REK A;  4H9O A;  1ULY A;  3AV1 B;  3WKJ B;  4H9Q B;  5AVC A;  3AYW C;  3B0C W;  4G92 B;  1P3A C;  4ZBJ B;  3AV2 D;  4Z66 C;  5AV8 B;  4YS3 D;  5B1M A;  5DNN D;  1ID3 C;  2XD1 A;  3X1T B;  1P3L A;  1KX4 A;  5DNM C;  2HUE B;  3LEL C;  2HIO C;  1P3L B;  4ZBJ C;  1ZLA A;  1P34 A;  3MNN D;  3TU4 C;  4H9O B;  3WKJ A;  5AVB D;  3UTB B;  5E5A A;  3EPJ A;  5B2I D;  3MNN A;  3AFA C;  3VH6 A;  1M1A C;  4Z5T A;  2FJ7 C;  4XZQ A;  1P3F C;  1P3F A;  1BH9 B;  2F8N H;  1BH8 A;  4QLC B;  2Y2G A;  3W96 A;  1P3G B;  1P3B C;  4J8X B;  1PZR A;  3AZJ B;  4YS3 A;  3REJ C;  1BH8 B;  4QLC A;  1P3G A;  3MNN C;  2CV5 B;  1H3O B;  5B2I B;  4AWL C;  1WWI A;  3UT9 C;  4UUZ A;  1TAF A;  4J8U B;  3AZN A;  3MNN B;  2FJ7 D;  1BFM A;  3LZ0 B;  5DNM A;  1P3I D;  5B0Z B;  5CPK D;  5B1M C;  2JE5 A;  3REJ D;  4WNN A;  1P3P C;  1P3M D;  2JSS A;  5AV8 D;  1P3A A;  2CV5 A;  5CPJ C;  5JA4 A;  4XUJ A;  3V9R B;  4X23 C;  3AZM D;  1A7W A;  3WAA A;  2F8N A;  4H9R A;  3AV1 D;  5B0Y A;  4R8P A;  3B6G A;  3AZG D;  2NZD D;  4WU8 B;  3VH5 T;  5GSU A;  1S32 A;  5FUG B;  1W2E A;  1JFI B;  4KGC D;  4G91 B;  5GSU B;  3REK B;  3AV1 A;  3REI A;  2IO5 B;  2ARO D;  3KSY A;  3X1U A;  5CPJ D;  4XUJ D;  4YM6 B;  5GT3 B;  4DQY B;  1M19 B;  4X23 D;  1KX5 D;  3AZM B;  1N1J A;  5B32 B;  3REI C;  3MGP A;  5B0Y B;  5GSU C;  1TZY C;  3LJA D;  2F2A C;  3AZH D;  5CPK A;  3EPK A;  1AOI B;  3MGP C;  3WAA C;  5CPK B;  5CPI D;  2CV5 C;  3B6F D;  2Y2I A;  4J8X C;  4CAY B;  3B0D C;  2RVQ D;  1S32 C;  3W96 D;  1B6W A;  1P3F B;  3C1C C;  4JJN D;  3AZJ D;  1U35 B;  3AN2 A;  4XZQ D;  4NE3 A;  4Z5T D;  3KFU G;  1WWS A;  3UT9 A;  3WTP B;  4NE6 A;  5CPI C;  5CPJ A;  1KU5 A;  5B24 D;  2BYK A;  5GT3 C;  4YM6 C;  3O62 D;  3AZE D;  5KDM A;  2BG1 A;  1ZLA D;  2HUE C;  2Y2L A;  1P3P A;  1S32 D;  2F8N K;  3AZG B;  5B0Z C;  1F66 B;  2YFV A;  3MGR D;  1ID3 B;  1P3L D;  4WU9 D;  2DQN C;  3NQU B;  2CWE A;  3B6G D;  4WU8 C;  2XD5 A;  1U35 A;  4XZQ C;  4KHA A;  3NQU A;  2F8N D;  1M1A A;  3AFA A;  3R45 A;  4J8W B;  4KHA B;  4H9P B;  5E5A C;  5JRG A;  5JRG C;  4J8W D;  1M18 C;  3AV2 B;  1P34 C;  3REJ B;  1P3M A;  1ZLA C;  4QLC C;  1P3G C;  4YS3 C;  1TAF B;  2HIO A;  5F99 D;  1P3B A;  1P3P B;  4WU8 A;  1U35 C;  5GXQ B;  3KXB D;  1KX4 C;  3C1B B;  2YFV B;  1S32 B;  1ID3 A;  5B0Z A;  2Y2J A;  3W99 D;  3KUY B;  3AZI D;  2ZY2 A;  2FJ7 A;  3AZE B;  3IP4 C;  4Z66 D;  5GT3 A;  4YM6 A;  2Y2H A;  3MGS B;  3A6N D;  5AVC C;  3AYW A;  2PYO B;  2ZY4 A;  3TU4 A;  3A1K A;  4J8V D;  5GT0 D;  3AYW B;  1M1A D;  4QLC D;  5B32 G;  5AV9 D;  1P3G D;  5GT0 B;  1EQZ C;  3LEL A;  4LD9 B;  1P3F D;  3MGS D;  3TU4 D;  5AVB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...