5B1LA

The mouse nucleosome structure containing h3t
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
b'PHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3t
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1lA00
1BH8A 4QLCD 5B31A 1P3KC 3WTPA 2BYMB 4X23A 4H9PA 3KUYC 4WU8C 3W98A 1P3AC 3TU4B 5B24C 5E5AA 4J8VB 3UT9A 4KHAB 3LZ1D 3X1VA 1P3GB 5B0YD 3AZMA 3RELC 3AV2A 3UTAD 1F66A 4EO5B 3X1VD 5CPIB 3REHA 1P3MA 3B0CT 4UUZB 4M6BA 1B6WA 4XZQB 4CSRB 2F8NA 3A6NC 3MGSC 3AZHA 3AN2B 3WTPB 3X1SC 5GXQB 4Z5TA 4R8PD 5E5AB 1KX4C 4Z5TD 3VH6A 3UTBD 4NE3A 3AV1A 3MGQB 3REKC 3WKJA 3AYWD 4J8WA 4XUJC 1P3MB 1EQZC 2F8NB 5CPKD 1AOIB 5JRGB 5DNMA 1M1AD 5AV8A 3AFAA 1Q9CA 3AZNB 5F99A 1P3FB 3W99C 4J8UD 5GT3C 1HQ3B 1P3KA 4LD9B 2NZDD 5B32C 2AROA 5GSUD 5AVBB 3KUYA 4KUDB 4AWLC 1P3AA 5G49B 4WU9C 3MVDD 3RELA 5B2JD 4WNNA 5AY8A 4DRBA 3WKJB 5AY8D 3O62D 5B33C 1P3IC 4J8VC 3A6NA 1P3GC 3W96A 5AV6C 3AZKD 2FJ7A 4EO5C 3AFAB 5CPIC 3MGRB 5B2IB 1BFMA 5FUGA 3MGSA 4XZQC 2YFWA 1KX5B 2HUEC 3X1SA 1ID3B 3VH5A 4WU8B 3AZGB 1S32C 4J8XD 5B24B 2CV5B 1KX4A 4H9SC 3RELB 1TZYD 5B40B 2PYOD 3REKA 4JJND 4XUJA 3B6GC 5GT0B 5GXQC 3X1TD 3REJB 1P3BD 3MGQC 2HIOD 3R45B 3X1UA 3W99A 5FUGB 1P3PD 5GT3A 3X1UD 1AOIC 3AZEB 5B32A 5KDMB 4YM6D 5CP6B 4NE5A 3C1CD 4ZBJC 3VH6W 3C1BD 3AZNC 1KX4B 1P3FC 4ZUXB 4WU9A 4H9NB 1HQ3C 1U35D 2CWEA 2BYMA 1B67A 5DNNB 5B0YC 5AVBC 4XUJB 1EQZB 3UTAC 5B33A 3V9RB 4KUDC 3MGPC 3WAAD 3TU4A 1P3IA 5AV5B 4J8VA 5CPJB 1P3GA 3TU4D 2LY8A 1KX3D 3B6FB 1JFIB 3AZFD 5B1LB 5B0ZC 5CPIA 3NQUB 4CAYB 4UUZA 3KWQD 4XZQA 1M19B 4CSRA 3B0BA 5AV9D 3AZJB 3AZLB 1S32A 4YS3B 3MGRC 5B2IC 4H9SA 1ZLAB 2NQBB 3AN2A 1KX5C 1P3LB 1ID3C 5B31D 2RVQD 5B1MB 3WTPD 5B33B 3AZGC 3B6GA 4X23D 5GXQA 1P3IB 2CV5C 4G92B 3AZIB 3W98D 5AV6B 1M18B 1WWSA 4G91B 5E5AD 3UT9D 5B40C 3LELB 3MGQA 3AV2D 3AZMD 1F66D 2F8NK 3VH5W 3REHD 5GT0C 1AOIA 4HGAB 2HUEB 4H9QB 1P34B 1P3MD 2F8ND 5JRGA 4Z66B 3LJAC 1S32B 3REJC 3AZNA 3KXBB 1P3FA 1P3OB 1HQ3A 4LD9A 3LZ0B 3AZEC 3AZHD 5AVBA 4LD9D 5CP6C 3B6GB 4KUDA 3MGPA 5AVCB 5G49A 1F1EA 4ZUXC 4KGCB 3WA9B 5B0ZA 5DNNC 3AV1D 3W97C 3WKJD 1R4VA 5AV5C 4J8WD 5CPJC 5DNMD 3B6FC 4ZBJB 5B1LC 3MGRA 5B2IA 5BT1C 5AV8D 1M19C 3AFAD 5F99D 5C3IB 1KX5A 3AZJC 1ID3A 3LZ1B 1P3KD 5B0YB 3AZLC 3MNNC 3UTAB 4WU8A 3MGPB 3AZGA 2AROD 5B24A 3KSYA 4YS3C 2CV5A 3KUYD 4H9OB 4WU8D 1P3AD 1ZLAC 2NQBC 5B40A 1P3LC 5B0ZB 3RELD 5B1MC 3WTPE 5GT0A 4G92C 3AZIC 1M18C 4G91C 3LJAA 3A6ND 3REJA 3LELC 3W96D 3R45A 3REIC 4YM6C 2FJ7D 3C1CC 4E44A 1TAFB 4HGAC 1P34C 3MGSD 3AZEA 5KDMA 4Z66C 5CP6A 3X1SD 3AYWB 3KXBC 1P3OC 4ZUXA 5CPKB 1KX4D 4H9NA 3LZ0C 1M1AB 5DNNA 1EQZA 3REKD 3V9RA 3W97A 3AZFC 5AV5A 4XUJD 1EQZD 5CPJA 5AVCC 4J8UB 3KWQC 4KGCC 3WA9C 3LJAB 3B6FA 1JFIA 2NZDB 5B1LA 3NQUA 4CAYA 1M19A 3W99D 3AZJA 4H9RB 5GT3D 3MVDB 3AZLA 3MNNA 4QLCC 5B32D 4YS3A 3O62B 1ZLAA 5C3IC 2NQBA 4WU9D 1P3LA 3VH6T 3W98C 3LZ1C 5B1MA 3UT9C 3AZKB 3W97B 3X1VC 3AZIA 5B33D 5AV6A 1P3ID 1M18A 4J8VD 3LELA 1P3GD 2F8NH 5CPID 4J8XB 1A7WA 5CHLB 4H9QA 1P34A 4XZQD 3MNNB 4Z66A 1TZYB 2YFVB 2PYOB 4JJNB 5JA4A 3KXBA 1P3OA 1S32D 4R8PC 2BYKB 2JSSA 3NQJA 3LZ0A 3X1TB 5BNVB 4Z5TC 3AN2D 3UTBC 2HIOB 5BO0A 3AYWC 5AVCA 3B6GD 1H3OB 5GXQD 5CPKC 3WA9A 5BNXB 4KGCA 1M1AC 3REIB 4YM6B 3C1CB 3MGQD 3C1BB 1N1JA 4J8UC 1AOID 4Z2MH 4QLCA 1U35B 5JRGD 3VH5T 5B31G 2NZDC 5GSUC 5JA4B 3WAAB 2AROC 3AZND 1P3FD 3NQJB 3LZ1A 4NFTA 1HQ3D 5B0YA 3MVDC 5B2JC 3UTAA 1KX3B 4NE6A 3B0CW 3AZFB 5BO0B 5AVBD 5AY8C 4E45A 4H9OA 3O62C 3MGPD 3KWQB 4KUDD 1BH9B 2F8NG 5AV9B 5BS7C 3AZKC 5B0ZD 3W96C 1N1JB 2FJ7C 4QLCB 3B0DC 1BH8B 5B31B 4X23B 4R8PA 3MGRD 2IO5B 5B2ID 1TAFA 4J8XC 4H9PB 3W98B 1KX5D 3UT9B 3UTBA 1TZYC 1ID3D 2PYOC 3X1VB 3AV2B 4JJNC 3AZMB 3AYWA 1F66B 4DRAA 3AZGD 5B24D 3REHB 5CPKA 2CV5D 1M1AA 3X1TC 5B40D 1P3BC 2HIOC 4Z2MG 5GT0D 4J8UA 1P3PC 3X1UC 3AZHB 2NZDA 5GSUA 3LJAD 3REJD 4R8PB 3C1BC 4Z5TB 4H9RA 3MVDA 5B2JA 3UTBB 1U35C 3AZED 5CP6D 3O62A 3AV1B 3WAAC 5BS7A 4ZUXD 4J8WB 3TU4C 1KX3C 5DNMB 3AZKA 5DNND 5AV8B 3W97D 5AV5D 5F99B 5CPJD 5AV9C 5GSUB 1P3KB 3B6FD 2AROB 5B1LD 4J8XA 5BT1D 3KUYB 1M19D 1P3AB 5B2JB 1TZYA 3AZJD 2YFVA 2PYOA 3AZLD 4JJNA 4WNNB 2L5AA 5AY8B 5B31C 2RVQC 3MNND 1WWIA 3WTPC 3AN2C 4YS3D 4X23C 2BYKA 2IO5C 3X1TA 1ZLAD 5BNVA 2NQBD 5E5AC 1P3LD 3A6NB 1P3BA 3W96B 2HIOA 3AZMC 5B1MD 3AV2C 1F66C 2FJ7B 1H3OA 1P3PA 3REHC 5BNXA 3AZID 3B0DB 1P3MC 3MGSB 5AV6D 1M18D 2YFWB 3REIA 5B32G 4YM6A 3X1SB 3LELD 5JRGC 3C1CA 3REID 3C1BA 1P34D 1U35A 4WV4B 3AZHC 4Z66D 4LD9C 3REKB 3WAAA 4WZSB 3KXBD 1P3OD 1KX3A 3LZ0D 4KHAA 1P3BB 3AZFA 1ULYA 3KWQA 3AV1C 1BH9A 1P3PB 3X1UB 3WKJC 3W99B 5AV9A 5AVCD 4J8WC 4KGCD 3WA9D 5GT3B 5DNMC 1HTAA 5B32B 1KU5A 4AWLB 5AV8C 3AFAC 5F99C 4WU9B
chains in the Genus database with same CATH superfamily
1BH8A 4QLCD 5B31A 1P3KC 3WTPA 2BYMB 3A1IA 4X23A 3P5JB 4H9PA 3KUYC 4WU8C 3W98A 1P3AC 3TU4B 5B24C 5E5AA 4J8VB 3UT9A 4KHAB 3EPKA 3LZ1D 3X1VA 1P3GB 5B0YD 3AZMA 3RELC 3AV2A 3UTAD 1F66A 2VQRA 4EO5B 3X1VD 5CPIB 3REHA 1P3MA 3B0CT 4UUZB 4M6BA 1B6WA 4XZQB 4CSRB 2F8NA 3A6NC 3H0LC 3FDDA 3MGSC 3AZHA 3AN2B 3WTPB 3X1SC 3IP4C 5GXQB 4Z5TA 4R8PD 5E5AB 1KX4C 4Z5TD 3VH6A 3UTBD 4NE3A 3AV1A 3MGQB 3REKC 3WKJA 3AYWD 4J8WA 4XUJC 1P3MB 1EQZC 2F8NB 5CPKD 1AOIB 5JRGB 5DNMA 1M1AD 5AV8A 3AFAA 1Q9CA 3AZNB 5F99A 1P3FB 3W99C 4J8UD 5GT3C 1HQ3B 1P3KA 4LD9B 2NZDD 5B32C 2AROA 5GSUD 5AVBB 3KUYA 4KUDB 4AWLC 1P3AA 5G49B 4WU9C 3MVDD 3RELA 5B2JD 4WNNA 5AY8A 4DRBA 3WKJB 5AY8D 3O62D 5B33C 1P3IC 4J8VC 3A6NA 1P3GC 3W96A 5AV6C 2Y2JA 3AZKD 2FJ7A 4EO5C 3AFAB 5CPIC 3MGRB 5B2IB 1BFMA 5FUGA 3MGSA 4XZQC 2YFWA 1KX5B 2HUEC 3X1SA 1ID3B 3VH5A 4WU8B 3AZGB 1S32C 4J8XD 5B24B 2CV5B 1KX4A 2UWXA 4H9SC 3RELB 2RIQA 1TZYD 5B40B 2PYOD 3REKA 4JJND 3A1KA 4XUJA 3B6GC 5GT0B 5GXQC 2JE5A 3X1TD 2Y2PA 3REJB 1P3BD 3MGQC 2HIOD 3R45B 3X1UA 2F2AC 3W99A 5FUGB 1P3PD 2Y2QA 5GT3A 3X1UD 1AOIC 3AZEB 5B32A 5KDMB 4YM6D 5CP6B 4NE5A 3C1CD 2G5IC 4ZBJC 3VH6W 3C1BD 3AZNC 1KX4B 1P3FC 4ZUXB 4WU9A 4H9NB 1HQ3C 1U35D 2CWEA 2BYMA 1B67A 5DNNB 5B0YC 5AVBC 4XUJB 1EQZB 3UTAC 2FFFB 3V9RB 5B33A 3MGPC 4KUDC 3WAAD 3TU4A 1P3IA 5AV5B 4J8VA 5CPJB 1P3GA 3TU4D 2LY8A 1KX3D 3B6FB 2G5HC 1JFIB 3AZFD 5B1LB 5B0ZC 5CPIA 3NQUB 4CAYB 4UUZA 3KWQD 4XZQA 1M19B 4CSRA 3B0BA 5AV9D 3AZJB 2ZY2A 3AZLB 1S32A 4YS3B 3MGRC 5B2IC 4H9SA 2DQNC 1ZLAB 2NQBB 3AN2A 1KX5C 1P3LB 2XD5A 1ID3C 5B31D 2RVQD 5B1MB 3WTPD 5B33B 3AZGC 3B6GA 4X23D 5GXQA 1P3IB 2CV5C 4G92B 3AZIB 3W98D 5AV6B 1M18B 1WWSA 4G91B 5E5AD 3UT9D 5B40C 3LELB 3MGQA 3AV2D 3AZMD 1F66D 2F8NK 3VH5W 3REHD 5GT0C 1AOIA 4HGAB 2HUEB 4H9QB 1P34B 1P3MD 2F8ND 5JRGA 4Z66B 2BG1A 3LJAC 1S32B 3REJC 3AZNA 3KXBB 1P3FA 1P3OB 1HQ3A 4LD9A 3LZ0B 3AZEC 3AZHD 5AVBA 4LD9D 5CP6C 3B6GB 4KUDA 3MGPA 5AVCB 5G49A 1F1EA 4ZUXC 4KGCB 3WA9B 1W2EA 5B0ZA 5DNNC 4WJ3C 3AV1D 2ZY5A 3W97C 3WKJD 1R4VA 5AV5C 4J8WD 5CPJC 1T3UA 5DNMD 3B6FC 4ZBJB 5B1LC 3MGRA 5B2IA 5BT1C 5AV8D 1M19C 3AFAD 5F99D 2Y2OA 5C3IB 1KX5A 3AZJC 1ID3A 3LZ1B 1P3KD 5B0YB 3AZLC 3MNNC 3UTAB 4WU8A 3MGPB 3AZGA 2AROD 5B24A 3KSYA 4YS3C 1PZRA 2CV5A 3KUYD 4H9OB 4WU8D 1P3AD 1ZLAC 2NQBC 5B40A 1P3LC 5B0ZB 3RELD 5B1MC 3WTPE 5GT0A 4G92C 3AZIC 1M18C 4G91C 3LJAA 3KFUG 3A6ND 3REJA 3LELC 3W96D 3R45A 3REIC 4YM6C 2FJ7D 3C1CC 4E44A 1TAFB 4HGAC 1P34C 3MGSD 3AZEA 5KDMA 4Z66C 5CP6A 3X1SD 3AYWB 3KXBC 1P3OC 4ZUXA 3F6TA 5CPKB 1KX4D 4H9NA 3LZ0C 1M1AB 5DNNA 1EQZA 3REKD 3V9RA 3W97A 3AZFC 5AV5A 4XUJD 1EQZD 5CPJA 5AVCC 4J8UB 3KWQC 4KGCC 3WA9C 3LJAB 3B6FA 1JFIA 2NZDB 5B1LA 3NQUA 4CAYA 1M19A 3W99D 3AZJA 4H9RB 5GT3D 3MVDB 3AZLA 3MNNA 4QLCC 5B32D 4YS3A 3O62B 1ZLAA 2Y2KA 5C3IC 2NQBA 4WU9D 1P3LA 3VH6T 3W98C 3LZ1C 5B1MA 3UT9C 3AZKB 3W97B 3X1VC 3AZIA 5B33D 5AV6A 1P3ID 1M18A 4J8VD 3LELA 1P3GD 2F8NH 3EPLA 5CPID 4J8XB 1A7WA 5CHLB 4H9QA 1P34A 2ZY4A 4XZQD 3MNNB 4Z66A 1TZYB 3H0RC 2YFVB 2PYOB 4JJNB 5JA4A 3KXBA 1P3OA 1S32D 4R8PC 2BYKB 2JSSA 3NQJA 3LZ0A 3X1TB 1Z2CB 5BNVB 4Z5TC 3AN2D 3UTBC 2HIOB 5BO0A 3AYWC 5AVCA 4WU9B 3B6GD 1H3OB 5GXQD 5CPKC 3WA9A 5BNXB 4KGCA 1M1AC 2Y2MA 3REIB 4YM6B 3C1CB 3MGQD 3C1BB 1N1JA 4J8UC 1AOID 4Z2MH 4QLCA 1U35B 5JRGD 3VH5T 5B31G 2NZDC 5GSUC 5JA4B 3WAAB 2AROC 3AZND 1P3FD 3NQJB 3LZ1A 4NFTA 1HQ3D 5B0YA 3MVDC 2DF4C 5B2JC 3UTAA 4NE6A 1KX3B 3B0CW 3AZFB 5BO0B 5AVBD 5AY8C 4E45A 4H9OA 3O62C 3MGPD 3KWQB 4KUDD 1BH9B 2F8NG 5AV9B 5BS7C 2Y2LA 3AZKC 5B0ZD 3W96C 3AL0C 1N1JB 2FJ7C 4QLCB 3B0DC 3H0MC 1BH8B 2Y2GA 5B31B 4X23B 4R8PA 3MGRD 2IO5B 5B2ID 1TAFA 4J8XC 4H9PB 3W98B 1KX5D 3UT9B 3UTBA 1TZYC 1ID3D 2W8SA 2PYOC 3X1VB 3AV2B 4JJNC 3AZMB 3AYWA 1F66B 4DRAA 3AZGD 5B24D 3REHB 5CPKA 2CV5D 3EG5B 1M1AA 3X1TC 5B40D 1P3BC 2HIOC 4Z2MG 5GT0D 4J8UA 1P3PC 3X1UC 3AZHB 2NZDA 5GSUA 3LJAD 3REJD 4R8PB 4UPKA 3C1BC 2ZM5A 4Z5TB 4H9RA 3MVDA 5B2JA 3UTBB 1U35C 3AZED 2J8PA 5CP6D 3O62A 3AV1B 3WAAC 5BS7A 4ZUXD 4J8WB 3TU4C 1KX3C 5DNMB 3AZKA 5DNND 5AV8B 3W97D 5AV5D 5F99B 5CPJD 5AV9C 5GSUB 1P3KB 3B6FD 2AROB 5B1LD 4J8XA 5BT1D 3KUYB 1M19D 1P3AB 5B2JB 2JCHA 1TZYA 3AZJD 2YFVA 2PYOA 2XD1A 4JJNA 3AZLD 4WNNB 5AY8B 2L5AA 5B31C 2RVQC 3MNND 1WWIA 3WTPC 3AN2C 4YS3D 4X23C 2BYKA 2IO5C 3X1TA 1ZLAD 5BNVA 2NQBD 5E5AC 1P3LD 3A6NB 1P3BA 3W96B 2HIOA 3AZMC 5B1MD 3AV2C 1F66C 2FJ7B 1H3OA 1P3PA 3REHC 5BNXA 3AZID 3B0DB 1P3MC 2Y2HA 3MGSB 5AV6D 1M18D 2YFWB 2ZY3A 3REIA 5B32G 4YM6A 3X1SB 3LELD 5JRGC 3C1CA 3REID 3C1BA 3EPJA 1P34D 1U35A 4WV4B 3AZHC 4Z66D 2Y2IA 4LD9C 3REKB 3WAAA 4WZSB 3KXBD 1P3OD 1KX3A 3LZ0D 4KHAA 1P3BB 3AZFA 1ULYA 3EPHA 3KWQA 3AV1C 1BH9A 1P3PB 3X1UB 3WKJC 3W99B 5AV9A 5AVCD 4J8WC 4KGCD 3WA9D 5GT3B 5DNMC 1HTAA 5B32B 1KU5A 4AWLB 5AV8C 3AFAC 4DQYB 5F99C 2Y2NA
chains in the Genus database with same CATH topology
1BH8A 4QLCD 5B31A 1P3KC 3WTPA 2BYMB 3A1IA 4X23A 3P5JB 4H9PA 3KUYC 4WU8C 3W98A 1P3AC 3TU4B 5B24C 5E5AA 4J8VB 3UT9A 4KHAB 3EPKA 3LZ1D 3X1VA 1P3GB 5B0YD 3AZMA 3RELC 3AV2A 3UTAD 1F66A 2VQRA 4EO5B 3X1VD 5CPIB 3REHA 1P3MA 3B0CT 4UUZB 4M6BA 1B6WA 4XZQB 4CSRB 2F8NA 3A6NC 3H0LC 3FDDA 3MGSC 3AZHA 3AN2B 3WTPB 3X1SC 3IP4C 5GXQB 4Z5TA 4R8PD 5E5AB 1KX4C 4Z5TD 3VH6A 3UTBD 4NE3A 3AV1A 3MGQB 3REKC 3WKJA 3AYWD 4J8WA 4XUJC 1P3MB 1EQZC 2F8NB 5CPKD 1AOIB 5JRGB 5DNMA 1M1AD 5AV8A 3AFAA 1Q9CA 3AZNB 5F99A 1P3FB 3W99C 4J8UD 5GT3C 1HQ3B 1P3KA 4LD9B 2NZDD 5B32C 2AROA 5GSUD 5AVBB 3KUYA 4KUDB 4AWLC 1P3AA 5G49B 4WU9C 3MVDD 3RELA 5B2JD 4WNNA 5AY8A 4DRBA 3WKJB 5AY8D 3O62D 5B33C 1P3IC 4J8VC 3A6NA 1P3GC 3W96A 5AV6C 2Y2JA 3AZKD 2FJ7A 4EO5C 3AFAB 5CPIC 3MGRB 5B2IB 1BFMA 5FUGA 3MGSA 4XZQC 2YFWA 1KX5B 2HUEC 3X1SA 1ID3B 3VH5A 4WU8B 3AZGB 1S32C 4J8XD 5B24B 2CV5B 1KX4A 2UWXA 4H9SC 3RELB 2RIQA 1TZYD 5B40B 2PYOD 3REKA 4JJND 3A1KA 4XUJA 3B6GC 5GT0B 5GXQC 2JE5A 3X1TD 2Y2PA 3REJB 1P3BD 3MGQC 2HIOD 3R45B 3X1UA 2F2AC 3W99A 5FUGB 1P3PD 2Y2QA 5GT3A 3X1UD 1AOIC 3AZEB 5B32A 5KDMB 4YM6D 5CP6B 4NE5A 3C1CD 2G5IC 4ZBJC 3VH6W 3C1BD 3AZNC 1KX4B 1P3FC 4ZUXB 4WU9A 4H9NB 1HQ3C 1U35D 2CWEA 2BYMA 1B67A 5DNNB 5B0YC 5AVBC 4XUJB 1EQZB 3UTAC 2FFFB 3V9RB 5B33A 3MGPC 4KUDC 3WAAD 3TU4A 1P3IA 5AV5B 4J8VA 5CPJB 1P3GA 3TU4D 2LY8A 1KX3D 3B6FB 2G5HC 1JFIB 3AZFD 5B1LB 5B0ZC 5CPIA 3NQUB 4CAYB 4UUZA 3KWQD 4XZQA 1M19B 4CSRA 3B0BA 5AV9D 3AZJB 2ZY2A 3AZLB 1S32A 4YS3B 3MGRC 5B2IC 4H9SA 2DQNC 1ZLAB 2NQBB 3AN2A 1KX5C 1P3LB 2XD5A 1ID3C 5B31D 2RVQD 5B1MB 3WTPD 5B33B 3AZGC 3B6GA 4X23D 5GXQA 1P3IB 2CV5C 4G92B 3AZIB 3W98D 5AV6B 1M18B 1WWSA 4G91B 5E5AD 3UT9D 5B40C 3LELB 3MGQA 3AV2D 3AZMD 1F66D 2F8NK 3VH5W 3REHD 5GT0C 1AOIA 4HGAB 2HUEB 4H9QB 1P34B 1P3MD 2F8ND 5JRGA 4Z66B 2BG1A 3LJAC 1S32B 3REJC 3AZNA 3KXBB 1P3FA 1P3OB 1HQ3A 4LD9A 3LZ0B 3AZEC 3AZHD 5AVBA 4LD9D 5CP6C 3B6GB 4KUDA 3MGPA 5AVCB 5G49A 1F1EA 4ZUXC 4KGCB 3WA9B 1W2EA 5B0ZA 5DNNC 4WJ3C 3AV1D 2ZY5A 3W97C 3WKJD 1R4VA 5AV5C 4J8WD 5CPJC 1T3UA 5DNMD 3B6FC 4ZBJB 5B1LC 3MGRA 5B2IA 5BT1C 5AV8D 1M19C 3AFAD 5F99D 2Y2OA 5C3IB 1KX5A 3AZJC 1ID3A 3LZ1B 1P3KD 5B0YB 3AZLC 3MNNC 3UTAB 4WU8A 3MGPB 3AZGA 2AROD 5B24A 3KSYA 4YS3C 1PZRA 2CV5A 3KUYD 4H9OB 4WU8D 1P3AD 1ZLAC 2NQBC 5B40A 1P3LC 5B0ZB 3RELD 5B1MC 3WTPE 5GT0A 4G92C 3AZIC 1M18C 4G91C 3LJAA 3KFUG 3A6ND 3REJA 3LELC 3W96D 3R45A 3REIC 4YM6C 2FJ7D 3C1CC 4E44A 1TAFB 4HGAC 1P34C 3MGSD 3AZEA 5KDMA 4Z66C 5CP6A 3X1SD 3AYWB 3KXBC 1P3OC 4ZUXA 3F6TA 5CPKB 1KX4D 4H9NA 3LZ0C 1M1AB 5DNNA 1EQZA 3REKD 3V9RA 3W97A 3AZFC 5AV5A 4XUJD 1EQZD 5CPJA 5AVCC 4J8UB 3KWQC 4KGCC 3WA9C 3LJAB 3B6FA 1JFIA 2NZDB 5B1LA 3NQUA 4CAYA 1M19A 3W99D 3AZJA 4H9RB 5GT3D 3MVDB 3AZLA 3MNNA 4QLCC 5B32D 4YS3A 3O62B 1ZLAA 2Y2KA 5C3IC 2NQBA 4WU9D 1P3LA 3VH6T 3W98C 3LZ1C 5B1MA 3UT9C 3AZKB 3W97B 3X1VC 3AZIA 5B33D 5AV6A 1P3ID 1M18A 4J8VD 3LELA 1P3GD 2F8NH 3EPLA 5CPID 4J8XB 1A7WA 5CHLB 4H9QA 1P34A 2ZY4A 4XZQD 3MNNB 4Z66A 1TZYB 3H0RC 2YFVB 2PYOB 4JJNB 5JA4A 3KXBA 1P3OA 1S32D 4R8PC 2BYKB 2JSSA 3NQJA 3LZ0A 3X1TB 1Z2CB 5BNVB 4Z5TC 3AN2D 3UTBC 2HIOB 5BO0A 3AYWC 5AVCA 4WU9B 3B6GD 1H3OB 5GXQD 5CPKC 3WA9A 5BNXB 4KGCA 1M1AC 2Y2MA 3REIB 4YM6B 3C1CB 3MGQD 3C1BB 1N1JA 4J8UC 1AOID 4Z2MH 4QLCA 1U35B 5JRGD 3VH5T 5B31G 2NZDC 5GSUC 5JA4B 3WAAB 2AROC 3AZND 1P3FD 3NQJB 3LZ1A 4NFTA 1HQ3D 5B0YA 3MVDC 2DF4C 5B2JC 3UTAA 4NE6A 1KX3B 3B0CW 3AZFB 5BO0B 5AVBD 5AY8C 4E45A 4H9OA 3O62C 3MGPD 3KWQB 4KUDD 1BH9B 2F8NG 5AV9B 5BS7C 2Y2LA 3AZKC 5B0ZD 3W96C 3AL0C 1N1JB 2FJ7C 4QLCB 3B0DC 3H0MC 1BH8B 2Y2GA 5B31B 4X23B 4R8PA 3MGRD 2IO5B 5B2ID 1TAFA 4J8XC 4H9PB 3W98B 1KX5D 3UT9B 3UTBA 1TZYC 1ID3D 2W8SA 2PYOC 3X1VB 3AV2B 4JJNC 3AZMB 3AYWA 1F66B 4DRAA 3AZGD 5B24D 3REHB 5CPKA 2CV5D 3EG5B 1M1AA 3X1TC 5B40D 1P3BC 2HIOC 4Z2MG 5GT0D 4J8UA 1P3PC 3X1UC 3AZHB 2NZDA 5GSUA 3LJAD 3REJD 4R8PB 4UPKA 3C1BC 2ZM5A 4Z5TB 4H9RA 3MVDA 5B2JA 3UTBB 1U35C 3AZED 2J8PA 5CP6D 3O62A 3AV1B 3WAAC 5BS7A 4ZUXD 4J8WB 3TU4C 1KX3C 5DNMB 3AZKA 5DNND 5AV8B 3W97D 5AV5D 5F99B 5CPJD 5AV9C 5GSUB 1P3KB 3B6FD 2AROB 5B1LD 4J8XA 5BT1D 3KUYB 1M19D 1P3AB 5B2JB 2JCHA 1TZYA 3AZJD 2YFVA 2PYOA 2XD1A 4JJNA 3AZLD 4WNNB 5AY8B 2L5AA 5B31C 2RVQC 3MNND 1WWIA 3WTPC 3AN2C 4YS3D 4X23C 2BYKA 2IO5C 3X1TA 1ZLAD 5BNVA 2NQBD 5E5AC 1P3LD 3A6NB 1P3BA 3W96B 2HIOA 3AZMC 5B1MD 3AV2C 1F66C 2FJ7B 1H3OA 1P3PA 3REHC 5BNXA 3AZID 3B0DB 1P3MC 2Y2HA 3MGSB 5AV6D 1M18D 2YFWB 2ZY3A 3REIA 5B32G 4YM6A 3X1SB 3LELD 5JRGC 3C1CA 3REID 3C1BA 3EPJA 1P34D 1U35A 4WV4B 3AZHC 4Z66D 2Y2IA 4LD9C 3REKB 3WAAA 4WZSB 3KXBD 1P3OD 1KX3A 3LZ0D 4KHAA 1P3BB 3AZFA 1ULYA 3EPHA 3KWQA 3AV1C 1BH9A 1P3PB 3X1UB 3WKJC 3W99B 5AV9A 5AVCD 4J8WC 4KGCD 3WA9D 5GT3B 5DNMC 1HTAA 5B32B 1KU5A 4AWLB 5AV8C 3AFAC 4DQYB 5F99C 2Y2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 A;  4QLC D;  5B31 A;  1P3K C;  3WTP A;  2BYM B;  4X23 A;  4H9P A;  3KUY C;  4WU8 C;  3W98 A;  1P3A C;  3TU4 B;  5B24 C;  5E5A A;  4J8V B;  3UT9 A;  4KHA B;  3LZ1 D;  3X1V A;  1P3G B;  5B0Y D;  3AZM A;  3REL C;  3AV2 A;  3UTA D;  1F66 A;  4EO5 B;  3X1V D;  5CPI B;  3REH A;  1P3M A;  3B0C T;  4UUZ B;  4M6B A;  1B6W A;  4XZQ B;  4CSR B;  2F8N A;  3A6N C;  3MGS C;  3AZH A;  3AN2 B;  3WTP B;  3X1S C;  5GXQ B;  4Z5T A;  4R8P D;  5E5A B;  1KX4 C;  4Z5T D;  3VH6 A;  3UTB D;  4NE3 A;  3AV1 A;  3MGQ B;  3REK C;  3WKJ A;  3AYW D;  4J8W A;  4XUJ C;  1P3M B;  1EQZ C;  2F8N B;  5CPK D;  1AOI B;  5JRG B;  5DNM A;  1M1A D;  5AV8 A;  3AFA A;  1Q9C A;  3AZN B;  5F99 A;  1P3F B;  3W99 C;  4J8U D;  5GT3 C;  1HQ3 B;  1P3K A;  4LD9 B;  2NZD D;  5B32 C;  2ARO A;  5GSU D;  5AVB B;  3KUY A;  4KUD B;  4AWL C;  1P3A A;  5G49 B;  4WU9 C;  3MVD D;  3REL A;  5B2J D;  4WNN A;  5AY8 A;  4DRB A;  3WKJ B;  5AY8 D;  3O62 D;  5B33 C;  1P3I C;  4J8V C;  3A6N A;  1P3G C;  3W96 A;  5AV6 C;  3AZK D;  2FJ7 A;  4EO5 C;  3AFA B;  5CPI C;  3MGR B;  5B2I B;  1BFM A;  5FUG A;  3MGS A;  4XZQ C;  2YFW A;  1KX5 B;  2HUE C;  3X1S A;  1ID3 B;  3VH5 A;  4WU8 B;  3AZG B;  1S32 C;  4J8X D;  5B24 B;  2CV5 B;  1KX4 A;  4H9S C;  3REL B;  1TZY D;  5B40 B;  2PYO D;  3REK A;  4JJN D;  4XUJ A;  3B6G C;  5GT0 B;  5GXQ C;  3X1T D;  3REJ B;  1P3B D;  3MGQ C;  2HIO D;  3R45 B;  3X1U A;  3W99 A;  5FUG B;  1P3P D;  5GT3 A;  3X1U D;  1AOI C;  3AZE B;  5B32 A;  5KDM B;  4YM6 D;  5CP6 B;  4NE5 A;  3C1C D;  4ZBJ C;  3VH6 W;  3C1B D;  3AZN C;  1KX4 B;  1P3F C;  4ZUX B;  4WU9 A;  4H9N B;  1HQ3 C;  1U35 D;  2CWE A;  2BYM A;  1B67 A;  5DNN B;  5B0Y C;  5AVB C;  4XUJ B;  1EQZ B;  3UTA C;  5B33 A;  3V9R B;  4KUD C;  3MGP C;  3WAA D;  3TU4 A;  1P3I A;  5AV5 B;  4J8V A;  5CPJ B;  1P3G A;  3TU4 D;  2LY8 A;  1KX3 D;  3B6F B;  1JFI B;  3AZF D;  5B1L B;  5B0Z C;  5CPI A;  3NQU B;  4CAY B;  4UUZ A;  3KWQ D;  4XZQ A;  1M19 B;  4CSR A;  3B0B A;  5AV9 D;  3AZJ B;  3AZL B;  1S32 A;  4YS3 B;  3MGR C;  5B2I C;  4H9S A;  1ZLA B;  2NQB B;  3AN2 A;  1KX5 C;  1P3L B;  1ID3 C;  5B31 D;  2RVQ D;  5B1M B;  3WTP D;  5B33 B;  3AZG C;  3B6G A;  4X23 D;  5GXQ A;  1P3I B;  2CV5 C;  4G92 B;  3AZI B;  3W98 D;  5AV6 B;  1M18 B;  1WWS A;  4G91 B;  5E5A D;  3UT9 D;  5B40 C;  3LEL B;  3MGQ A;  3AV2 D;  3AZM D;  1F66 D;  2F8N K;  3VH5 W;  3REH D;  5GT0 C;  1AOI A;  4HGA B;  2HUE B;  4H9Q B;  1P34 B;  1P3M D;  2F8N D;  5JRG A;  4Z66 B;  3LJA C;  1S32 B;  3REJ C;  3AZN A;  3KXB B;  1P3F A;  1P3O B;  1HQ3 A;  4LD9 A;  3LZ0 B;  3AZE C;  3AZH D;  5AVB A;  4LD9 D;  5CP6 C;  3B6G B;  4KUD A;  3MGP A;  5AVC B;  5G49 A;  1F1E A;  4ZUX C;  4KGC B;  3WA9 B;  5B0Z A;  5DNN C;  3AV1 D;  3W97 C;  3WKJ D;  1R4V A;  5AV5 C;  4J8W D;  5CPJ C;  5DNM D;  3B6F C;  4ZBJ B;  5B1L C;  3MGR A;  5B2I A;  5BT1 C;  5AV8 D;  1M19 C;  3AFA D;  5F99 D;  5C3I B;  1KX5 A;  3AZJ C;  1ID3 A;  3LZ1 B;  1P3K D;  5B0Y B;  3AZL C;  3MNN C;  3UTA B;  4WU8 A;  3MGP B;  3AZG A;  2ARO D;  5B24 A;  3KSY A;  4YS3 C;  2CV5 A;  3KUY D;  4H9O B;  4WU8 D;  1P3A D;  1ZLA C;  2NQB C;  5B40 A;  1P3L C;  5B0Z B;  3REL D;  5B1M C;  3WTP E;  5GT0 A;  4G92 C;  3AZI C;  1M18 C;  4G91 C;  3LJA A;  3A6N D;  3REJ A;  3LEL C;  3W96 D;  3R45 A;  3REI C;  4YM6 C;  2FJ7 D;  3C1C C;  4E44 A;  1TAF B;  4HGA C;  1P34 C;  3MGS D;  3AZE A;  5KDM A;  4Z66 C;  5CP6 A;  3X1S D;  3AYW B;  3KXB C;  1P3O C;  4ZUX A;  5CPK B;  1KX4 D;  4H9N A;  3LZ0 C;  1M1A B;  5DNN A;  1EQZ A;  3REK D;  3V9R A;  3W97 A;  3AZF C;  5AV5 A;  4XUJ D;  1EQZ D;  5CPJ A;  5AVC C;  4J8U B;  3KWQ C;  4KGC C;  3WA9 C;  3LJA B;  3B6F A;  1JFI A;  2NZD B;  5B1L A;  3NQU A;  4CAY A;  1M19 A;  3W99 D;  3AZJ A;  4H9R B;  5GT3 D;  3MVD B;  3AZL A;  3MNN A;  4QLC C;  5B32 D;  4YS3 A;  3O62 B;  1ZLA A;  5C3I C;  2NQB A;  4WU9 D;  1P3L A;  3VH6 T;  3W98 C;  3LZ1 C;  5B1M A;  3UT9 C;  3AZK B;  3W97 B;  3X1V C;  3AZI A;  5B33 D;  5AV6 A;  1P3I D;  1M18 A;  4J8V D;  3LEL A;  1P3G D;  2F8N H;  5CPI D;  4J8X B;  1A7W A;  5CHL B;  4H9Q A;  1P34 A;  4XZQ D;  3MNN B;  4Z66 A;  1TZY B;  2YFV B;  2PYO B;  4JJN B;  5JA4 A;  3KXB A;  1P3O A;  1S32 D;  4R8P C;  2BYK B;  2JSS A;  3NQJ A;  3LZ0 A;  3X1T B;  5BNV B;  4Z5T C;  3AN2 D;  3UTB C;  2HIO B;  5BO0 A;  3AYW C;  5AVC A;  3B6G D;  1H3O B;  5GXQ D;  5CPK C;  3WA9 A;  5BNX B;  4KGC A;  1M1A C;  3REI B;  4YM6 B;  3C1C B;  3MGQ D;  3C1B B;  1N1J A;  4J8U C;  1AOI D;  4Z2M H;  4QLC A;  1U35 B;  5JRG D;  3VH5 T;  5B31 G;  2NZD C;  5GSU C;  5JA4 B;  3WAA B;  2ARO C;  3AZN D;  1P3F D;  3NQJ B;  3LZ1 A;  4NFT A;  1HQ3 D;  5B0Y A;  3MVD C;  5B2J C;  3UTA A;  1KX3 B;  4NE6 A;  3B0C W;  3AZF B;  5BO0 B;  5AVB D;  5AY8 C;  4E45 A;  4H9O A;  3O62 C;  3MGP D;  3KWQ B;  4KUD D;  1BH9 B;  2F8N G;  5AV9 B;  5BS7 C;  3AZK C;  5B0Z D;  3W96 C;  1N1J B;  2FJ7 C;  4QLC B;  3B0D C;  1BH8 B;  5B31 B;  4X23 B;  4R8P A;  3MGR D;  2IO5 B;  5B2I D;  1TAF A;  4J8X C;  4H9P B;  3W98 B;  1KX5 D;  3UT9 B;  3UTB A;  1TZY C;  1ID3 D;  2PYO C;  3X1V B;  3AV2 B;  4JJN C;  3AZM B;  3AYW A;  1F66 B;  4DRA A;  3AZG D;  5B24 D;  3REH B;  5CPK A;  2CV5 D;  1M1A A;  3X1T C;  5B40 D;  1P3B C;  2HIO C;  4Z2M G;  5GT0 D;  4J8U A;  1P3P C;  3X1U C;  3AZH B;  2NZD A;  5GSU A;  3LJA D;  3REJ D;  4R8P B;  3C1B C;  4Z5T B;  4H9R A;  3MVD A;  5B2J A;  3UTB B;  1U35 C;  3AZE D;  5CP6 D;  3O62 A;  3AV1 B;  3WAA C;  5BS7 A;  4ZUX D;  4J8W B;  3TU4 C;  1KX3 C;  5DNM B;  3AZK A;  5DNN D;  5AV8 B;  3W97 D;  5AV5 D;  5F99 B;  5CPJ D;  5AV9 C;  5GSU B;  1P3K B;  3B6F D;  2ARO B;  5B1L D;  4J8X A;  5BT1 D;  3KUY B;  1M19 D;  1P3A B;  5B2J B;  1TZY A;  3AZJ D;  2YFV A;  2PYO A;  3AZL D;  4JJN A;  4WNN B;  2L5A A;  5AY8 B;  5B31 C;  2RVQ C;  3MNN D;  1WWI A;  3WTP C;  3AN2 C;  4YS3 D;  4X23 C;  2BYK A;  2IO5 C;  3X1T A;  1ZLA D;  5BNV A;  2NQB D;  5E5A C;  1P3L D;  3A6N B;  1P3B A;  3W96 B;  2HIO A;  3AZM C;  5B1M D;  3AV2 C;  1F66 C;  2FJ7 B;  1H3O A;  1P3P A;  3REH C;  5BNX A;  3AZI D;  3B0D B;  1P3M C;  3MGS B;  5AV6 D;  1M18 D;  2YFW B;  3REI A;  5B32 G;  4YM6 A;  3X1S B;  3LEL D;  5JRG C;  3C1C A;  3REI D;  3C1B A;  1P34 D;  1U35 A;  4WV4 B;  3AZH C;  4Z66 D;  4LD9 C;  3REK B;  3WAA A;  4WZS B;  3KXB D;  1P3O D;  1KX3 A;  3LZ0 D;  4KHA A;  1P3B B;  3AZF A;  1ULY A;  3KWQ A;  3AV1 C;  1BH9 A;  1P3P B;  3X1U B;  3WKJ C;  3W99 B;  5AV9 A;  5AVC D;  4J8W C;  4KGC D;  3WA9 D;  5GT3 B;  5DNM C;  1HTA A;  5B32 B;  1KU5 A;  4AWL B;  5AV8 C;  3AFA C;  5F99 C;  4WU9 B; 
#chains in the Genus database with same CATH topology
 1BH8 A;  4QLC D;  5B31 A;  1P3K C;  3WTP A;  2BYM B;  3A1I A;  4X23 A;  3P5J B;  4H9P A;  3KUY C;  4WU8 C;  3W98 A;  1P3A C;  3TU4 B;  5B24 C;  5E5A A;  4J8V B;  3UT9 A;  4KHA B;  3EPK A;  3LZ1 D;  3X1V A;  1P3G B;  5B0Y D;  3AZM A;  3REL C;  3AV2 A;  3UTA D;  1F66 A;  2VQR A;  4EO5 B;  3X1V D;  5CPI B;  3REH A;  1P3M A;  3B0C T;  4UUZ B;  4M6B A;  1B6W A;  4XZQ B;  4CSR B;  2F8N A;  3A6N C;  3H0L C;  3FDD A;  3MGS C;  3AZH A;  3AN2 B;  3WTP B;  3X1S C;  3IP4 C;  5GXQ B;  4Z5T A;  4R8P D;  5E5A B;  1KX4 C;  4Z5T D;  3VH6 A;  3UTB D;  4NE3 A;  3AV1 A;  3MGQ B;  3REK C;  3WKJ A;  3AYW D;  4J8W A;  4XUJ C;  1P3M B;  1EQZ C;  2F8N B;  5CPK D;  1AOI B;  5JRG B;  5DNM A;  1M1A D;  5AV8 A;  3AFA A;  1Q9C A;  3AZN B;  5F99 A;  1P3F B;  3W99 C;  4J8U D;  5GT3 C;  1HQ3 B;  1P3K A;  4LD9 B;  2NZD D;  5B32 C;  2ARO A;  5GSU D;  5AVB B;  3KUY A;  4KUD B;  4AWL C;  1P3A A;  5G49 B;  4WU9 C;  3MVD D;  3REL A;  5B2J D;  4WNN A;  5AY8 A;  4DRB A;  3WKJ B;  5AY8 D;  3O62 D;  5B33 C;  1P3I C;  4J8V C;  3A6N A;  1P3G C;  3W96 A;  5AV6 C;  2Y2J A;  3AZK D;  2FJ7 A;  4EO5 C;  3AFA B;  5CPI C;  3MGR B;  5B2I B;  1BFM A;  5FUG A;  3MGS A;  4XZQ C;  2YFW A;  1KX5 B;  2HUE C;  3X1S A;  1ID3 B;  3VH5 A;  4WU8 B;  3AZG B;  1S32 C;  4J8X D;  5B24 B;  2CV5 B;  1KX4 A;  2UWX A;  4H9S C;  3REL B;  2RIQ A;  1TZY D;  5B40 B;  2PYO D;  3REK A;  4JJN D;  3A1K A;  4XUJ A;  3B6G C;  5GT0 B;  5GXQ C;  2JE5 A;  3X1T D;  2Y2P A;  3REJ B;  1P3B D;  3MGQ C;  2HIO D;  3R45 B;  3X1U A;  2F2A C;  3W99 A;  5FUG B;  1P3P D;  2Y2Q A;  5GT3 A;  3X1U D;  1AOI C;  3AZE B;  5B32 A;  5KDM B;  4YM6 D;  5CP6 B;  4NE5 A;  3C1C D;  2G5I C;  4ZBJ C;  3VH6 W;  3C1B D;  3AZN C;  1KX4 B;  1P3F C;  4ZUX B;  4WU9 A;  4H9N B;  1HQ3 C;  1U35 D;  2CWE A;  2BYM A;  1B67 A;  5DNN B;  5B0Y C;  5AVB C;  4XUJ B;  1EQZ B;  3UTA C;  2FFF B;  3V9R B;  5B33 A;  3MGP C;  4KUD C;  3WAA D;  3TU4 A;  1P3I A;  5AV5 B;  4J8V A;  5CPJ B;  1P3G A;  3TU4 D;  2LY8 A;  1KX3 D;  3B6F B;  2G5H C;  1JFI B;  3AZF D;  5B1L B;  5B0Z C;  5CPI A;  3NQU B;  4CAY B;  4UUZ A;  3KWQ D;  4XZQ A;  1M19 B;  4CSR A;  3B0B A;  5AV9 D;  3AZJ B;  2ZY2 A;  3AZL B;  1S32 A;  4YS3 B;  3MGR C;  5B2I C;  4H9S A;  2DQN C;  1ZLA B;  2NQB B;  3AN2 A;  1KX5 C;  1P3L B;  2XD5 A;  1ID3 C;  5B31 D;  2RVQ D;  5B1M B;  3WTP D;  5B33 B;  3AZG C;  3B6G A;  4X23 D;  5GXQ A;  1P3I B;  2CV5 C;  4G92 B;  3AZI B;  3W98 D;  5AV6 B;  1M18 B;  1WWS A;  4G91 B;  5E5A D;  3UT9 D;  5B40 C;  3LEL B;  3MGQ A;  3AV2 D;  3AZM D;  1F66 D;  2F8N K;  3VH5 W;  3REH D;  5GT0 C;  1AOI A;  4HGA B;  2HUE B;  4H9Q B;  1P34 B;  1P3M D;  2F8N D;  5JRG A;  4Z66 B;  2BG1 A;  3LJA C;  1S32 B;  3REJ C;  3AZN A;  3KXB B;  1P3F A;  1P3O B;  1HQ3 A;  4LD9 A;  3LZ0 B;  3AZE C;  3AZH D;  5AVB A;  4LD9 D;  5CP6 C;  3B6G B;  4KUD A;  3MGP A;  5AVC B;  5G49 A;  1F1E A;  4ZUX C;  4KGC B;  3WA9 B;  1W2E A;  5B0Z A;  5DNN C;  4WJ3 C;  3AV1 D;  2ZY5 A;  3W97 C;  3WKJ D;  1R4V A;  5AV5 C;  4J8W D;  5CPJ C;  1T3U A;  5DNM D;  3B6F C;  4ZBJ B;  5B1L C;  3MGR A;  5B2I A;  5BT1 C;  5AV8 D;  1M19 C;  3AFA D;  5F99 D;  2Y2O A;  5C3I B;  1KX5 A;  3AZJ C;  1ID3 A;  3LZ1 B;  1P3K D;  5B0Y B;  3AZL C;  3MNN C;  3UTA B;  4WU8 A;  3MGP B;  3AZG A;  2ARO D;  5B24 A;  3KSY A;  4YS3 C;  1PZR A;  2CV5 A;  3KUY D;  4H9O B;  4WU8 D;  1P3A D;  1ZLA C;  2NQB C;  5B40 A;  1P3L C;  5B0Z B;  3REL D;  5B1M C;  3WTP E;  5GT0 A;  4G92 C;  3AZI C;  1M18 C;  4G91 C;  3LJA A;  3KFU G;  3A6N D;  3REJ A;  3LEL C;  3W96 D;  3R45 A;  3REI C;  4YM6 C;  2FJ7 D;  3C1C C;  4E44 A;  1TAF B;  4HGA C;  1P34 C;  3MGS D;  3AZE A;  5KDM A;  4Z66 C;  5CP6 A;  3X1S D;  3AYW B;  3KXB C;  1P3O C;  4ZUX A;  3F6T A;  5CPK B;  1KX4 D;  4H9N A;  3LZ0 C;  1M1A B;  5DNN A;  1EQZ A;  3REK D;  3V9R A;  3W97 A;  3AZF C;  5AV5 A;  4XUJ D;  1EQZ D;  5CPJ A;  5AVC C;  4J8U B;  3KWQ C;  4KGC C;  3WA9 C;  3LJA B;  3B6F A;  1JFI A;  2NZD B;  5B1L A;  3NQU A;  4CAY A;  1M19 A;  3W99 D;  3AZJ A;  4H9R B;  5GT3 D;  3MVD B;  3AZL A;  3MNN A;  4QLC C;  5B32 D;  4YS3 A;  3O62 B;  1ZLA A;  2Y2K A;  5C3I C;  2NQB A;  4WU9 D;  1P3L A;  3VH6 T;  3W98 C;  3LZ1 C;  5B1M A;  3UT9 C;  3AZK B;  3W97 B;  3X1V C;  3AZI A;  5B33 D;  5AV6 A;  1P3I D;  1M18 A;  4J8V D;  3LEL A;  1P3G D;  2F8N H;  3EPL A;  5CPI D;  4J8X B;  1A7W A;  5CHL B;  4H9Q A;  1P34 A;  2ZY4 A;  4XZQ D;  3MNN B;  4Z66 A;  1TZY B;  3H0R C;  2YFV B;  2PYO B;  4JJN B;  5JA4 A;  3KXB A;  1P3O A;  1S32 D;  4R8P C;  2BYK B;  2JSS A;  3NQJ A;  3LZ0 A;  3X1T B;  1Z2C B;  5BNV B;  4Z5T C;  3AN2 D;  3UTB C;  2HIO B;  5BO0 A;  3AYW C;  5AVC A;  4WU9 B;  3B6G D;  1H3O B;  5GXQ D;  5CPK C;  3WA9 A;  5BNX B;  4KGC A;  1M1A C;  2Y2M A;  3REI B;  4YM6 B;  3C1C B;  3MGQ D;  3C1B B;  1N1J A;  4J8U C;  1AOI D;  4Z2M H;  4QLC A;  1U35 B;  5JRG D;  3VH5 T;  5B31 G;  2NZD C;  5GSU C;  5JA4 B;  3WAA B;  2ARO C;  3AZN D;  1P3F D;  3NQJ B;  3LZ1 A;  4NFT A;  1HQ3 D;  5B0Y A;  3MVD C;  2DF4 C;  5B2J C;  3UTA A;  4NE6 A;  1KX3 B;  3B0C W;  3AZF B;  5BO0 B;  5AVB D;  5AY8 C;  4E45 A;  4H9O A;  3O62 C;  3MGP D;  3KWQ B;  4KUD D;  1BH9 B;  2F8N G;  5AV9 B;  5BS7 C;  2Y2L A;  3AZK C;  5B0Z D;  3W96 C;  3AL0 C;  1N1J B;  2FJ7 C;  4QLC B;  3B0D C;  3H0M C;  1BH8 B;  2Y2G A;  5B31 B;  4X23 B;  4R8P A;  3MGR D;  2IO5 B;  5B2I D;  1TAF A;  4J8X C;  4H9P B;  3W98 B;  1KX5 D;  3UT9 B;  3UTB A;  1TZY C;  1ID3 D;  2W8S A;  2PYO C;  3X1V B;  3AV2 B;  4JJN C;  3AZM B;  3AYW A;  1F66 B;  4DRA A;  3AZG D;  5B24 D;  3REH B;  5CPK A;  2CV5 D;  3EG5 B;  1M1A A;  3X1T C;  5B40 D;  1P3B C;  2HIO C;  4Z2M G;  5GT0 D;  4J8U A;  1P3P C;  3X1U C;  3AZH B;  2NZD A;  5GSU A;  3LJA D;  3REJ D;  4R8P B;  4UPK A;  3C1B C;  2ZM5 A;  4Z5T B;  4H9R A;  3MVD A;  5B2J A;  3UTB B;  1U35 C;  3AZE D;  2J8P A;  5CP6 D;  3O62 A;  3AV1 B;  3WAA C;  5BS7 A;  4ZUX D;  4J8W B;  3TU4 C;  1KX3 C;  5DNM B;  3AZK A;  5DNN D;  5AV8 B;  3W97 D;  5AV5 D;  5F99 B;  5CPJ D;  5AV9 C;  5GSU B;  1P3K B;  3B6F D;  2ARO B;  5B1L D;  4J8X A;  5BT1 D;  3KUY B;  1M19 D;  1P3A B;  5B2J B;  2JCH A;  1TZY A;  3AZJ D;  2YFV A;  2PYO A;  2XD1 A;  4JJN A;  3AZL D;  4WNN B;  5AY8 B;  2L5A A;  5B31 C;  2RVQ C;  3MNN D;  1WWI A;  3WTP C;  3AN2 C;  4YS3 D;  4X23 C;  2BYK A;  2IO5 C;  3X1T A;  1ZLA D;  5BNV A;  2NQB D;  5E5A C;  1P3L D;  3A6N B;  1P3B A;  3W96 B;  2HIO A;  3AZM C;  5B1M D;  3AV2 C;  1F66 C;  2FJ7 B;  1H3O A;  1P3P A;  3REH C;  5BNX A;  3AZI D;  3B0D B;  1P3M C;  2Y2H A;  3MGS B;  5AV6 D;  1M18 D;  2YFW B;  2ZY3 A;  3REI A;  5B32 G;  4YM6 A;  3X1S B;  3LEL D;  5JRG C;  3C1C A;  3REI D;  3C1B A;  3EPJ A;  1P34 D;  1U35 A;  4WV4 B;  3AZH C;  4Z66 D;  2Y2I A;  4LD9 C;  3REK B;  3WAA A;  4WZS B;  3KXB D;  1P3O D;  1KX3 A;  3LZ0 D;  4KHA A;  1P3B B;  3AZF A;  1ULY A;  3EPH A;  3KWQ A;  3AV1 C;  1BH9 A;  1P3P B;  3X1U B;  3WKJ C;  3W99 B;  5AV9 A;  5AVC D;  4J8W C;  4KGC D;  3WA9 D;  5GT3 B;  5DNM C;  1HTA A;  5B32 B;  1KU5 A;  4AWL B;  5AV8 C;  3AFA C;  4DQY B;  5F99 C;  2Y2N A; 
#chains in the Genus database with same CATH homology
 1BH8 A;  4QLC D;  5B31 A;  1P3K C;  3WTP A;  2BYM B;  3A1I A;  4X23 A;  3P5J B;  4H9P A;  3KUY C;  4WU8 C;  3W98 A;  1P3A C;  3TU4 B;  5B24 C;  5E5A A;  4J8V B;  3UT9 A;  4KHA B;  3EPK A;  3LZ1 D;  3X1V A;  1P3G B;  5B0Y D;  3AZM A;  3REL C;  3AV2 A;  3UTA D;  1F66 A;  2VQR A;  4EO5 B;  3X1V D;  5CPI B;  3REH A;  1P3M A;  3B0C T;  4UUZ B;  4M6B A;  1B6W A;  4XZQ B;  4CSR B;  2F8N A;  3A6N C;  3H0L C;  3FDD A;  3MGS C;  3AZH A;  3AN2 B;  3WTP B;  3X1S C;  3IP4 C;  5GXQ B;  4Z5T A;  4R8P D;  5E5A B;  1KX4 C;  4Z5T D;  3VH6 A;  3UTB D;  4NE3 A;  3AV1 A;  3MGQ B;  3REK C;  3WKJ A;  3AYW D;  4J8W A;  4XUJ C;  1P3M B;  1EQZ C;  2F8N B;  5CPK D;  1AOI B;  5JRG B;  5DNM A;  1M1A D;  5AV8 A;  3AFA A;  1Q9C A;  3AZN B;  5F99 A;  1P3F B;  3W99 C;  4J8U D;  5GT3 C;  1HQ3 B;  1P3K A;  4LD9 B;  2NZD D;  5B32 C;  2ARO A;  5GSU D;  5AVB B;  3KUY A;  4KUD B;  4AWL C;  1P3A A;  5G49 B;  4WU9 C;  3MVD D;  3REL A;  5B2J D;  4WNN A;  5AY8 A;  4DRB A;  3WKJ B;  5AY8 D;  3O62 D;  5B33 C;  1P3I C;  4J8V C;  3A6N A;  1P3G C;  3W96 A;  5AV6 C;  2Y2J A;  3AZK D;  2FJ7 A;  4EO5 C;  3AFA B;  5CPI C;  3MGR B;  5B2I B;  1BFM A;  5FUG A;  3MGS A;  4XZQ C;  2YFW A;  1KX5 B;  2HUE C;  3X1S A;  1ID3 B;  3VH5 A;  4WU8 B;  3AZG B;  1S32 C;  4J8X D;  5B24 B;  2CV5 B;  1KX4 A;  2UWX A;  4H9S C;  3REL B;  2RIQ A;  1TZY D;  5B40 B;  2PYO D;  3REK A;  4JJN D;  3A1K A;  4XUJ A;  3B6G C;  5GT0 B;  5GXQ C;  2JE5 A;  3X1T D;  2Y2P A;  3REJ B;  1P3B D;  3MGQ C;  2HIO D;  3R45 B;  3X1U A;  2F2A C;  3W99 A;  5FUG B;  1P3P D;  2Y2Q A;  5GT3 A;  3X1U D;  1AOI C;  3AZE B;  5B32 A;  5KDM B;  4YM6 D;  5CP6 B;  4NE5 A;  3C1C D;  2G5I C;  4ZBJ C;  3VH6 W;  3C1B D;  3AZN C;  1KX4 B;  1P3F C;  4ZUX B;  4WU9 A;  4H9N B;  1HQ3 C;  1U35 D;  2CWE A;  2BYM A;  1B67 A;  5DNN B;  5B0Y C;  5AVB C;  4XUJ B;  1EQZ B;  3UTA C;  2FFF B;  3V9R B;  5B33 A;  3MGP C;  4KUD C;  3WAA D;  3TU4 A;  1P3I A;  5AV5 B;  4J8V A;  5CPJ B;  1P3G A;  3TU4 D;  2LY8 A;  1KX3 D;  3B6F B;  2G5H C;  1JFI B;  3AZF D;  5B1L B;  5B0Z C;  5CPI A;  3NQU B;  4CAY B;  4UUZ A;  3KWQ D;  4XZQ A;  1M19 B;  4CSR A;  3B0B A;  5AV9 D;  3AZJ B;  2ZY2 A;  3AZL B;  1S32 A;  4YS3 B;  3MGR C;  5B2I C;  4H9S A;  2DQN C;  1ZLA B;  2NQB B;  3AN2 A;  1KX5 C;  1P3L B;  2XD5 A;  1ID3 C;  5B31 D;  2RVQ D;  5B1M B;  3WTP D;  5B33 B;  3AZG C;  3B6G A;  4X23 D;  5GXQ A;  1P3I B;  2CV5 C;  4G92 B;  3AZI B;  3W98 D;  5AV6 B;  1M18 B;  1WWS A;  4G91 B;  5E5A D;  3UT9 D;  5B40 C;  3LEL B;  3MGQ A;  3AV2 D;  3AZM D;  1F66 D;  2F8N K;  3VH5 W;  3REH D;  5GT0 C;  1AOI A;  4HGA B;  2HUE B;  4H9Q B;  1P34 B;  1P3M D;  2F8N D;  5JRG A;  4Z66 B;  2BG1 A;  3LJA C;  1S32 B;  3REJ C;  3AZN A;  3KXB B;  1P3F A;  1P3O B;  1HQ3 A;  4LD9 A;  3LZ0 B;  3AZE C;  3AZH D;  5AVB A;  4LD9 D;  5CP6 C;  3B6G B;  4KUD A;  3MGP A;  5AVC B;  5G49 A;  1F1E A;  4ZUX C;  4KGC B;  3WA9 B;  1W2E A;  5B0Z A;  5DNN C;  4WJ3 C;  3AV1 D;  2ZY5 A;  3W97 C;  3WKJ D;  1R4V A;  5AV5 C;  4J8W D;  5CPJ C;  1T3U A;  5DNM D;  3B6F C;  4ZBJ B;  5B1L C;  3MGR A;  5B2I A;  5BT1 C;  5AV8 D;  1M19 C;  3AFA D;  5F99 D;  2Y2O A;  5C3I B;  1KX5 A;  3AZJ C;  1ID3 A;  3LZ1 B;  1P3K D;  5B0Y B;  3AZL C;  3MNN C;  3UTA B;  4WU8 A;  3MGP B;  3AZG A;  2ARO D;  5B24 A;  3KSY A;  4YS3 C;  1PZR A;  2CV5 A;  3KUY D;  4H9O B;  4WU8 D;  1P3A D;  1ZLA C;  2NQB C;  5B40 A;  1P3L C;  5B0Z B;  3REL D;  5B1M C;  3WTP E;  5GT0 A;  4G92 C;  3AZI C;  1M18 C;  4G91 C;  3LJA A;  3KFU G;  3A6N D;  3REJ A;  3LEL C;  3W96 D;  3R45 A;  3REI C;  4YM6 C;  2FJ7 D;  3C1C C;  4E44 A;  1TAF B;  4HGA C;  1P34 C;  3MGS D;  3AZE A;  5KDM A;  4Z66 C;  5CP6 A;  3X1S D;  3AYW B;  3KXB C;  1P3O C;  4ZUX A;  3F6T A;  5CPK B;  1KX4 D;  4H9N A;  3LZ0 C;  1M1A B;  5DNN A;  1EQZ A;  3REK D;  3V9R A;  3W97 A;  3AZF C;  5AV5 A;  4XUJ D;  1EQZ D;  5CPJ A;  5AVC C;  4J8U B;  3KWQ C;  4KGC C;  3WA9 C;  3LJA B;  3B6F A;  1JFI A;  2NZD B;  5B1L A;  3NQU A;  4CAY A;  1M19 A;  3W99 D;  3AZJ A;  4H9R B;  5GT3 D;  3MVD B;  3AZL A;  3MNN A;  4QLC C;  5B32 D;  4YS3 A;  3O62 B;  1ZLA A;  2Y2K A;  5C3I C;  2NQB A;  4WU9 D;  1P3L A;  3VH6 T;  3W98 C;  3LZ1 C;  5B1M A;  3UT9 C;  3AZK B;  3W97 B;  3X1V C;  3AZI A;  5B33 D;  5AV6 A;  1P3I D;  1M18 A;  4J8V D;  3LEL A;  1P3G D;  2F8N H;  3EPL A;  5CPI D;  4J8X B;  1A7W A;  5CHL B;  4H9Q A;  1P34 A;  2ZY4 A;  4XZQ D;  3MNN B;  4Z66 A;  1TZY B;  3H0R C;  2YFV B;  2PYO B;  4JJN B;  5JA4 A;  3KXB A;  1P3O A;  1S32 D;  4R8P C;  2BYK B;  2JSS A;  3NQJ A;  3LZ0 A;  3X1T B;  1Z2C B;  5BNV B;  4Z5T C;  3AN2 D;  3UTB C;  2HIO B;  5BO0 A;  3AYW C;  5AVC A;  4WU9 B;  3B6G D;  1H3O B;  5GXQ D;  5CPK C;  3WA9 A;  5BNX B;  4KGC A;  1M1A C;  2Y2M A;  3REI B;  4YM6 B;  3C1C B;  3MGQ D;  3C1B B;  1N1J A;  4J8U C;  1AOI D;  4Z2M H;  4QLC A;  1U35 B;  5JRG D;  3VH5 T;  5B31 G;  2NZD C;  5GSU C;  5JA4 B;  3WAA B;  2ARO C;  3AZN D;  1P3F D;  3NQJ B;  3LZ1 A;  4NFT A;  1HQ3 D;  5B0Y A;  3MVD C;  2DF4 C;  5B2J C;  3UTA A;  4NE6 A;  1KX3 B;  3B0C W;  3AZF B;  5BO0 B;  5AVB D;  5AY8 C;  4E45 A;  4H9O A;  3O62 C;  3MGP D;  3KWQ B;  4KUD D;  1BH9 B;  2F8N G;  5AV9 B;  5BS7 C;  2Y2L A;  3AZK C;  5B0Z D;  3W96 C;  3AL0 C;  1N1J B;  2FJ7 C;  4QLC B;  3B0D C;  3H0M C;  1BH8 B;  2Y2G A;  5B31 B;  4X23 B;  4R8P A;  3MGR D;  2IO5 B;  5B2I D;  1TAF A;  4J8X C;  4H9P B;  3W98 B;  1KX5 D;  3UT9 B;  3UTB A;  1TZY C;  1ID3 D;  2W8S A;  2PYO C;  3X1V B;  3AV2 B;  4JJN C;  3AZM B;  3AYW A;  1F66 B;  4DRA A;  3AZG D;  5B24 D;  3REH B;  5CPK A;  2CV5 D;  3EG5 B;  1M1A A;  3X1T C;  5B40 D;  1P3B C;  2HIO C;  4Z2M G;  5GT0 D;  4J8U A;  1P3P C;  3X1U C;  3AZH B;  2NZD A;  5GSU A;  3LJA D;  3REJ D;  4R8P B;  4UPK A;  3C1B C;  2ZM5 A;  4Z5T B;  4H9R A;  3MVD A;  5B2J A;  3UTB B;  1U35 C;  3AZE D;  2J8P A;  5CP6 D;  3O62 A;  3AV1 B;  3WAA C;  5BS7 A;  4ZUX D;  4J8W B;  3TU4 C;  1KX3 C;  5DNM B;  3AZK A;  5DNN D;  5AV8 B;  3W97 D;  5AV5 D;  5F99 B;  5CPJ D;  5AV9 C;  5GSU B;  1P3K B;  3B6F D;  2ARO B;  5B1L D;  4J8X A;  5BT1 D;  3KUY B;  1M19 D;  1P3A B;  5B2J B;  2JCH A;  1TZY A;  3AZJ D;  2YFV A;  2PYO A;  2XD1 A;  4JJN A;  3AZL D;  4WNN B;  5AY8 B;  2L5A A;  5B31 C;  2RVQ C;  3MNN D;  1WWI A;  3WTP C;  3AN2 C;  4YS3 D;  4X23 C;  2BYK A;  2IO5 C;  3X1T A;  1ZLA D;  5BNV A;  2NQB D;  5E5A C;  1P3L D;  3A6N B;  1P3B A;  3W96 B;  2HIO A;  3AZM C;  5B1M D;  3AV2 C;  1F66 C;  2FJ7 B;  1H3O A;  1P3P A;  3REH C;  5BNX A;  3AZI D;  3B0D B;  1P3M C;  2Y2H A;  3MGS B;  5AV6 D;  1M18 D;  2YFW B;  2ZY3 A;  3REI A;  5B32 G;  4YM6 A;  3X1S B;  3LEL D;  5JRG C;  3C1C A;  3REI D;  3C1B A;  3EPJ A;  1P34 D;  1U35 A;  4WV4 B;  3AZH C;  4Z66 D;  2Y2I A;  4LD9 C;  3REK B;  3WAA A;  4WZS B;  3KXB D;  1P3O D;  1KX3 A;  3LZ0 D;  4KHA A;  1P3B B;  3AZF A;  1ULY A;  3EPH A;  3KWQ A;  3AV1 C;  1BH9 A;  1P3P B;  3X1U B;  3WKJ C;  3W99 B;  5AV9 A;  5AVC D;  4J8W C;  4KGC D;  3WA9 D;  5GT3 B;  5DNM C;  1HTA A;  5B32 B;  1KU5 A;  4AWL B;  5AV8 C;  3AFA C;  4DQY B;  5F99 C;  2Y2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...