5B1LA

The mouse nucleosome structure containing h3t
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lA00
1P3AB 3MGPA 1ID3D 5B2JB 4WNNA 5AY8B 5B33D 3MVDA 3AZND 1P3LD 4R8PD 4NFTA 5AVBC 3AV2C 2IO5B 2YFWB 3AZMD 1KX3C 1ULYA 3W97B 4J8UB 4Z2MG 3MNNA 5BO0B 2NQBA 3X1SA 1B6WA 4XZQD 1KX3D 2AROB 1F1EA 3AZIC 3AFAA 5B2IC 3C1CD 5JA4B 4H9OB 3LZ1A 3UTBC 3B0DB 2F8NB 5B2ID 3AYWA 3R45A 1B67A 3B6GB 5B0ZA 3AZFA 5JRGA 4DRAA 5B0YC 3AZLB 3KWQB 1KX5B 3X1UA 5GT3A 3REKB 1M19D 3X1TA 5AV5D 3WAAA 5GSUB 4H9NB 5AV8B 4J8VA 3V9RA 4QLCD 5B31C 1P3GA 2BYMA 4WU9C 1P3MC 5CPID 3UT9B 1HQ3A 4NE3A 1ZLAC 4J8WB 4WU9D 3AZKA 1P3MD 5CPJC 2BYKA 3UTAA 5DNMC 3W96A 1P3OB 4ZUXA 1ZLAD 5GT0C 3RELC 3AZNB 5B33B 1P3LB 4AWLC 1P3AC 5CPJD 4H9PA 4R8PB 3LELC 5DNMD 2YFVA 4YS3A 1BH9B 5B2JC 2FJ7C 5B40B 5AVCB 5AY8C 5GT0D 3RELD 3AZMB 3B6FA 4KUDA 1AOIA 3LELD 4JJNA 5B2JD 1P3KA 2FJ7D 3TU4D 3MGQA 4XZQB 5AV9C 4J8UC 1P3FC 2NZDA 3W98A 4CAYA 3C1CB 1TZYD 3X1VA 1P34A 4KHAA 2AROC 5AV9D 5BNVB 1P3FD 3AV1A 3AZGB 5E5AA 3KXBA 3AZHA 5B2IB 1P3BA 3MGRA 1U35A 4WZSB 3C1BA 5G49B 3B0DC 5DNNA 3B6GC 5AV6D 3AZLC 2F8ND 3LZ0D 3KWQC 1M19B 1KX5C 3WA9C 5AV5B 5CP6C 4XUJB 4WU8B 3REKC 3A6NA 4QLCB 3KWQD 4NE5A 3WA9D 5B1MA 5GSUC 5CP6D 5AV8C 5CPIB 5BNXA 4M6BA 1S32A 1P3PA 4H9QA 5GSUD 3MGPC 2HIOA 5B32D 4WU9B 2CV5B 5B32G 5CHLB 1TAFB 3MGPD 1P3IA 5B1LA 2LY8A 3O62A 3W99B 4G91B 1P3OC 5GT0B 3AZNC 5B33C 3NQJA 1P3LC 5GXQA 4R8PC 3LELB 5B24A 1P3OD 3LJAA 5B40C 5AVCC 2FJ7B 3WTPA 3TU4B 3AZMC 5CPKA 4KGCA 3X1SD 4H9SC 3KUYA 1JFIA 2PYOA 5F99A 1TZYB 5B40D 5AVCD 3WKJB 4XZQC 3AFAD 3REIB 5BS7A 5AV9B 1P3FB 3C1CC 3AZEA 5B0ZC 3MGSA 3LZ1D 4J8XB 5FUGA 1M1AA 1N1JA 3AZGC 3AZJA 5B0ZD 4Z5TA 1EQZB 5JRGD 5GT3C 3X1TC 5AV6B 4YM6B 4HGAB 4Z66C 3AZGD 1KX4B 4X23A 3LZ0B 5GT3D 3AN2B 3REJB 4ZBJB 3X1TD 4Z66D 1ID3A 1M19C 1F66A 1WWSA 5AV5C 3WA9B 4XUJC 5CP6B 3VH5A 4WU8C 4QLCC 3AZKC 1M18A 4XUJD 4WU8D 5B32B 3AV2A 5CPIC 5KDMB 5AVBA 4LD9B 3AZKD 1KX3A 4UUZA 3MGPB 3UTAD 3VH6A 2CV5C 5BT1C 4WNNB 3MVDB 1AOIC 3AZIA 1H3OA 2CV5D 5BT1D 4CSRA 1HTAA 3MGQC 3W99C 3B6FD 4G91C 1BH8A 1AOID 3UTBA 3MNNB 4JJND 2NQBB 3X1SB 1P34C 3MGQD 3W99D 3B0CW 3TU4C 5B0YA 2NZDD 3AFAB 3AZHC 3W98D 1P3BC 3MGRC 1P34D 2F8NK 3NQUA 1TZYC 4WV4B 3LZ1B 3WKJC 3REIC 5E5AD 3AZHD 1P3BD 3MGRD 3AYWB 4DRBA 3R45B 5B0ZB 5C3IC 3AZFB 5JRGB 3WKJD 4J8XC 3REID 5B31A 1EQZC 3KSYA 3VH5W 3X1UB 5GT3B 1P3MA 4J8XD 3X1TB 5AV6C 4YM6C 4HGAC 1KX4C 4Z66B 3WAAB 1ZLAA 1EQZD 3LZ0C 3AN2C 4H9RA 4J8VB 3V9RB 3REJC 5CPJA 4ZBJC 3B0CT 4YM6D 1S32C 2HUEB 5DNMA 1P3PC 1KX4D 1P3GB 3RELA 3AN2D 2BYMB 3REHA 2F8NH 3REJD 1P3AA 1HQ3B 1S32D 1P3PD 5B2JA 5AY8A 2HIOD 3AZKB 5B1LC 2BYKB 5B32C 3UTAB 3W96B 4ZUXB 2YFWA 4LD9C 5GXQC 3W97A 5B1LD 4J8UA 3O62D 3VH5T 3WTPE 2YFVB 5BO0A 4YS3B 1A7WA 4LD9D 3B6FB 3MVDC 4KUDB 2AROA 5GXQD 1AOIB 4KGCC 3KUYC 1R4VA 4JJNB 1P3KB 5JA4A 3WTPD 3MGQB 3MVDD 5CPKD 4KGCD 4H9OA 3KUYD 3VH6T 2NZDB 3MNNC 2F8NA 3W98B 2NQBC 4CAYB 3X1SC 3MGSC 2L5AA 3X1VB 1P34B 4KHAB 3B6GA 3AZLA 3AV1B 3AFAC 3MNND 5E5AB 3KXBB 3AZHB 3AZED 1P3BB 3KWQA 3MGSD 3MGRB 1U35B 1KX5A 2NQBD 3C1BB 3LZ1C 3REKA 4Z5TD 5DNNB 3AYWC 4Z2MH 4H9NA 5GSUA 1Q9CA 5C3IB 5JRGC 5AV8A 3AZFC 3AYWD 1F66C 3X1UC 3AZFD 3UT9A 3A6NB 1F66D 3WAAC 5B1MB 1M18C 4J8WA 3X1UD 4J8VC 5BNXB 1P3PB 1S32B 2HUEC 4H9QB 1P3OA 3WAAD 1P3GC 1M18D 2HIOB 5B33A 4J8VD 3AZNA 3AV2D 5AVBD 1P3LA 4R8PA 1HQ3C 1BH9A 1P3GD 5B40A 5AVCA 3AZMA 1P3IB 5B1LB 1HQ3D 4H9SA 3O62B 3UTAC 3W96C 4ZUXC 4EO5B 3AZID 3NQJB 4XZQA 5GXQB 5B24B 4YS3C 3C1CA 3W96D 4ZUXD 3LJAB 3WTPB 3UTBD 3B6FC 4KUDC 5CPKB 4G92B 5BNVA 4KGCB 3KUYB 3AZGA 1JFIB 2PYOB 5F99B 5B2IA 4YS3D 4JJNC 1P3KC 5B0YD 4KUDD 5G49A 4Z66A 2NZDC 3W98C 3AZEB 1P3KD 3MGSB 3X1VC 4E44A 5FUGB 1KU5A 1M1AB 1N1JB 3AV1C 5E5AC 3KXBC 3AZJB 1M19A 4Z5TB 1U35C 3X1VD 5AV5A 3C1BC 4XUJA 4WU8A 5B31D 3AV1D 3KXBD 5B31G 4QLCA 4X23B 5DNNC 1U35D 3B0BA 1BFMA 3C1BD 5CPIA 1ID3B 5DNND 1F66B 3REHC 4WU9A 2CV5A 3A6NC 3REHD 1TAFA 4E45A 1P3AD 5B1MC 1M18B 3AV2B 5AVBB 3A6ND 2IO5C 5AY8D 3W99A 1KX3B 3W97C 5B1MD 4UUZB 5GT0A 2HIOC 3VH6W 3LELA 1WWIA 3W97D 4J8UD 2FJ7A 3TU4A 3AZIB 1H3OB 1P3IC 2JSSA 4CSRB 3O62C 2AROD 1BH8B 1TZYA 4EO5C 3UTBB 3WKJA 3REIA 1P3ID 5AV9A 4H9PB 1P3FA 5B24C 2RVQC 3LJAC 3WTPC 5B0YB 4J8XA 5CPKC 4G92C 2F8NG 5B24D 2RVQD 4NE6A 5F99C 2PYOC 3B6GD 3NQUB 3LJAD 1EQZA 3AZLD 5BS7C 5AV6A 4YM6A 1KX4A 1KX5D 2PYOD 5F99D 3AZEC 3LZ0A 3AN2A 3REJA 3REKD 1M1AC 5B31B 3AZJC 4Z5TC 5AV8D 1P3MB 3WA9A 3UT9C 1M1AD 5CP6A 1ZLAB 3AZJD 4X23C 4J8WC 4H9RB 2CWEA 3UT9D 5CPJB 5B32A 5KDMA 5DNMB 1ID3C 4X23D 4J8WD 3RELB 4LD9A 3REHB 4AWLB
chains in the Genus database with same CATH superfamily
1P3AB 3MGPA 2Y2OA 1ID3D 5B2JB 4WNNA 5AY8B 5B33D 3MVDA 3AZND 1P3LD 4R8PD 4NFTA 5AVBC 3AV2C 4WJ3C 2IO5B 2YFWB 3AZMD 1KX3C 1ULYA 3W97B 4J8UB 4Z2MG 3MNNA 5BO0B 2NQBA 3X1SA 1B6WA 4XZQD 1KX3D 2AROB 1F1EA 3H0RC 3AZIC 3AFAA 5B2IC 3C1CD 5JA4B 4H9OB 3LZ1A 3UTBC 3B0DB 2F8NB 5B2ID 3AYWA 3R45A 1B67A 3B6GB 5B0ZA 3AZFA 5JRGA 4DRAA 5B0YC 3AZLB 3KWQB 1KX5B 3X1UA 5GT3A 3REKB 2Y2HA 1M19D 3X1TA 5AV5D 3WAAA 5GSUB 4H9NB 5AV8B 4J8VA 3V9RA 4QLCD 5B31C 1P3GA 2BYMA 4WU9C 1P3MC 5CPID 3UT9B 1HQ3A 2Y2KA 4NE3A 1ZLAC 4J8WB 4WU9D 3AZKA 1P3MD 4DQYB 5CPJC 2BYKA 3UTAA 5DNMC 3W96A 1P3OB 4ZUXA 1ZLAD 5GT0C 3RELC 3AZNB 5B33B 1P3LB 4AWLC 1P3AC 5CPJD 4H9PA 4R8PB 3LELC 2ZY3A 5DNMD 2YFVA 4YS3A 1BH9B 5B2JC 2FJ7C 5B40B 5AVCB 5AY8C 5GT0D 3RELD 3AZMB 3B6FA 4KUDA 1AOIA 3LELD 4JJNA 5B2JD 1P3KA 2FJ7D 3TU4D 3MGQA 4XZQB 5AV9C 4J8UC 1P3FC 2NZDA 3W98A 4CAYA 3C1CB 1TZYD 3X1VA 1P34A 4KHAA 2AROC 5AV9D 5BNVB 1P3FD 3AV1A 3AZGB 5E5AA 3KXBA 3AZHA 5B2IB 1P3BA 3MGRA 1U35A 4WZSB 3C1BA 3EG5B 5G49B 3B0DC 5DNNA 3B6GC 3P5JB 5AV6D 3AZLC 3H0MC 2F8ND 3LZ0D 3KWQC 1M19B 1KX5C 3WA9C 5AV5B 3FDDA 5CP6C 4XUJB 4WU8B 3REKC 3A6NA 4QLCB 3KWQD 4NE5A 2F2AC 3WA9D 5B1MA 5GSUC 5CP6D 5AV8C 5CPIB 5BNXA 4M6BA 2JCHA 1S32A 4H9QA 1P3PA 5GSUD 3MGPC 2HIOA 5B32D 4WU9B 2CV5B 5B32G 5CHLB 1TAFB 3MGPD 1P3IA 5B1LA 2LY8A 3O62A 3W99B 4G91B 1P3OC 5GT0B 3AZNC 5B33C 3NQJA 1PZRA 1P3LC 5GXQA 4R8PC 3LELB 2W8SA 5B24A 1P3OD 3LJAA 5B40C 5AVCC 2FJ7B 3WTPA 3TU4B 3AZMC 5CPKA 4KGCA 3X1SD 4H9SC 3KUYA 1JFIA 2PYOA 5F99A 1TZYB 5B40D 5AVCD 3WKJB 4XZQC 3AFAD 3REIB 5BS7A 5AV9B 1P3FB 3C1CC 3AZEA 5B0ZC 3MGSA 3LZ1D 4J8XB 3EPKA 5FUGA 1M1AA 1N1JA 3AZGC 3AZJA 5B0ZD 4Z5TA 1EQZB 5JRGD 5GT3C 1Z2CB 3X1TC 5AV6B 4YM6B 4HGAB 3F6TA 4Z66C 3AZGD 1KX4B 4X23A 3LZ0B 5GT3D 3AN2B 3REJB 4ZBJB 3X1TD 4Z66D 1ID3A 2XD1A 1M19C 1F66A 1WWSA 2UWXA 5AV5C 3WA9B 4XUJC 5CP6B 3VH5A 4WU8C 4QLCC 3AZKC 1M18A 4XUJD 4WU8D 5B32B 3AV2A 5CPIC 5KDMB 5AVBA 4LD9B 3AZKD 1KX3A 4UUZA 3MGPB 3UTAD 3VH6A 2CV5C 5BT1C 3EPHA 4WNNB 3MVDB 1AOIC 2DF4C 3AZIA 2BG1A 1H3OA 2CV5D 5BT1D 4CSRA 1HTAA 3MGQC 3W99C 3B6FD 4G91C 1BH8A 1AOID 3UTBA 2Y2MA 3MNNB 4JJND 2NQBB 3X1SB 1P34C 3MGQD 3W99D 2VQRA 3B0CW 3TU4C 5B0YA 2NZDD 3AFAB 3AZHC 3W98D 1P3BC 3MGRC 1P34D 2F8NK 3NQUA 1TZYC 4WV4B 3LZ1B 3WKJC 3REIC 5E5AD 3AZHD 2Y2PA 1P3BD 3MGRD 3AYWB 4DRBA 3R45B 5B0ZB 5C3IC 3AZFB 5JRGB 3WKJD 4J8XC 3REID 5B31A 1EQZC 3KSYA 3VH5W 3X1UB 5GT3B 1P3MA 4J8XD 3X1TB 5AV6C 4YM6C 4HGAC 1KX4C 4Z66B 3WAAB 1ZLAA 1EQZD 3LZ0C 3AN2C 4H9RA 4J8VB 3V9RB 3REJC 5CPJA 4ZBJC 3B0CT 4YM6D 1S32C 2HUEB 5DNMA 1P3PC 1KX4D 1P3GB 3RELA 3AN2D 2BYMB 3REHA 2F8NH 3REJD 1P3AA 1HQ3B 1S32D 1P3PD 5B2JA 5AY8A 2HIOD 3AZKB 5B1LC 2BYKB 5B32C 3UTAB 2G5IC 3W96B 4ZUXB 1T3UA 2YFWA 4LD9C 5GXQC 3W97A 5B1LD 4J8UA 3O62D 3VH5T 3WTPE 2YFVB 3H0LC 5BO0A 4YS3B 1A7WA 4LD9D 3B6FB 3MVDC 4KUDB 2AROA 5GXQD 1AOIB 4KGCC 3KUYC 1R4VA 4JJNB 1P3KB 5JA4A 3WTPD 3MGQB 3MVDD 5CPKD 4KGCD 4H9OA 3KUYD 3VH6T 2NZDB 3MNNC 2F8NA 3W98B 2NQBC 4CAYB 3X1SC 3MGSC 2L5AA 3X1VB 1P34B 4KHAB 3B6GA 3AZLA 3AV1B 3AFAC 3MNND 5E5AB 3KXBB 3AZHB 3AZED 1P3BB 3KWQA 3MGSD 3MGRB 1U35B 1KX5A 2NQBD 3C1BB 3LZ1C 2JE5A 3REKA 4Z5TD 5DNNB 3AYWC 2ZY5A 4Z2MH 4H9NA 5GSUA 1Q9CA 5C3IB 5JRGC 5AV8A 3AZFC 3AYWD 1F66C 3X1UC 3AZFD 3UT9A 3A6NB 1F66D 3WAAC 5B1MB 1M18C 4J8WA 3X1UD 4J8VC 2XD5A 5BNXB 1P3PB 1S32B 2HUEC 4H9QB 1P3OA 3WAAD 1P3GC 2Y2IA 1M18D 2HIOB 5B33A 4J8VD 3AZNA 3AV2D 5AVBD 1P3LA 4R8PA 1HQ3C 3AL0C 1BH9A 1P3GD 5B40A 5AVCA 2G5HC 3AZMA 1P3IB 5B1LB 1HQ3D 4H9SA 3O62B 3UTAC 2RIQA 3W96C 4ZUXC 4EO5B 3AZID 3NQJB 4XZQA 5GXQB 2ZM5A 5B24B 4YS3C 3C1CA 3W96D 4ZUXD 3LJAB 3WTPB 3UTBD 3B6FC 4KUDC 3A1KA 5CPKB 4G92B 5BNVA 4KGCB 3KUYB 3AZGA 1JFIB 2PYOB 5F99B 5B2IA 4YS3D 4JJNC 1P3KC 5B0YD 4KUDD 5G49A 4Z66A 2NZDC 3W98C 3AZEB 1P3KD 3MGSB 3X1VC 4E44A 5FUGB 1KU5A 1M1AB 1N1JB 3AV1C 5E5AC 3KXBC 3AZJB 1M19A 4Z5TB 1U35C 2Y2LA 3X1VD 5AV5A 3C1BC 4XUJA 4WU8A 5B31D 2ZY4A 3AV1D 3KXBD 5B31G 4QLCA 4X23B 5DNNC 3EPJA 3B0BA 1U35D 1BFMA 3C1BD 5CPIA 1ID3B 3A1IA 5DNND 3EPLA 1F66B 3KFUG 3REHC 2FFFB 4WU9A 2CV5A 3A6NC 4UPKA 2J8PA 3REHD 1TAFA 4E45A 1P3AD 5B1MC 1M18B 2Y2QA 3AV2B 5AVBB 3A6ND 2IO5C 5AY8D 3W99A 1KX3B 3W97C 5B1MD 4UUZB 5GT0A 2HIOC 3VH6W 3LELA 1WWIA 3W97D 4J8UD 2FJ7A 1W2EA 3TU4A 3AZIB 1H3OB 1P3IC 2JSSA 4CSRB 3O62C 2AROD 1BH8B 1TZYA 4EO5C 3UTBB 3WKJA 3REIA 1P3ID 5AV9A 4H9PB 1P3FA 5B24C 2RVQC 3LJAC 3WTPC 5B0YB 4J8XA 5CPKC 4G92C 2F8NG 2Y2JA 5B24D 2RVQD 4NE6A 5F99C 2PYOC 3B6GD 3NQUB 3LJAD 1EQZA 3AZLD 5BS7C 2Y2GA 5AV6A 4YM6A 1KX4A 1KX5D 2PYOD 5F99D 3AZEC 3IP4C 3LZ0A 3AN2A 3REJA 3REKD 2DQNC 1M1AC 5B31B 3AZJC 4Z5TC 5AV8D 1P3MB 3WA9A 3UT9C 2Y2NA 1M1AD 5CP6A 1ZLAB 3AZJD 4X23C 4J8WC 4H9RB 2CWEA 3UT9D 5CPJB 5B32A 5KDMA 5DNMB 1ID3C 4X23D 4J8WD 3RELB 4LD9A 2ZY2A 3REHB 4AWLB
chains in the Genus database with same CATH topology
1P3AB 3MGPA 2Y2OA 1ID3D 5B2JB 4WNNA 5AY8B 5B33D 3MVDA 3AZND 1P3LD 4R8PD 4NFTA 5AVBC 3AV2C 4WJ3C 2IO5B 2YFWB 3AZMD 1KX3C 1ULYA 3W97B 4J8UB 4Z2MG 3MNNA 5BO0B 2NQBA 3X1SA 1B6WA 4XZQD 1KX3D 2AROB 1F1EA 3H0RC 3AZIC 3AFAA 5B2IC 3C1CD 5JA4B 4H9OB 3LZ1A 3UTBC 3B0DB 2F8NB 5B2ID 3AYWA 3R45A 1B67A 3B6GB 5B0ZA 3AZFA 5JRGA 4DRAA 5B0YC 3AZLB 3KWQB 1KX5B 3X1UA 5GT3A 3REKB 2Y2HA 1M19D 3X1TA 5AV5D 3WAAA 5GSUB 4H9NB 5AV8B 4J8VA 3V9RA 4QLCD 5B31C 1P3GA 2BYMA 4WU9C 1P3MC 5CPID 3UT9B 1HQ3A 2Y2KA 4NE3A 1ZLAC 4J8WB 4WU9D 3AZKA 1P3MD 4DQYB 5CPJC 2BYKA 3UTAA 5DNMC 3W96A 1P3OB 4ZUXA 1ZLAD 5GT0C 3RELC 3AZNB 5B33B 1P3LB 4AWLC 1P3AC 5CPJD 4H9PA 4R8PB 3LELC 2ZY3A 5DNMD 2YFVA 4YS3A 1BH9B 5B2JC 2FJ7C 5B40B 5AVCB 5AY8C 5GT0D 3RELD 3AZMB 3B6FA 4KUDA 1AOIA 3LELD 4JJNA 5B2JD 1P3KA 2FJ7D 3TU4D 3MGQA 4XZQB 5AV9C 4J8UC 1P3FC 2NZDA 3W98A 4CAYA 3C1CB 1TZYD 3X1VA 1P34A 4KHAA 2AROC 5AV9D 5BNVB 1P3FD 3AV1A 3AZGB 5E5AA 3KXBA 3AZHA 5B2IB 1P3BA 3MGRA 1U35A 4WZSB 3C1BA 3EG5B 5G49B 3B0DC 5DNNA 3B6GC 3P5JB 5AV6D 3AZLC 3H0MC 2F8ND 3LZ0D 3KWQC 1M19B 1KX5C 3WA9C 5AV5B 3FDDA 5CP6C 4XUJB 4WU8B 3REKC 3A6NA 4QLCB 3KWQD 4NE5A 2F2AC 3WA9D 5B1MA 5GSUC 5CP6D 5AV8C 5CPIB 5BNXA 4M6BA 2JCHA 1S32A 4H9QA 1P3PA 5GSUD 3MGPC 2HIOA 5B32D 4WU9B 2CV5B 5B32G 5CHLB 1TAFB 3MGPD 1P3IA 5B1LA 2LY8A 3O62A 3W99B 4G91B 1P3OC 5GT0B 3AZNC 5B33C 3NQJA 1PZRA 1P3LC 5GXQA 4R8PC 3LELB 2W8SA 5B24A 1P3OD 3LJAA 5B40C 5AVCC 2FJ7B 3WTPA 3TU4B 3AZMC 5CPKA 4KGCA 3X1SD 4H9SC 3KUYA 1JFIA 2PYOA 5F99A 1TZYB 5B40D 5AVCD 3WKJB 4XZQC 3AFAD 3REIB 5BS7A 5AV9B 1P3FB 3C1CC 3AZEA 5B0ZC 3MGSA 3LZ1D 4J8XB 3EPKA 5FUGA 1M1AA 1N1JA 3AZGC 3AZJA 5B0ZD 4Z5TA 1EQZB 5JRGD 5GT3C 1Z2CB 3X1TC 5AV6B 4YM6B 4HGAB 3F6TA 4Z66C 3AZGD 1KX4B 4X23A 3LZ0B 5GT3D 3AN2B 3REJB 4ZBJB 3X1TD 4Z66D 1ID3A 2XD1A 1M19C 1F66A 1WWSA 2UWXA 5AV5C 3WA9B 4XUJC 5CP6B 3VH5A 4WU8C 4QLCC 3AZKC 1M18A 4XUJD 4WU8D 5B32B 3AV2A 5CPIC 5KDMB 5AVBA 4LD9B 3AZKD 1KX3A 4UUZA 3MGPB 3UTAD 3VH6A 2CV5C 5BT1C 3EPHA 4WNNB 3MVDB 1AOIC 2DF4C 3AZIA 2BG1A 1H3OA 2CV5D 5BT1D 4CSRA 1HTAA 3MGQC 3W99C 3B6FD 4G91C 1BH8A 1AOID 3UTBA 2Y2MA 3MNNB 4JJND 2NQBB 3X1SB 1P34C 3MGQD 3W99D 2VQRA 3B0CW 3TU4C 5B0YA 2NZDD 3AFAB 3AZHC 3W98D 1P3BC 3MGRC 1P34D 2F8NK 3NQUA 1TZYC 4WV4B 3LZ1B 3WKJC 3REIC 5E5AD 3AZHD 2Y2PA 1P3BD 3MGRD 3AYWB 4DRBA 3R45B 5B0ZB 5C3IC 3AZFB 5JRGB 3WKJD 4J8XC 3REID 5B31A 1EQZC 3KSYA 3VH5W 3X1UB 5GT3B 1P3MA 4J8XD 3X1TB 5AV6C 4YM6C 4HGAC 1KX4C 4Z66B 3WAAB 1ZLAA 1EQZD 3LZ0C 3AN2C 4H9RA 4J8VB 3V9RB 3REJC 5CPJA 4ZBJC 3B0CT 4YM6D 1S32C 2HUEB 5DNMA 1P3PC 1KX4D 1P3GB 3RELA 3AN2D 2BYMB 3REHA 2F8NH 3REJD 1P3AA 1HQ3B 1S32D 1P3PD 5B2JA 5AY8A 2HIOD 3AZKB 5B1LC 2BYKB 5B32C 3UTAB 2G5IC 3W96B 4ZUXB 1T3UA 2YFWA 4LD9C 5GXQC 3W97A 5B1LD 4J8UA 3O62D 3VH5T 3WTPE 2YFVB 3H0LC 5BO0A 4YS3B 1A7WA 4LD9D 3B6FB 3MVDC 4KUDB 2AROA 5GXQD 1AOIB 4KGCC 3KUYC 1R4VA 4JJNB 1P3KB 5JA4A 3WTPD 3MGQB 3MVDD 5CPKD 4KGCD 4H9OA 3KUYD 3VH6T 2NZDB 3MNNC 2F8NA 3W98B 2NQBC 4CAYB 3X1SC 3MGSC 2L5AA 3X1VB 1P34B 4KHAB 3B6GA 3AZLA 3AV1B 3AFAC 3MNND 5E5AB 3KXBB 3AZHB 3AZED 1P3BB 3KWQA 3MGSD 3MGRB 1U35B 1KX5A 2NQBD 3C1BB 3LZ1C 2JE5A 3REKA 4Z5TD 5DNNB 3AYWC 2ZY5A 4Z2MH 4H9NA 5GSUA 1Q9CA 5C3IB 5JRGC 5AV8A 3AZFC 3AYWD 1F66C 3X1UC 3AZFD 3UT9A 3A6NB 1F66D 3WAAC 5B1MB 1M18C 4J8WA 3X1UD 4J8VC 2XD5A 5BNXB 1P3PB 1S32B 2HUEC 4H9QB 1P3OA 3WAAD 1P3GC 2Y2IA 1M18D 2HIOB 5B33A 4J8VD 3AZNA 3AV2D 5AVBD 1P3LA 4R8PA 1HQ3C 3AL0C 1BH9A 1P3GD 5B40A 5AVCA 2G5HC 3AZMA 1P3IB 5B1LB 1HQ3D 4H9SA 3O62B 3UTAC 2RIQA 3W96C 4ZUXC 4EO5B 3AZID 3NQJB 4XZQA 5GXQB 2ZM5A 5B24B 4YS3C 3C1CA 3W96D 4ZUXD 3LJAB 3WTPB 3UTBD 3B6FC 4KUDC 3A1KA 5CPKB 4G92B 5BNVA 4KGCB 3KUYB 3AZGA 1JFIB 2PYOB 5F99B 5B2IA 4YS3D 4JJNC 1P3KC 5B0YD 4KUDD 5G49A 4Z66A 2NZDC 3W98C 3AZEB 1P3KD 3MGSB 3X1VC 4E44A 5FUGB 1KU5A 1M1AB 1N1JB 3AV1C 5E5AC 3KXBC 3AZJB 1M19A 4Z5TB 1U35C 2Y2LA 3X1VD 5AV5A 3C1BC 4XUJA 4WU8A 5B31D 2ZY4A 3AV1D 3KXBD 5B31G 4QLCA 4X23B 5DNNC 3EPJA 3B0BA 1U35D 1BFMA 3C1BD 5CPIA 1ID3B 3A1IA 5DNND 3EPLA 1F66B 3KFUG 3REHC 2FFFB 4WU9A 2CV5A 3A6NC 4UPKA 2J8PA 3REHD 1TAFA 4E45A 1P3AD 5B1MC 1M18B 2Y2QA 3AV2B 5AVBB 3A6ND 2IO5C 5AY8D 3W99A 1KX3B 3W97C 5B1MD 4UUZB 5GT0A 2HIOC 3VH6W 3LELA 1WWIA 3W97D 4J8UD 2FJ7A 1W2EA 3TU4A 3AZIB 1H3OB 1P3IC 2JSSA 4CSRB 3O62C 2AROD 1BH8B 1TZYA 4EO5C 3UTBB 3WKJA 3REIA 1P3ID 5AV9A 4H9PB 1P3FA 5B24C 2RVQC 3LJAC 3WTPC 5B0YB 4J8XA 5CPKC 4G92C 2F8NG 2Y2JA 5B24D 2RVQD 4NE6A 5F99C 2PYOC 3B6GD 3NQUB 3LJAD 1EQZA 3AZLD 5BS7C 2Y2GA 5AV6A 4YM6A 1KX4A 1KX5D 2PYOD 5F99D 3AZEC 3IP4C 3LZ0A 3AN2A 3REJA 3REKD 2DQNC 1M1AC 5B31B 3AZJC 4Z5TC 5AV8D 1P3MB 3WA9A 3UT9C 2Y2NA 1M1AD 5CP6A 1ZLAB 3AZJD 4X23C 4J8WC 4H9RB 2CWEA 3UT9D 5CPJB 5B32A 5KDMA 5DNMB 1ID3C 4X23D 4J8WD 3RELB 4LD9A 2ZY2A 3REHB 4AWLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A B;  3MGP A;  1ID3 D;  5B2J B;  4WNN A;  5AY8 B;  5B33 D;  3MVD A;  3AZN D;  1P3L D;  4R8P D;  4NFT A;  5AVB C;  3AV2 C;  2IO5 B;  2YFW B;  3AZM D;  1KX3 C;  1ULY A;  3W97 B;  4J8U B;  4Z2M G;  3MNN A;  5BO0 B;  2NQB A;  3X1S A;  1B6W A;  4XZQ D;  1KX3 D;  2ARO B;  1F1E A;  3AZI C;  3AFA A;  5B2I C;  3C1C D;  5JA4 B;  4H9O B;  3LZ1 A;  3UTB C;  3B0D B;  2F8N B;  5B2I D;  3AYW A;  3R45 A;  1B67 A;  3B6G B;  5B0Z A;  3AZF A;  5JRG A;  4DRA A;  5B0Y C;  3AZL B;  3KWQ B;  1KX5 B;  3X1U A;  5GT3 A;  3REK B;  1M19 D;  3X1T A;  5AV5 D;  3WAA A;  5GSU B;  4H9N B;  5AV8 B;  4J8V A;  3V9R A;  4QLC D;  5B31 C;  1P3G A;  2BYM A;  4WU9 C;  1P3M C;  5CPI D;  3UT9 B;  1HQ3 A;  4NE3 A;  1ZLA C;  4J8W B;  4WU9 D;  3AZK A;  1P3M D;  5CPJ C;  2BYK A;  3UTA A;  5DNM C;  3W96 A;  1P3O B;  4ZUX A;  1ZLA D;  5GT0 C;  3REL C;  3AZN B;  5B33 B;  1P3L B;  4AWL C;  1P3A C;  5CPJ D;  4H9P A;  4R8P B;  3LEL C;  5DNM D;  2YFV A;  4YS3 A;  1BH9 B;  5B2J C;  2FJ7 C;  5B40 B;  5AVC B;  5AY8 C;  5GT0 D;  3REL D;  3AZM B;  3B6F A;  4KUD A;  1AOI A;  3LEL D;  4JJN A;  5B2J D;  1P3K A;  2FJ7 D;  3TU4 D;  3MGQ A;  4XZQ B;  5AV9 C;  4J8U C;  1P3F C;  2NZD A;  3W98 A;  4CAY A;  3C1C B;  1TZY D;  3X1V A;  1P34 A;  4KHA A;  2ARO C;  5AV9 D;  5BNV B;  1P3F D;  3AV1 A;  3AZG B;  5E5A A;  3KXB A;  3AZH A;  5B2I B;  1P3B A;  3MGR A;  1U35 A;  4WZS B;  3C1B A;  5G49 B;  3B0D C;  5DNN A;  3B6G C;  5AV6 D;  3AZL C;  2F8N D;  3LZ0 D;  3KWQ C;  1M19 B;  1KX5 C;  3WA9 C;  5AV5 B;  5CP6 C;  4XUJ B;  4WU8 B;  3REK C;  3A6N A;  4QLC B;  3KWQ D;  4NE5 A;  3WA9 D;  5B1M A;  5GSU C;  5CP6 D;  5AV8 C;  5CPI B;  5BNX A;  4M6B A;  1S32 A;  1P3P A;  4H9Q A;  5GSU D;  3MGP C;  2HIO A;  5B32 D;  4WU9 B;  2CV5 B;  5B32 G;  5CHL B;  1TAF B;  3MGP D;  1P3I A;  5B1L A;  2LY8 A;  3O62 A;  3W99 B;  4G91 B;  1P3O C;  5GT0 B;  3AZN C;  5B33 C;  3NQJ A;  1P3L C;  5GXQ A;  4R8P C;  3LEL B;  5B24 A;  1P3O D;  3LJA A;  5B40 C;  5AVC C;  2FJ7 B;  3WTP A;  3TU4 B;  3AZM C;  5CPK A;  4KGC A;  3X1S D;  4H9S C;  3KUY A;  1JFI A;  2PYO A;  5F99 A;  1TZY B;  5B40 D;  5AVC D;  3WKJ B;  4XZQ C;  3AFA D;  3REI B;  5BS7 A;  5AV9 B;  1P3F B;  3C1C C;  3AZE A;  5B0Z C;  3MGS A;  3LZ1 D;  4J8X B;  5FUG A;  1M1A A;  1N1J A;  3AZG C;  3AZJ A;  5B0Z D;  4Z5T A;  1EQZ B;  5JRG D;  5GT3 C;  3X1T C;  5AV6 B;  4YM6 B;  4HGA B;  4Z66 C;  3AZG D;  1KX4 B;  4X23 A;  3LZ0 B;  5GT3 D;  3AN2 B;  3REJ B;  4ZBJ B;  3X1T D;  4Z66 D;  1ID3 A;  1M19 C;  1F66 A;  1WWS A;  5AV5 C;  3WA9 B;  4XUJ C;  5CP6 B;  3VH5 A;  4WU8 C;  4QLC C;  3AZK C;  1M18 A;  4XUJ D;  4WU8 D;  5B32 B;  3AV2 A;  5CPI C;  5KDM B;  5AVB A;  4LD9 B;  3AZK D;  1KX3 A;  4UUZ A;  3MGP B;  3UTA D;  3VH6 A;  2CV5 C;  5BT1 C;  4WNN B;  3MVD B;  1AOI C;  3AZI A;  1H3O A;  2CV5 D;  5BT1 D;  4CSR A;  1HTA A;  3MGQ C;  3W99 C;  3B6F D;  4G91 C;  1BH8 A;  1AOI D;  3UTB A;  3MNN B;  4JJN D;  2NQB B;  3X1S B;  1P34 C;  3MGQ D;  3W99 D;  3B0C W;  3TU4 C;  5B0Y A;  2NZD D;  3AFA B;  3AZH C;  3W98 D;  1P3B C;  3MGR C;  1P34 D;  2F8N K;  3NQU A;  1TZY C;  4WV4 B;  3LZ1 B;  3WKJ C;  3REI C;  5E5A D;  3AZH D;  1P3B D;  3MGR D;  3AYW B;  4DRB A;  3R45 B;  5B0Z B;  5C3I C;  3AZF B;  5JRG B;  3WKJ D;  4J8X C;  3REI D;  5B31 A;  1EQZ C;  3KSY A;  3VH5 W;  3X1U B;  5GT3 B;  1P3M A;  4J8X D;  3X1T B;  5AV6 C;  4YM6 C;  4HGA C;  1KX4 C;  4Z66 B;  3WAA B;  1ZLA A;  1EQZ D;  3LZ0 C;  3AN2 C;  4H9R A;  4J8V B;  3V9R B;  3REJ C;  5CPJ A;  4ZBJ C;  3B0C T;  4YM6 D;  1S32 C;  2HUE B;  5DNM A;  1P3P C;  1KX4 D;  1P3G B;  3REL A;  3AN2 D;  2BYM B;  3REH A;  2F8N H;  3REJ D;  1P3A A;  1HQ3 B;  1S32 D;  1P3P D;  5B2J A;  5AY8 A;  2HIO D;  3AZK B;  5B1L C;  2BYK B;  5B32 C;  3UTA B;  3W96 B;  4ZUX B;  2YFW A;  4LD9 C;  5GXQ C;  3W97 A;  5B1L D;  4J8U A;  3O62 D;  3VH5 T;  3WTP E;  2YFV B;  5BO0 A;  4YS3 B;  1A7W A;  4LD9 D;  3B6F B;  3MVD C;  4KUD B;  2ARO A;  5GXQ D;  1AOI B;  4KGC C;  3KUY C;  1R4V A;  4JJN B;  1P3K B;  5JA4 A;  3WTP D;  3MGQ B;  3MVD D;  5CPK D;  4KGC D;  4H9O A;  3KUY D;  3VH6 T;  2NZD B;  3MNN C;  2F8N A;  3W98 B;  2NQB C;  4CAY B;  3X1S C;  3MGS C;  2L5A A;  3X1V B;  1P34 B;  4KHA B;  3B6G A;  3AZL A;  3AV1 B;  3AFA C;  3MNN D;  5E5A B;  3KXB B;  3AZH B;  3AZE D;  1P3B B;  3KWQ A;  3MGS D;  3MGR B;  1U35 B;  1KX5 A;  2NQB D;  3C1B B;  3LZ1 C;  3REK A;  4Z5T D;  5DNN B;  3AYW C;  4Z2M H;  4H9N A;  5GSU A;  1Q9C A;  5C3I B;  5JRG C;  5AV8 A;  3AZF C;  3AYW D;  1F66 C;  3X1U C;  3AZF D;  3UT9 A;  3A6N B;  1F66 D;  3WAA C;  5B1M B;  1M18 C;  4J8W A;  3X1U D;  4J8V C;  5BNX B;  1P3P B;  1S32 B;  2HUE C;  4H9Q B;  1P3O A;  3WAA D;  1P3G C;  1M18 D;  2HIO B;  5B33 A;  4J8V D;  3AZN A;  3AV2 D;  5AVB D;  1P3L A;  4R8P A;  1HQ3 C;  1BH9 A;  1P3G D;  5B40 A;  5AVC A;  3AZM A;  1P3I B;  5B1L B;  1HQ3 D;  4H9S A;  3O62 B;  3UTA C;  3W96 C;  4ZUX C;  4EO5 B;  3AZI D;  3NQJ B;  4XZQ A;  5GXQ B;  5B24 B;  4YS3 C;  3C1C A;  3W96 D;  4ZUX D;  3LJA B;  3WTP B;  3UTB D;  3B6F C;  4KUD C;  5CPK B;  4G92 B;  5BNV A;  4KGC B;  3KUY B;  3AZG A;  1JFI B;  2PYO B;  5F99 B;  5B2I A;  4YS3 D;  4JJN C;  1P3K C;  5B0Y D;  4KUD D;  5G49 A;  4Z66 A;  2NZD C;  3W98 C;  3AZE B;  1P3K D;  3MGS B;  3X1V C;  4E44 A;  5FUG B;  1KU5 A;  1M1A B;  1N1J B;  3AV1 C;  5E5A C;  3KXB C;  3AZJ B;  1M19 A;  4Z5T B;  1U35 C;  3X1V D;  5AV5 A;  3C1B C;  4XUJ A;  4WU8 A;  5B31 D;  3AV1 D;  3KXB D;  5B31 G;  4QLC A;  4X23 B;  5DNN C;  1U35 D;  3B0B A;  1BFM A;  3C1B D;  5CPI A;  1ID3 B;  5DNN D;  1F66 B;  3REH C;  4WU9 A;  2CV5 A;  3A6N C;  3REH D;  1TAF A;  4E45 A;  1P3A D;  5B1M C;  1M18 B;  3AV2 B;  5AVB B;  3A6N D;  2IO5 C;  5AY8 D;  3W99 A;  1KX3 B;  3W97 C;  5B1M D;  4UUZ B;  5GT0 A;  2HIO C;  3VH6 W;  3LEL A;  1WWI A;  3W97 D;  4J8U D;  2FJ7 A;  3TU4 A;  3AZI B;  1H3O B;  1P3I C;  2JSS A;  4CSR B;  3O62 C;  2ARO D;  1BH8 B;  1TZY A;  4EO5 C;  3UTB B;  3WKJ A;  3REI A;  1P3I D;  5AV9 A;  4H9P B;  1P3F A;  5B24 C;  2RVQ C;  3LJA C;  3WTP C;  5B0Y B;  4J8X A;  5CPK C;  4G92 C;  2F8N G;  5B24 D;  2RVQ D;  4NE6 A;  5F99 C;  2PYO C;  3B6G D;  3NQU B;  3LJA D;  1EQZ A;  3AZL D;  5BS7 C;  5AV6 A;  4YM6 A;  1KX4 A;  1KX5 D;  2PYO D;  5F99 D;  3AZE C;  3LZ0 A;  3AN2 A;  3REJ A;  3REK D;  1M1A C;  5B31 B;  3AZJ C;  4Z5T C;  5AV8 D;  1P3M B;  3WA9 A;  3UT9 C;  1M1A D;  5CP6 A;  1ZLA B;  3AZJ D;  4X23 C;  4J8W C;  4H9R B;  2CWE A;  3UT9 D;  5CPJ B;  5B32 A;  5KDM A;  5DNM B;  1ID3 C;  4X23 D;  4J8W D;  3REL B;  4LD9 A;  3REH B;  4AWL B; 
#chains in the Genus database with same CATH topology
 1P3A B;  3MGP A;  2Y2O A;  1ID3 D;  5B2J B;  4WNN A;  5AY8 B;  5B33 D;  3MVD A;  3AZN D;  1P3L D;  4R8P D;  4NFT A;  5AVB C;  3AV2 C;  4WJ3 C;  2IO5 B;  2YFW B;  3AZM D;  1KX3 C;  1ULY A;  3W97 B;  4J8U B;  4Z2M G;  3MNN A;  5BO0 B;  2NQB A;  3X1S A;  1B6W A;  4XZQ D;  1KX3 D;  2ARO B;  1F1E A;  3H0R C;  3AZI C;  3AFA A;  5B2I C;  3C1C D;  5JA4 B;  4H9O B;  3LZ1 A;  3UTB C;  3B0D B;  2F8N B;  5B2I D;  3AYW A;  3R45 A;  1B67 A;  3B6G B;  5B0Z A;  3AZF A;  5JRG A;  4DRA A;  5B0Y C;  3AZL B;  3KWQ B;  1KX5 B;  3X1U A;  5GT3 A;  3REK B;  2Y2H A;  1M19 D;  3X1T A;  5AV5 D;  3WAA A;  5GSU B;  4H9N B;  5AV8 B;  4J8V A;  3V9R A;  4QLC D;  5B31 C;  1P3G A;  2BYM A;  4WU9 C;  1P3M C;  5CPI D;  3UT9 B;  1HQ3 A;  2Y2K A;  4NE3 A;  1ZLA C;  4J8W B;  4WU9 D;  3AZK A;  1P3M D;  4DQY B;  5CPJ C;  2BYK A;  3UTA A;  5DNM C;  3W96 A;  1P3O B;  4ZUX A;  1ZLA D;  5GT0 C;  3REL C;  3AZN B;  5B33 B;  1P3L B;  4AWL C;  1P3A C;  5CPJ D;  4H9P A;  4R8P B;  3LEL C;  2ZY3 A;  5DNM D;  2YFV A;  4YS3 A;  1BH9 B;  5B2J C;  2FJ7 C;  5B40 B;  5AVC B;  5AY8 C;  5GT0 D;  3REL D;  3AZM B;  3B6F A;  4KUD A;  1AOI A;  3LEL D;  4JJN A;  5B2J D;  1P3K A;  2FJ7 D;  3TU4 D;  3MGQ A;  4XZQ B;  5AV9 C;  4J8U C;  1P3F C;  2NZD A;  3W98 A;  4CAY A;  3C1C B;  1TZY D;  3X1V A;  1P34 A;  4KHA A;  2ARO C;  5AV9 D;  5BNV B;  1P3F D;  3AV1 A;  3AZG B;  5E5A A;  3KXB A;  3AZH A;  5B2I B;  1P3B A;  3MGR A;  1U35 A;  4WZS B;  3C1B A;  3EG5 B;  5G49 B;  3B0D C;  5DNN A;  3B6G C;  3P5J B;  5AV6 D;  3AZL C;  3H0M C;  2F8N D;  3LZ0 D;  3KWQ C;  1M19 B;  1KX5 C;  3WA9 C;  5AV5 B;  3FDD A;  5CP6 C;  4XUJ B;  4WU8 B;  3REK C;  3A6N A;  4QLC B;  3KWQ D;  4NE5 A;  2F2A C;  3WA9 D;  5B1M A;  5GSU C;  5CP6 D;  5AV8 C;  5CPI B;  5BNX A;  4M6B A;  2JCH A;  1S32 A;  4H9Q A;  1P3P A;  5GSU D;  3MGP C;  2HIO A;  5B32 D;  4WU9 B;  2CV5 B;  5B32 G;  5CHL B;  1TAF B;  3MGP D;  1P3I A;  5B1L A;  2LY8 A;  3O62 A;  3W99 B;  4G91 B;  1P3O C;  5GT0 B;  3AZN C;  5B33 C;  3NQJ A;  1PZR A;  1P3L C;  5GXQ A;  4R8P C;  3LEL B;  2W8S A;  5B24 A;  1P3O D;  3LJA A;  5B40 C;  5AVC C;  2FJ7 B;  3WTP A;  3TU4 B;  3AZM C;  5CPK A;  4KGC A;  3X1S D;  4H9S C;  3KUY A;  1JFI A;  2PYO A;  5F99 A;  1TZY B;  5B40 D;  5AVC D;  3WKJ B;  4XZQ C;  3AFA D;  3REI B;  5BS7 A;  5AV9 B;  1P3F B;  3C1C C;  3AZE A;  5B0Z C;  3MGS A;  3LZ1 D;  4J8X B;  3EPK A;  5FUG A;  1M1A A;  1N1J A;  3AZG C;  3AZJ A;  5B0Z D;  4Z5T A;  1EQZ B;  5JRG D;  5GT3 C;  1Z2C B;  3X1T C;  5AV6 B;  4YM6 B;  4HGA B;  3F6T A;  4Z66 C;  3AZG D;  1KX4 B;  4X23 A;  3LZ0 B;  5GT3 D;  3AN2 B;  3REJ B;  4ZBJ B;  3X1T D;  4Z66 D;  1ID3 A;  2XD1 A;  1M19 C;  1F66 A;  1WWS A;  2UWX A;  5AV5 C;  3WA9 B;  4XUJ C;  5CP6 B;  3VH5 A;  4WU8 C;  4QLC C;  3AZK C;  1M18 A;  4XUJ D;  4WU8 D;  5B32 B;  3AV2 A;  5CPI C;  5KDM B;  5AVB A;  4LD9 B;  3AZK D;  1KX3 A;  4UUZ A;  3MGP B;  3UTA D;  3VH6 A;  2CV5 C;  5BT1 C;  3EPH A;  4WNN B;  3MVD B;  1AOI C;  2DF4 C;  3AZI A;  2BG1 A;  1H3O A;  2CV5 D;  5BT1 D;  4CSR A;  1HTA A;  3MGQ C;  3W99 C;  3B6F D;  4G91 C;  1BH8 A;  1AOI D;  3UTB A;  2Y2M A;  3MNN B;  4JJN D;  2NQB B;  3X1S B;  1P34 C;  3MGQ D;  3W99 D;  2VQR A;  3B0C W;  3TU4 C;  5B0Y A;  2NZD D;  3AFA B;  3AZH C;  3W98 D;  1P3B C;  3MGR C;  1P34 D;  2F8N K;  3NQU A;  1TZY C;  4WV4 B;  3LZ1 B;  3WKJ C;  3REI C;  5E5A D;  3AZH D;  2Y2P A;  1P3B D;  3MGR D;  3AYW B;  4DRB A;  3R45 B;  5B0Z B;  5C3I C;  3AZF B;  5JRG B;  3WKJ D;  4J8X C;  3REI D;  5B31 A;  1EQZ C;  3KSY A;  3VH5 W;  3X1U B;  5GT3 B;  1P3M A;  4J8X D;  3X1T B;  5AV6 C;  4YM6 C;  4HGA C;  1KX4 C;  4Z66 B;  3WAA B;  1ZLA A;  1EQZ D;  3LZ0 C;  3AN2 C;  4H9R A;  4J8V B;  3V9R B;  3REJ C;  5CPJ A;  4ZBJ C;  3B0C T;  4YM6 D;  1S32 C;  2HUE B;  5DNM A;  1P3P C;  1KX4 D;  1P3G B;  3REL A;  3AN2 D;  2BYM B;  3REH A;  2F8N H;  3REJ D;  1P3A A;  1HQ3 B;  1S32 D;  1P3P D;  5B2J A;  5AY8 A;  2HIO D;  3AZK B;  5B1L C;  2BYK B;  5B32 C;  3UTA B;  2G5I C;  3W96 B;  4ZUX B;  1T3U A;  2YFW A;  4LD9 C;  5GXQ C;  3W97 A;  5B1L D;  4J8U A;  3O62 D;  3VH5 T;  3WTP E;  2YFV B;  3H0L C;  5BO0 A;  4YS3 B;  1A7W A;  4LD9 D;  3B6F B;  3MVD C;  4KUD B;  2ARO A;  5GXQ D;  1AOI B;  4KGC C;  3KUY C;  1R4V A;  4JJN B;  1P3K B;  5JA4 A;  3WTP D;  3MGQ B;  3MVD D;  5CPK D;  4KGC D;  4H9O A;  3KUY D;  3VH6 T;  2NZD B;  3MNN C;  2F8N A;  3W98 B;  2NQB C;  4CAY B;  3X1S C;  3MGS C;  2L5A A;  3X1V B;  1P34 B;  4KHA B;  3B6G A;  3AZL A;  3AV1 B;  3AFA C;  3MNN D;  5E5A B;  3KXB B;  3AZH B;  3AZE D;  1P3B B;  3KWQ A;  3MGS D;  3MGR B;  1U35 B;  1KX5 A;  2NQB D;  3C1B B;  3LZ1 C;  2JE5 A;  3REK A;  4Z5T D;  5DNN B;  3AYW C;  2ZY5 A;  4Z2M H;  4H9N A;  5GSU A;  1Q9C A;  5C3I B;  5JRG C;  5AV8 A;  3AZF C;  3AYW D;  1F66 C;  3X1U C;  3AZF D;  3UT9 A;  3A6N B;  1F66 D;  3WAA C;  5B1M B;  1M18 C;  4J8W A;  3X1U D;  4J8V C;  2XD5 A;  5BNX B;  1P3P B;  1S32 B;  2HUE C;  4H9Q B;  1P3O A;  3WAA D;  1P3G C;  2Y2I A;  1M18 D;  2HIO B;  5B33 A;  4J8V D;  3AZN A;  3AV2 D;  5AVB D;  1P3L A;  4R8P A;  1HQ3 C;  3AL0 C;  1BH9 A;  1P3G D;  5B40 A;  5AVC A;  2G5H C;  3AZM A;  1P3I B;  5B1L B;  1HQ3 D;  4H9S A;  3O62 B;  3UTA C;  2RIQ A;  3W96 C;  4ZUX C;  4EO5 B;  3AZI D;  3NQJ B;  4XZQ A;  5GXQ B;  2ZM5 A;  5B24 B;  4YS3 C;  3C1C A;  3W96 D;  4ZUX D;  3LJA B;  3WTP B;  3UTB D;  3B6F C;  4KUD C;  3A1K A;  5CPK B;  4G92 B;  5BNV A;  4KGC B;  3KUY B;  3AZG A;  1JFI B;  2PYO B;  5F99 B;  5B2I A;  4YS3 D;  4JJN C;  1P3K C;  5B0Y D;  4KUD D;  5G49 A;  4Z66 A;  2NZD C;  3W98 C;  3AZE B;  1P3K D;  3MGS B;  3X1V C;  4E44 A;  5FUG B;  1KU5 A;  1M1A B;  1N1J B;  3AV1 C;  5E5A C;  3KXB C;  3AZJ B;  1M19 A;  4Z5T B;  1U35 C;  2Y2L A;  3X1V D;  5AV5 A;  3C1B C;  4XUJ A;  4WU8 A;  5B31 D;  2ZY4 A;  3AV1 D;  3KXB D;  5B31 G;  4QLC A;  4X23 B;  5DNN C;  3EPJ A;  3B0B A;  1U35 D;  1BFM A;  3C1B D;  5CPI A;  1ID3 B;  3A1I A;  5DNN D;  3EPL A;  1F66 B;  3KFU G;  3REH C;  2FFF B;  4WU9 A;  2CV5 A;  3A6N C;  4UPK A;  2J8P A;  3REH D;  1TAF A;  4E45 A;  1P3A D;  5B1M C;  1M18 B;  2Y2Q A;  3AV2 B;  5AVB B;  3A6N D;  2IO5 C;  5AY8 D;  3W99 A;  1KX3 B;  3W97 C;  5B1M D;  4UUZ B;  5GT0 A;  2HIO C;  3VH6 W;  3LEL A;  1WWI A;  3W97 D;  4J8U D;  2FJ7 A;  1W2E A;  3TU4 A;  3AZI B;  1H3O B;  1P3I C;  2JSS A;  4CSR B;  3O62 C;  2ARO D;  1BH8 B;  1TZY A;  4EO5 C;  3UTB B;  3WKJ A;  3REI A;  1P3I D;  5AV9 A;  4H9P B;  1P3F A;  5B24 C;  2RVQ C;  3LJA C;  3WTP C;  5B0Y B;  4J8X A;  5CPK C;  4G92 C;  2F8N G;  2Y2J A;  5B24 D;  2RVQ D;  4NE6 A;  5F99 C;  2PYO C;  3B6G D;  3NQU B;  3LJA D;  1EQZ A;  3AZL D;  5BS7 C;  2Y2G A;  5AV6 A;  4YM6 A;  1KX4 A;  1KX5 D;  2PYO D;  5F99 D;  3AZE C;  3IP4 C;  3LZ0 A;  3AN2 A;  3REJ A;  3REK D;  2DQN C;  1M1A C;  5B31 B;  3AZJ C;  4Z5T C;  5AV8 D;  1P3M B;  3WA9 A;  3UT9 C;  2Y2N A;  1M1A D;  5CP6 A;  1ZLA B;  3AZJ D;  4X23 C;  4J8W C;  4H9R B;  2CWE A;  3UT9 D;  5CPJ B;  5B32 A;  5KDM A;  5DNM B;  1ID3 C;  4X23 D;  4J8W D;  3REL B;  4LD9 A;  2ZY2 A;  3REH B;  4AWL B; 
#chains in the Genus database with same CATH homology
 1P3A B;  3MGP A;  2Y2O A;  1ID3 D;  5B2J B;  4WNN A;  5AY8 B;  5B33 D;  3MVD A;  3AZN D;  1P3L D;  4R8P D;  4NFT A;  5AVB C;  3AV2 C;  4WJ3 C;  2IO5 B;  2YFW B;  3AZM D;  1KX3 C;  1ULY A;  3W97 B;  4J8U B;  4Z2M G;  3MNN A;  5BO0 B;  2NQB A;  3X1S A;  1B6W A;  4XZQ D;  1KX3 D;  2ARO B;  1F1E A;  3H0R C;  3AZI C;  3AFA A;  5B2I C;  3C1C D;  5JA4 B;  4H9O B;  3LZ1 A;  3UTB C;  3B0D B;  2F8N B;  5B2I D;  3AYW A;  3R45 A;  1B67 A;  3B6G B;  5B0Z A;  3AZF A;  5JRG A;  4DRA A;  5B0Y C;  3AZL B;  3KWQ B;  1KX5 B;  3X1U A;  5GT3 A;  3REK B;  2Y2H A;  1M19 D;  3X1T A;  5AV5 D;  3WAA A;  5GSU B;  4H9N B;  5AV8 B;  4J8V A;  3V9R A;  4QLC D;  5B31 C;  1P3G A;  2BYM A;  4WU9 C;  1P3M C;  5CPI D;  3UT9 B;  1HQ3 A;  2Y2K A;  4NE3 A;  1ZLA C;  4J8W B;  4WU9 D;  3AZK A;  1P3M D;  4DQY B;  5CPJ C;  2BYK A;  3UTA A;  5DNM C;  3W96 A;  1P3O B;  4ZUX A;  1ZLA D;  5GT0 C;  3REL C;  3AZN B;  5B33 B;  1P3L B;  4AWL C;  1P3A C;  5CPJ D;  4H9P A;  4R8P B;  3LEL C;  2ZY3 A;  5DNM D;  2YFV A;  4YS3 A;  1BH9 B;  5B2J C;  2FJ7 C;  5B40 B;  5AVC B;  5AY8 C;  5GT0 D;  3REL D;  3AZM B;  3B6F A;  4KUD A;  1AOI A;  3LEL D;  4JJN A;  5B2J D;  1P3K A;  2FJ7 D;  3TU4 D;  3MGQ A;  4XZQ B;  5AV9 C;  4J8U C;  1P3F C;  2NZD A;  3W98 A;  4CAY A;  3C1C B;  1TZY D;  3X1V A;  1P34 A;  4KHA A;  2ARO C;  5AV9 D;  5BNV B;  1P3F D;  3AV1 A;  3AZG B;  5E5A A;  3KXB A;  3AZH A;  5B2I B;  1P3B A;  3MGR A;  1U35 A;  4WZS B;  3C1B A;  3EG5 B;  5G49 B;  3B0D C;  5DNN A;  3B6G C;  3P5J B;  5AV6 D;  3AZL C;  3H0M C;  2F8N D;  3LZ0 D;  3KWQ C;  1M19 B;  1KX5 C;  3WA9 C;  5AV5 B;  3FDD A;  5CP6 C;  4XUJ B;  4WU8 B;  3REK C;  3A6N A;  4QLC B;  3KWQ D;  4NE5 A;  2F2A C;  3WA9 D;  5B1M A;  5GSU C;  5CP6 D;  5AV8 C;  5CPI B;  5BNX A;  4M6B A;  2JCH A;  1S32 A;  4H9Q A;  1P3P A;  5GSU D;  3MGP C;  2HIO A;  5B32 D;  4WU9 B;  2CV5 B;  5B32 G;  5CHL B;  1TAF B;  3MGP D;  1P3I A;  5B1L A;  2LY8 A;  3O62 A;  3W99 B;  4G91 B;  1P3O C;  5GT0 B;  3AZN C;  5B33 C;  3NQJ A;  1PZR A;  1P3L C;  5GXQ A;  4R8P C;  3LEL B;  2W8S A;  5B24 A;  1P3O D;  3LJA A;  5B40 C;  5AVC C;  2FJ7 B;  3WTP A;  3TU4 B;  3AZM C;  5CPK A;  4KGC A;  3X1S D;  4H9S C;  3KUY A;  1JFI A;  2PYO A;  5F99 A;  1TZY B;  5B40 D;  5AVC D;  3WKJ B;  4XZQ C;  3AFA D;  3REI B;  5BS7 A;  5AV9 B;  1P3F B;  3C1C C;  3AZE A;  5B0Z C;  3MGS A;  3LZ1 D;  4J8X B;  3EPK A;  5FUG A;  1M1A A;  1N1J A;  3AZG C;  3AZJ A;  5B0Z D;  4Z5T A;  1EQZ B;  5JRG D;  5GT3 C;  1Z2C B;  3X1T C;  5AV6 B;  4YM6 B;  4HGA B;  3F6T A;  4Z66 C;  3AZG D;  1KX4 B;  4X23 A;  3LZ0 B;  5GT3 D;  3AN2 B;  3REJ B;  4ZBJ B;  3X1T D;  4Z66 D;  1ID3 A;  2XD1 A;  1M19 C;  1F66 A;  1WWS A;  2UWX A;  5AV5 C;  3WA9 B;  4XUJ C;  5CP6 B;  3VH5 A;  4WU8 C;  4QLC C;  3AZK C;  1M18 A;  4XUJ D;  4WU8 D;  5B32 B;  3AV2 A;  5CPI C;  5KDM B;  5AVB A;  4LD9 B;  3AZK D;  1KX3 A;  4UUZ A;  3MGP B;  3UTA D;  3VH6 A;  2CV5 C;  5BT1 C;  3EPH A;  4WNN B;  3MVD B;  1AOI C;  2DF4 C;  3AZI A;  2BG1 A;  1H3O A;  2CV5 D;  5BT1 D;  4CSR A;  1HTA A;  3MGQ C;  3W99 C;  3B6F D;  4G91 C;  1BH8 A;  1AOI D;  3UTB A;  2Y2M A;  3MNN B;  4JJN D;  2NQB B;  3X1S B;  1P34 C;  3MGQ D;  3W99 D;  2VQR A;  3B0C W;  3TU4 C;  5B0Y A;  2NZD D;  3AFA B;  3AZH C;  3W98 D;  1P3B C;  3MGR C;  1P34 D;  2F8N K;  3NQU A;  1TZY C;  4WV4 B;  3LZ1 B;  3WKJ C;  3REI C;  5E5A D;  3AZH D;  2Y2P A;  1P3B D;  3MGR D;  3AYW B;  4DRB A;  3R45 B;  5B0Z B;  5C3I C;  3AZF B;  5JRG B;  3WKJ D;  4J8X C;  3REI D;  5B31 A;  1EQZ C;  3KSY A;  3VH5 W;  3X1U B;  5GT3 B;  1P3M A;  4J8X D;  3X1T B;  5AV6 C;  4YM6 C;  4HGA C;  1KX4 C;  4Z66 B;  3WAA B;  1ZLA A;  1EQZ D;  3LZ0 C;  3AN2 C;  4H9R A;  4J8V B;  3V9R B;  3REJ C;  5CPJ A;  4ZBJ C;  3B0C T;  4YM6 D;  1S32 C;  2HUE B;  5DNM A;  1P3P C;  1KX4 D;  1P3G B;  3REL A;  3AN2 D;  2BYM B;  3REH A;  2F8N H;  3REJ D;  1P3A A;  1HQ3 B;  1S32 D;  1P3P D;  5B2J A;  5AY8 A;  2HIO D;  3AZK B;  5B1L C;  2BYK B;  5B32 C;  3UTA B;  2G5I C;  3W96 B;  4ZUX B;  1T3U A;  2YFW A;  4LD9 C;  5GXQ C;  3W97 A;  5B1L D;  4J8U A;  3O62 D;  3VH5 T;  3WTP E;  2YFV B;  3H0L C;  5BO0 A;  4YS3 B;  1A7W A;  4LD9 D;  3B6F B;  3MVD C;  4KUD B;  2ARO A;  5GXQ D;  1AOI B;  4KGC C;  3KUY C;  1R4V A;  4JJN B;  1P3K B;  5JA4 A;  3WTP D;  3MGQ B;  3MVD D;  5CPK D;  4KGC D;  4H9O A;  3KUY D;  3VH6 T;  2NZD B;  3MNN C;  2F8N A;  3W98 B;  2NQB C;  4CAY B;  3X1S C;  3MGS C;  2L5A A;  3X1V B;  1P34 B;  4KHA B;  3B6G A;  3AZL A;  3AV1 B;  3AFA C;  3MNN D;  5E5A B;  3KXB B;  3AZH B;  3AZE D;  1P3B B;  3KWQ A;  3MGS D;  3MGR B;  1U35 B;  1KX5 A;  2NQB D;  3C1B B;  3LZ1 C;  2JE5 A;  3REK A;  4Z5T D;  5DNN B;  3AYW C;  2ZY5 A;  4Z2M H;  4H9N A;  5GSU A;  1Q9C A;  5C3I B;  5JRG C;  5AV8 A;  3AZF C;  3AYW D;  1F66 C;  3X1U C;  3AZF D;  3UT9 A;  3A6N B;  1F66 D;  3WAA C;  5B1M B;  1M18 C;  4J8W A;  3X1U D;  4J8V C;  2XD5 A;  5BNX B;  1P3P B;  1S32 B;  2HUE C;  4H9Q B;  1P3O A;  3WAA D;  1P3G C;  2Y2I A;  1M18 D;  2HIO B;  5B33 A;  4J8V D;  3AZN A;  3AV2 D;  5AVB D;  1P3L A;  4R8P A;  1HQ3 C;  3AL0 C;  1BH9 A;  1P3G D;  5B40 A;  5AVC A;  2G5H C;  3AZM A;  1P3I B;  5B1L B;  1HQ3 D;  4H9S A;  3O62 B;  3UTA C;  2RIQ A;  3W96 C;  4ZUX C;  4EO5 B;  3AZI D;  3NQJ B;  4XZQ A;  5GXQ B;  2ZM5 A;  5B24 B;  4YS3 C;  3C1C A;  3W96 D;  4ZUX D;  3LJA B;  3WTP B;  3UTB D;  3B6F C;  4KUD C;  3A1K A;  5CPK B;  4G92 B;  5BNV A;  4KGC B;  3KUY B;  3AZG A;  1JFI B;  2PYO B;  5F99 B;  5B2I A;  4YS3 D;  4JJN C;  1P3K C;  5B0Y D;  4KUD D;  5G49 A;  4Z66 A;  2NZD C;  3W98 C;  3AZE B;  1P3K D;  3MGS B;  3X1V C;  4E44 A;  5FUG B;  1KU5 A;  1M1A B;  1N1J B;  3AV1 C;  5E5A C;  3KXB C;  3AZJ B;  1M19 A;  4Z5T B;  1U35 C;  2Y2L A;  3X1V D;  5AV5 A;  3C1B C;  4XUJ A;  4WU8 A;  5B31 D;  2ZY4 A;  3AV1 D;  3KXB D;  5B31 G;  4QLC A;  4X23 B;  5DNN C;  3EPJ A;  3B0B A;  1U35 D;  1BFM A;  3C1B D;  5CPI A;  1ID3 B;  3A1I A;  5DNN D;  3EPL A;  1F66 B;  3KFU G;  3REH C;  2FFF B;  4WU9 A;  2CV5 A;  3A6N C;  4UPK A;  2J8P A;  3REH D;  1TAF A;  4E45 A;  1P3A D;  5B1M C;  1M18 B;  2Y2Q A;  3AV2 B;  5AVB B;  3A6N D;  2IO5 C;  5AY8 D;  3W99 A;  1KX3 B;  3W97 C;  5B1M D;  4UUZ B;  5GT0 A;  2HIO C;  3VH6 W;  3LEL A;  1WWI A;  3W97 D;  4J8U D;  2FJ7 A;  1W2E A;  3TU4 A;  3AZI B;  1H3O B;  1P3I C;  2JSS A;  4CSR B;  3O62 C;  2ARO D;  1BH8 B;  1TZY A;  4EO5 C;  3UTB B;  3WKJ A;  3REI A;  1P3I D;  5AV9 A;  4H9P B;  1P3F A;  5B24 C;  2RVQ C;  3LJA C;  3WTP C;  5B0Y B;  4J8X A;  5CPK C;  4G92 C;  2F8N G;  2Y2J A;  5B24 D;  2RVQ D;  4NE6 A;  5F99 C;  2PYO C;  3B6G D;  3NQU B;  3LJA D;  1EQZ A;  3AZL D;  5BS7 C;  2Y2G A;  5AV6 A;  4YM6 A;  1KX4 A;  1KX5 D;  2PYO D;  5F99 D;  3AZE C;  3IP4 C;  3LZ0 A;  3AN2 A;  3REJ A;  3REK D;  2DQN C;  1M1A C;  5B31 B;  3AZJ C;  4Z5T C;  5AV8 D;  1P3M B;  3WA9 A;  3UT9 C;  2Y2N A;  1M1A D;  5CP6 A;  1ZLA B;  3AZJ D;  4X23 C;  4J8W C;  4H9R B;  2CWE A;  3UT9 D;  5CPJ B;  5B32 A;  5KDM A;  5DNM B;  1ID3 C;  4X23 D;  4J8W D;  3REL B;  4LD9 A;  2ZY2 A;  3REH B;  4AWL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...