4QLCC

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromatin binding protein/dna
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcC00
5B33B 4WU8D 1P3GA 2PYOD 3W96B 3B0CW 1AOIA 3RELD 4KHAA 3W96D 3W98D 1P3PB 5G49A 5B2IA 3O62D 2HIOD 3X1TA 3A6NC 3MGQA 4XZQD 3REHA 1ID3A 5AVCD 1P3IB 3AZHB 3C1CA 3MGPB 2YFWA 5GT0B 3REJA 5B1LC 3AZHD 3NQUB 5CPKD 1P3LA 5GT0D 4J8XC 3AZEA 2AROC 5B2JD 4E45A 3REIA 1P3MB 4LD9A 4J8WA 3AZGA 5BT1C 1P34B 5B0YA 3AV1A 3B6FD 2BYMA 1P3FB 3AV2B 4XUJB 1M1AB 3LZ1C 1EQZB 4HGAC 4DRAA 5JRGC 5BNVB 2FJ7A 4ZUXA 3W97A 2NQBA 4G92B 5CPJC 1BH9A 5BNXB 4J8VC 1R4VA 3KXBC 3UT9A 4Z5TD 3MGRD 2NZDA 3X1SD 3LELD 4J8UA 4QLCB 4X23A 1HQ3A 5B31A 5DNNA 3C1BA 3TU4D 3R45A 3VH6W 5GXQA 3MNND 3REKB 3AZND 1KX3A 1JFIA 3AYWB 5C3IC 5B33A 3A6NB 1P3PA 3W99A 5B0ZC 4YM6C 2HUEB 5AV8B 5AV5B 3WTPC 5B1LD 3WKJC 2JSSA 1M19B 2AROB 3KWQB 4J8XD 3MGSB 1P3IA 2AROD 3MGPA 5GT0A 3NQUA 3AZJC 1U35D 2YFVA 5BS7C 3WAAC 5BT1D 5B32C 1P3MA 1ULYA 4UUZB 4DRBA 3VH6T 1P34A 3AZFC 4G91B 3AZLB 3LZ1D 2F8NH 5JRGD 1P3FA 3AV2A 4XUJA 5F99C 1P3BB 1M1AA 2F8NB 5B1MB 1EQZA 4R8PC 5CPJD 5BNVA 4J8VD 3UTAC 5BNXA 3KXBD 5AV6C 5AVCC 4NE5A 4H9SC 4YS3C 5B31G 4QLCA 3LJAD 4KGCC 3B0BA 5B24C 4JJNA 3REKA 5C3IB 5CPIB 3MVDB 3B6GC 1KX5B 5AVBC 3AYWA 1ZLAB 5B0ZD 3A6NA 4YM6D 3WTPD 3WKJD 4H9OB 5AV8A 5AV5A 1TZYB 3AZKB 4WU9B 1P3AB 2AROA 3KWQA 3AZJD 3MGSA 1M19A 5B32B 3AFAB 3WA9A 5BO0B 3WAAD 3KUYB 5GT3C 1F66C 3AZFB 1M18C 3LELC 1HTAA 1P3OB 3AZFD 3X1VC 4UUZA 5F99B 3KSYA 4AWLC 5AV9C 5F99D 3AZLA 3MNNC 3AZNC 4WU8B 2PYOB 4R8PD 3RELB 4H9RB 3VH5A 3W98B 1P3BA 1P3KC 2F8NA 5B1MA 3O62B 4E44A 3UTAD 2HIOB 4XZQB 5AVCB 3X1UC 4KUDC 5AV6D 2BYKB 5CPKB 4YS3D 1N1JB 4CSRB 5B2JB 4KGCD 2CV5D 5B24D 3AZMC 4ZBJC 1U35C 3B6FB 3B6GD 5DNMC 5AY8C 5CPIA 5AVBD 3MVDA 5B40C 3AZIC 3B0DB 1KX5A 3V9RB 5GSUC 1H3OB 3NQJB 1ZLAA 4H9QB 4H9OA 5E5AC 1Q9CA 4EO5B 1F66B 1TZYA 3AZKA 4Z5TB 1TAFB 5GT3D 3MGRB 4WU9A 1P3AA 1F66D 1M18B 3X1SB 3LELB 5B32A 3AFAA 1M18D 5BO0A 3KUYA 1KX4C 3X1VD 3TU4B 3MNNB 3AZNB 5AV9D 1P3OA 1S32A 3LJAC 2F8NG 1P3KD 4WU8A 2PYOA 1AOIC 3RELA 4H9RA 3W96A 3W98A 4KUDB 5B2IC 3O62A 3X1UD 2HIOA 4KUDD 5B1LB 4XZQA 3MGQC 3REHC 4J8XB 5AVCA 2BYKA 3C1CC 3REJC 5CPKA 1P3LC 3AZHA 3AZEC 1KU5A 1U35B 4ZBJB 5FUGB 1N1JA 4CSRA 5B2JA 3AZMD 3REIC 5DNMD 4LD9C 4J8WC 5AY8D 3AV1C 3B6FA 3LZ1B 5JRGB 4HGAB 2IO5C 5B40D 3AZID 5GSUD 5CPJB 3V9RA 1H3OA 3NQJA 4ZUXC 4J8VB 3W97C 5E5AD 4H9PB 4H9QA 3KXBB 4Z66C 5B32G 1KX4B 4Z5TA 1TAFA 3UT9C 3MGRA 1M18A 1KX4D 3X1SA 3LELA 4J8UC 3LJAB 4X23C 1HQ3C 2CV5C 5CP6D 5DNNC 3C1BC 3TU4A 1KX3C 5GXQC 3MNNA 3AZNA 1P3GD 1AOID 5B2ID 5B0ZB 5B33C 4YM6B 3WTPB 3WKJB 3MGQD 3W99C 3REHD 4WV4B 1P3PC 1ID3D 3C1CD 3REJD 5B1LA 3AZEB 1P3LD 4J8XA 3AZJB 3AZED 1P3IC 3AN2C 3MGPC 1B67A 3WAAB 3REID 1U35A 4LD9D 4J8WD 3AZGD 5JA4B 1P3MC 3AV1D 3WTPE 1P34C 3LZ1A 5JRGA 4ZUXB 4R8PB 3AV2C 2FJ7D 4XUJC 4ZUXD 1M1AC 3W97D 3UTAB 1EQZC 2NQBD 2RVQC 5CPJA 4Z66B 4J8VA 4Z66D 3VH5W 5AV6B 4H9PA 3KXBA 4YS3B 3UT9D 2NZDD 4J8UD 4KGCB 1KX4A 2CV5B 4X23D 3C1BB 1HQ3D 5B31D 3UTBC 5B24B 4QLCC 5DNND 3LZ0C 3C1BD 3LJAA 5GXQD 1KX3D 3B6GB 1BH8B 4JJNC 3REKC 5AVBB 4CAYB 5B33D 3W99B 3W99D 4M6BA 3AYWC 1P3PD 4WNNB 5B0ZA 4YM6A 3WTPA 3WKJA 3AN2B 1P3ID 3AN2D 3VH5T 2HUEC 5AV8C 5AV5C 3MGPD 1M19C 5GT3B 3KWQC 2YFVB 3AZJA 3MGSC 4H9NB 5BS7A 3WA9C 3WAAA 1P3MD 1A7WA 3X1VB 2LY8A 5JA4A 4AWLB 5AV9B 1P34D 3AZFA 1P3FD 3AV2D 5CP6C 1P3KB 4XUJD 5F99A 1M1AD 4G91C 3AZLC 5CHLB 4Z2MG 1EQZD 3B0CT 4R8PA 2RVQD 1P3GC 1BFMA 1P3BC 5B1MC 3UTAA 3X1UB 4NFTA 4Z66A 3X1TC 5AV6A 1ID3C 4H9SA 4YS3A 3UTBB 3VH6A 3LZ0B 3UTBD 4QLCD 3LZ0D 3AZMB 4KGCA 2CV5A 5DNMB 4JJNB 5B24A 4JJND 5AY8B 3REKD 3AZGC 3B6GA 1BH8A 5B0YC 5B40B 3AZIB 5GSUB 5CPIC 5AVBA 3MVDC 4CAYA 4Z2MH 4WZSB 3AYWD 5KDMB 3A6ND 1KX5C 1ZLAC 2FJ7C 4WNNA 5E5AB 5AV8D 2NQBC 5AV5D 3AN2A 1M19D 3KWQD 4NE3A 3MGSD 3WA9B 3WA9D 1TZYC 3AZKC 4WU9C 5GT3A 1P3AC 1F66A 4H9NA 3AFAC 2NZDC 1B6WA 3KUYC 3X1VA 5CP6B 5B31C 5AV9A 1P3OC 1S32C 3AZLD 1P3GB 1AOIB 4KHAB 1P3KA 1P3BD 2F8ND 5G49B 5B2IB 5B1MD 2F8NK 4WU8C 2PYOC 3X1TB 3RELC 3W96C 3W98C 3MGQB 1F1EA 3X1TD 3REHB 1ID3B 3O62C 3X1UA 2HIOC 4KUDA 3C1CB 3REJB 2CWEA 2YFWB 1P3LB 4XZQC 5CPKC 3AZHC 1WWSA 5GT0C 3REIB 3UTBA 3LZ0A 4LD9B 4J8WB 5B2JC 3AZMA 3AZGB 4NE6A 5FUGA 5B0YB 3AV1B 2BYMB 5DNMA 2IO5B 5B0YD 5AY8A 5CPID 3MVDD 3B6FC 5B40A 3AZIA 1KX5D 5GSUA 2FJ7B 1P3FC 1ZLAD 3W97B 2NQBB 5KDMA 1WWIA 3B0DC 1BH9B 5E5AA 4G92C 1TZYD 4WU9D 3UT9B 3AZKD 1P3AD 2NZDB 5B32D 4EO5C 3AFAD 4J8UB 4Z5TC 3KUYD 3MGRC 4X23B 1HQ3B 5B31B 3X1SC 5DNNB 1S32B 3R45B 5GXQB 1KX3B 1P3OD 1S32D 1JFIB 5CP6A 3TU4C 2L5AA
chains in the Genus database with same CATH superfamily
5B33B 4WU8D 1P3GA 2PYOD 3W96B 3B0CW 1AOIA 3RELD 4KHAA 3W96D 3W98D 1P3PB 5G49A 5B2IA 3O62D 2HIOD 3X1TA 3A6NC 3MGQA 4XZQD 3REHA 1ID3A 5AVCD 1P3IB 3AZHB 3C1CA 3MGPB 2YFWA 5GT0B 3REJA 5B1LC 3AZHD 3NQUB 5CPKD 1P3LA 5GT0D 4J8XC 3AZEA 2AROC 5B2JD 4E45A 3REIA 1P3MB 4LD9A 4J8WA 3AZGA 5BT1C 1P34B 5B0YA 3AV1A 3B6FD 2BYMA 3EPHA 1P3FB 3AV2B 4XUJB 1M1AB 3LZ1C 1EQZB 4HGAC 4DRAA 5JRGC 5BNVB 2FJ7A 4ZUXA 3W97A 2NQBA 4G92B 5CPJC 1BH9A 5BNXB 4J8VC 1R4VA 3KXBC 2XD5A 4Z5TD 3UT9A 3MGRD 2NZDA 3X1SD 3LELD 4J8UA 4QLCB 2ZY3A 4X23A 1HQ3A 5B31A 3IP4C 5DNNA 3C1BA 3TU4D 3R45A 3VH6W 5GXQA 3MNND 3REKB 3AZND 1KX3A 1JFIA 3H0RC 3AYWB 5C3IC 5B33A 3A6NB 1P3PA 3W99A 5B0ZC 4YM6C 2HUEB 5AV8B 5AV5B 3WTPC 5B1LD 3WKJC 2JSSA 1M19B 2AROB 3KWQB 4J8XD 3MGSB 1P3IA 2AROD 3MGPA 5GT0A 3NQUA 3AZJC 2G5HC 1U35D 2YFVA 5BS7C 3WAAC 5BT1D 5B32C 1P3MA 1ULYA 4UUZB 4DRBA 3VH6T 1P34A 3AZFC 3EG5B 4G91B 3AZLB 3LZ1D 2F8NH 5JRGD 1P3FA 3AV2A 2DF4C 4XUJA 5F99C 1P3BB 1M1AA 2F8NB 5B1MB 1EQZA 3FDDA 4R8PC 3AL0C 5CPJD 5BNVA 4J8VD 3UTAC 5BNXA 3KXBD 2G5IC 5AV6C 5AVCC 4NE5A 4H9SC 4YS3C 5B31G 4QLCA 3LJAD 4KGCC 3B0BA 5B24C 4JJNA 3REKA 5C3IB 5CPIB 3MVDB 3B6GC 1KX5B 5AVBC 3AYWA 1ZLAB 2Y2KA 5B0ZD 3A6NA 4YM6D 3WTPD 3WKJD 4H9OB 5AV8A 5AV5A 3KFUG 1TZYB 3AZKB 4WU9B 1P3AB 2AROA 3KWQA 3AZJD 3MGSA 1M19A 2RIQA 5B32B 3AFAB 3EPKA 3WA9A 5BO0B 3WAAD 2Y2NA 3KUYB 5GT3C 1F66C 3AZFB 1M18C 3LELC 1HTAA 1P3OB 3AZFD 3X1VC 4UUZA 5F99B 3KSYA 4AWLC 5AV9C 5F99D 3AZLA 3MNNC 3AZNC 4WU8B 2PYOB 4R8PD 3RELB 4H9RB 3VH5A 3W98B 1P3BA 1P3KC 2F8NA 5B1MA 3O62B 4E44A 3UTAD 2HIOB 3F6TA 4XZQB 5AVCB 3X1UC 4KUDC 5AV6D 2BYKB 5CPKB 4YS3D 2FFFB 1N1JB 4CSRB 5B2JB 4KGCD 2Y2LA 2CV5D 4WJ3C 5B24D 3AZMC 1Z2CB 4ZBJC 1U35C 2JE5A 3B6FB 3B6GD 5DNMC 5AY8C 5CPIA 5AVBD 3MVDA 5B40C 2Y2PA 3B0DB 3AZIC 1KX5A 3V9RB 5GSUC 1H3OB 2J8PA 3NQJB 1ZLAA 2Y2JA 4H9QB 4H9OA 5E5AC 1Q9CA 4EO5B 1F66B 1TZYA 3AZKA 4Z5TB 1TAFB 2Y2GA 5GT3D 3MGRB 4WU9A 1P3AA 1M18B 1F66D 3X1SB 3LELB 5B32A 3AFAA 1M18D 5BO0A 3KUYA 1KX4C 3X1VD 3TU4B 3MNNB 3AZNB 5AV9D 1P3OA 1S32A 3LJAC 2F8NG 1P3KD 2W8SA 4WU8A 2PYOA 1AOIC 3RELA 4H9RA 3W96A 3W98A 4KUDB 5B2IC 3O62A 3X1UD 2HIOA 4KUDD 5B1LB 4XZQA 3MGQC 3REHC 4J8XB 5AVCA 2BYKA 3C1CC 3REJC 5CPKA 1P3LC 3AZHA 2ZY2A 3AZEC 1KU5A 1U35B 2Y2QA 4ZBJB 5FUGB 1N1JA 4CSRA 5B2JA 3AZMD 3REIC 5DNMD 4LD9C 2Y2OA 4J8WC 5AY8D 3AV1C 3B6FA 3LZ1B 5JRGB 4HGAB 2IO5C 5B40D 3AZID 5GSUD 4UPKA 5CPJB 3V9RA 1H3OA 3NQJA 4ZUXC 4J8VB 3W97C 5E5AD 4H9PB 4H9QA 3KXBB 4Z66C 5B32G 1KX4B 4Z5TA 1TAFA 3UT9C 3MGRA 1M18A 1KX4D 3X1SA 3LELA 4J8UC 3LJAB 4X23C 1HQ3C 2CV5C 5CP6D 5DNNC 3C1BC 3TU4A 1KX3C 5GXQC 3MNNA 3AZNA 1P3GD 1AOID 5B2ID 5B0ZB 5B33C 4YM6B 3WTPB 3WKJB 3MGQD 3W99C 3REHD 4WV4B 1P3PC 1ID3D 3C1CD 3REJD 5B1LA 3AZEB 1P3LD 2Y2MA 4J8XA 3AZJB 3AZED 1P3IC 3AN2C 3MGPC 1B67A 2JCHA 3WAAB 2F2AC 3REID 1U35A 4LD9D 4J8WD 3AZGD 5JA4B 1P3MC 3AV1D 3WTPE 2Y2IA 1P34C 3LZ1A 5JRGA 4ZUXB 4R8PB 3AV2C 2FJ7D 4XUJC 4ZUXD 1M1AC 3W97D 3UTAB 1EQZC 2NQBD 2RVQC 5CPJA 4Z66B 4J8VA 4Z66D 3VH5W 5AV6B 3P5JB 1T3UA 4H9PA 3KXBA 4YS3B 3UT9D 2NZDD 2VQRA 4J8UD 4KGCB 1KX4A 2ZM5A 3H0MC 2CV5B 4X23D 3C1BB 1HQ3D 5B31D 3UTBC 5B24B 4QLCC 5DNND 3LZ0C 3C1BD 3LJAA 5GXQD 1KX3D 3B6GB 1BH8B 1W2EA 4JJNC 3REKC 5AVBB 4CAYB 5B33D 3W99B 3W99D 4M6BA 3AYWC 1P3PD 4WNNB 5B0ZA 4YM6A 3WTPA 3WKJA 3AN2B 1P3ID 3AN2D 3VH5T 2HUEC 5AV8C 5AV5C 3MGPD 1M19C 5GT3B 3KWQC 2YFVB 3AZJA 3MGSC 4H9NB 5BS7A 3WA9C 3WAAA 1P3MD 1A7WA 3X1VB 2LY8A 2XD1A 5JA4A 4AWLB 2ZY4A 5AV9B 1P34D 3AZFA 3H0LC 1P3FD 3AV2D 5CP6C 1P3KB 4XUJD 5F99A 3A1IA 4G91C 3AZLC 5CHLB 1M1AD 4Z2MG 1EQZD 3B0CT 4R8PA 2RVQD 1P3GC 1BFMA 1P3BC 5B1MC 3UTAA 3X1UB 4NFTA 4Z66A 3X1TC 5AV6A 2ZY5A 1ID3C 4H9SA 4YS3A 3UTBB 3VH6A 3LZ0B 3UTBD 4QLCD 3LZ0D 3AZMB 4KGCA 3A1KA 2CV5A 5DNMB 4JJNB 5B24A 4DQYB 4JJND 1PZRA 5AY8B 3REKD 3AZGC 3B6GA 1BH8A 5B0YC 5B40B 3AZIB 5GSUB 5CPIC 5AVBA 3MVDC 4CAYA 4Z2MH 4WZSB 3AYWD 5KDMB 3A6ND 1KX5C 1ZLAC 2FJ7C 4WNNA 5E5AB 5AV8D 2NQBC 5AV5D 3AN2A 1M19D 3KWQD 4NE3A 3MGSD 3WA9B 3WA9D 1TZYC 3AZKC 4WU9C 5GT3A 2DQNC 1P3AC 1F66A 4H9NA 3AFAC 2NZDC 1B6WA 3KUYC 3X1VA 5CP6B 5B31C 5AV9A 1P3OC 1S32C 3AZLD 3EPLA 1P3GB 1AOIB 4KHAB 1P3KA 1P3BD 2F8ND 5B2IB 5G49B 5B1MD 2F8NK 4WU8C 2PYOC 3X1TB 2Y2HA 3RELC 3W96C 3W98C 3MGQB 1F1EA 3X1TD 3REHB 1ID3B 3O62C 3X1UA 2HIOC 4KUDA 3C1CB 3REJB 2CWEA 2YFWB 1P3LB 4XZQC 5CPKC 3AZHC 1WWSA 5GT0C 3REIB 3UTBA 3LZ0A 4LD9B 4J8WB 5B2JC 3AZMA 3AZGB 4NE6A 5FUGA 5B0YB 3AV1B 2BYMB 5DNMA 2IO5B 5B0YD 5AY8A 5CPID 3MVDD 3B6FC 3EPJA 5B40A 3AZIA 1KX5D 5GSUA 2FJ7B 1P3FC 1ZLAD 3W97B 2NQBB 5KDMA 1WWIA 3B0DC 1BH9B 5E5AA 4G92C 1TZYD 4WU9D 3UT9B 3AZKD 1P3AD 2NZDB 5B32D 4EO5C 3AFAD 4J8UB 4Z5TC 3KUYD 3MGRC 4X23B 2BG1A 1HQ3B 5B31B 3X1SC 5DNNB 1S32B 3R45B 5GXQB 1KX3B 1P3OD 1S32D 2UWXA 1JFIB 5CP6A 3TU4C 2L5AA
chains in the Genus database with same CATH topology
5B33B 4WU8D 1P3GA 2PYOD 3W96B 3B0CW 1AOIA 3RELD 4KHAA 3W96D 3W98D 1P3PB 5G49A 5B2IA 3O62D 2HIOD 3X1TA 3A6NC 3MGQA 4XZQD 3REHA 1ID3A 5AVCD 1P3IB 3AZHB 3C1CA 3MGPB 2YFWA 5GT0B 3REJA 5B1LC 3AZHD 3NQUB 5CPKD 1P3LA 5GT0D 4J8XC 3AZEA 2AROC 5B2JD 4E45A 3REIA 1P3MB 4LD9A 4J8WA 3AZGA 5BT1C 1P34B 5B0YA 3AV1A 3B6FD 2BYMA 3EPHA 1P3FB 3AV2B 4XUJB 1M1AB 3LZ1C 1EQZB 4HGAC 4DRAA 5JRGC 5BNVB 2FJ7A 4ZUXA 3W97A 2NQBA 4G92B 5CPJC 1BH9A 5BNXB 4J8VC 1R4VA 3KXBC 2XD5A 4Z5TD 3UT9A 3MGRD 2NZDA 3X1SD 3LELD 4J8UA 4QLCB 2ZY3A 4X23A 1HQ3A 5B31A 3IP4C 5DNNA 3C1BA 3TU4D 3R45A 3VH6W 5GXQA 3MNND 3REKB 3AZND 1KX3A 1JFIA 3H0RC 3AYWB 5C3IC 5B33A 3A6NB 1P3PA 3W99A 5B0ZC 4YM6C 2HUEB 5AV8B 5AV5B 3WTPC 5B1LD 3WKJC 2JSSA 1M19B 2AROB 3KWQB 4J8XD 3MGSB 1P3IA 2AROD 3MGPA 5GT0A 3NQUA 3AZJC 2G5HC 1U35D 2YFVA 5BS7C 3WAAC 5BT1D 5B32C 1P3MA 1ULYA 4UUZB 4DRBA 3VH6T 1P34A 3AZFC 3EG5B 4G91B 3AZLB 3LZ1D 2F8NH 5JRGD 1P3FA 3AV2A 2DF4C 4XUJA 5F99C 1P3BB 1M1AA 2F8NB 5B1MB 1EQZA 3FDDA 4R8PC 3AL0C 5CPJD 5BNVA 4J8VD 3UTAC 5BNXA 3KXBD 2G5IC 5AV6C 5AVCC 4NE5A 4H9SC 4YS3C 5B31G 4QLCA 3LJAD 4KGCC 3B0BA 5B24C 4JJNA 3REKA 5C3IB 5CPIB 3MVDB 3B6GC 1KX5B 5AVBC 3AYWA 1ZLAB 2Y2KA 5B0ZD 3A6NA 4YM6D 3WTPD 3WKJD 4H9OB 5AV8A 5AV5A 3KFUG 1TZYB 3AZKB 4WU9B 1P3AB 2AROA 3KWQA 3AZJD 3MGSA 1M19A 2RIQA 5B32B 3AFAB 3EPKA 3WA9A 5BO0B 3WAAD 2Y2NA 3KUYB 5GT3C 1F66C 3AZFB 1M18C 3LELC 1HTAA 1P3OB 3AZFD 3X1VC 4UUZA 5F99B 3KSYA 4AWLC 5AV9C 5F99D 3AZLA 3MNNC 3AZNC 4WU8B 2PYOB 4R8PD 3RELB 4H9RB 3VH5A 3W98B 1P3BA 1P3KC 2F8NA 5B1MA 3O62B 4E44A 3UTAD 2HIOB 3F6TA 4XZQB 5AVCB 3X1UC 4KUDC 5AV6D 2BYKB 5CPKB 4YS3D 2FFFB 1N1JB 4CSRB 5B2JB 4KGCD 2Y2LA 2CV5D 4WJ3C 5B24D 3AZMC 1Z2CB 4ZBJC 1U35C 2JE5A 3B6FB 3B6GD 5DNMC 5AY8C 5CPIA 5AVBD 3MVDA 5B40C 2Y2PA 3B0DB 3AZIC 1KX5A 3V9RB 5GSUC 1H3OB 2J8PA 3NQJB 1ZLAA 2Y2JA 4H9QB 4H9OA 5E5AC 1Q9CA 4EO5B 1F66B 1TZYA 3AZKA 4Z5TB 1TAFB 2Y2GA 5GT3D 3MGRB 4WU9A 1P3AA 1M18B 1F66D 3X1SB 3LELB 5B32A 3AFAA 1M18D 5BO0A 3KUYA 1KX4C 3X1VD 3TU4B 3MNNB 3AZNB 5AV9D 1P3OA 1S32A 3LJAC 2F8NG 1P3KD 2W8SA 4WU8A 2PYOA 1AOIC 3RELA 4H9RA 3W96A 3W98A 4KUDB 5B2IC 3O62A 3X1UD 2HIOA 4KUDD 5B1LB 4XZQA 3MGQC 3REHC 4J8XB 5AVCA 2BYKA 3C1CC 3REJC 5CPKA 1P3LC 3AZHA 2ZY2A 3AZEC 1KU5A 1U35B 2Y2QA 4ZBJB 5FUGB 1N1JA 4CSRA 5B2JA 3AZMD 3REIC 5DNMD 4LD9C 2Y2OA 4J8WC 5AY8D 3AV1C 3B6FA 3LZ1B 5JRGB 4HGAB 2IO5C 5B40D 3AZID 5GSUD 4UPKA 5CPJB 3V9RA 1H3OA 3NQJA 4ZUXC 4J8VB 3W97C 5E5AD 4H9PB 4H9QA 3KXBB 4Z66C 5B32G 1KX4B 4Z5TA 1TAFA 3UT9C 3MGRA 1M18A 1KX4D 3X1SA 3LELA 4J8UC 3LJAB 4X23C 1HQ3C 2CV5C 5CP6D 5DNNC 3C1BC 3TU4A 1KX3C 5GXQC 3MNNA 3AZNA 1P3GD 1AOID 5B2ID 5B0ZB 5B33C 4YM6B 3WTPB 3WKJB 3MGQD 3W99C 3REHD 4WV4B 1P3PC 1ID3D 3C1CD 3REJD 5B1LA 3AZEB 1P3LD 2Y2MA 4J8XA 3AZJB 3AZED 1P3IC 3AN2C 3MGPC 1B67A 2JCHA 3WAAB 2F2AC 3REID 1U35A 4LD9D 4J8WD 3AZGD 5JA4B 1P3MC 3AV1D 3WTPE 2Y2IA 1P34C 3LZ1A 5JRGA 4ZUXB 4R8PB 3AV2C 2FJ7D 4XUJC 4ZUXD 1M1AC 3W97D 3UTAB 1EQZC 2NQBD 2RVQC 5CPJA 4Z66B 4J8VA 4Z66D 3VH5W 5AV6B 3P5JB 1T3UA 4H9PA 3KXBA 4YS3B 3UT9D 2NZDD 2VQRA 4J8UD 4KGCB 1KX4A 2ZM5A 3H0MC 2CV5B 4X23D 3C1BB 1HQ3D 5B31D 3UTBC 5B24B 4QLCC 5DNND 3LZ0C 3C1BD 3LJAA 5GXQD 1KX3D 3B6GB 1BH8B 1W2EA 4JJNC 3REKC 5AVBB 4CAYB 5B33D 3W99B 3W99D 4M6BA 3AYWC 1P3PD 4WNNB 5B0ZA 4YM6A 3WTPA 3WKJA 3AN2B 1P3ID 3AN2D 3VH5T 2HUEC 5AV8C 5AV5C 3MGPD 1M19C 5GT3B 3KWQC 2YFVB 3AZJA 3MGSC 4H9NB 5BS7A 3WA9C 3WAAA 1P3MD 1A7WA 3X1VB 2LY8A 2XD1A 5JA4A 4AWLB 2ZY4A 5AV9B 1P34D 3AZFA 3H0LC 1P3FD 3AV2D 5CP6C 1P3KB 4XUJD 5F99A 3A1IA 4G91C 3AZLC 5CHLB 1M1AD 4Z2MG 1EQZD 3B0CT 4R8PA 2RVQD 1P3GC 1BFMA 1P3BC 5B1MC 3UTAA 3X1UB 4NFTA 4Z66A 3X1TC 5AV6A 2ZY5A 1ID3C 4H9SA 4YS3A 3UTBB 3VH6A 3LZ0B 3UTBD 4QLCD 3LZ0D 3AZMB 4KGCA 3A1KA 2CV5A 5DNMB 4JJNB 5B24A 4DQYB 4JJND 1PZRA 5AY8B 3REKD 3AZGC 3B6GA 1BH8A 5B0YC 5B40B 3AZIB 5GSUB 5CPIC 5AVBA 3MVDC 4CAYA 4Z2MH 4WZSB 3AYWD 5KDMB 3A6ND 1KX5C 1ZLAC 2FJ7C 4WNNA 5E5AB 5AV8D 2NQBC 5AV5D 3AN2A 1M19D 3KWQD 4NE3A 3MGSD 3WA9B 3WA9D 1TZYC 3AZKC 4WU9C 5GT3A 2DQNC 1P3AC 1F66A 4H9NA 3AFAC 2NZDC 1B6WA 3KUYC 3X1VA 5CP6B 5B31C 5AV9A 1P3OC 1S32C 3AZLD 3EPLA 1P3GB 1AOIB 4KHAB 1P3KA 1P3BD 2F8ND 5B2IB 5G49B 5B1MD 2F8NK 4WU8C 2PYOC 3X1TB 2Y2HA 3RELC 3W96C 3W98C 3MGQB 1F1EA 3X1TD 3REHB 1ID3B 3O62C 3X1UA 2HIOC 4KUDA 3C1CB 3REJB 2CWEA 2YFWB 1P3LB 4XZQC 5CPKC 3AZHC 1WWSA 5GT0C 3REIB 3UTBA 3LZ0A 4LD9B 4J8WB 5B2JC 3AZMA 3AZGB 4NE6A 5FUGA 5B0YB 3AV1B 2BYMB 5DNMA 2IO5B 5B0YD 5AY8A 5CPID 3MVDD 3B6FC 3EPJA 5B40A 3AZIA 1KX5D 5GSUA 2FJ7B 1P3FC 1ZLAD 3W97B 2NQBB 5KDMA 1WWIA 3B0DC 1BH9B 5E5AA 4G92C 1TZYD 4WU9D 3UT9B 3AZKD 1P3AD 2NZDB 5B32D 4EO5C 3AFAD 4J8UB 4Z5TC 3KUYD 3MGRC 4X23B 2BG1A 1HQ3B 5B31B 3X1SC 5DNNB 1S32B 3R45B 5GXQB 1KX3B 1P3OD 1S32D 2UWXA 1JFIB 5CP6A 3TU4C 2L5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 B;  4WU8 D;  1P3G A;  2PYO D;  3W96 B;  3B0C W;  1AOI A;  3REL D;  4KHA A;  3W96 D;  3W98 D;  1P3P B;  5G49 A;  5B2I A;  3O62 D;  2HIO D;  3X1T A;  3A6N C;  3MGQ A;  4XZQ D;  3REH A;  1ID3 A;  5AVC D;  1P3I B;  3AZH B;  3C1C A;  3MGP B;  2YFW A;  5GT0 B;  3REJ A;  5B1L C;  3AZH D;  3NQU B;  5CPK D;  1P3L A;  5GT0 D;  4J8X C;  3AZE A;  2ARO C;  5B2J D;  4E45 A;  3REI A;  1P3M B;  4LD9 A;  4J8W A;  3AZG A;  5BT1 C;  1P34 B;  5B0Y A;  3AV1 A;  3B6F D;  2BYM A;  1P3F B;  3AV2 B;  4XUJ B;  1M1A B;  3LZ1 C;  1EQZ B;  4HGA C;  4DRA A;  5JRG C;  5BNV B;  2FJ7 A;  4ZUX A;  3W97 A;  2NQB A;  4G92 B;  5CPJ C;  1BH9 A;  5BNX B;  4J8V C;  1R4V A;  3KXB C;  3UT9 A;  4Z5T D;  3MGR D;  2NZD A;  3X1S D;  3LEL D;  4J8U A;  4QLC B;  4X23 A;  1HQ3 A;  5B31 A;  5DNN A;  3C1B A;  3TU4 D;  3R45 A;  3VH6 W;  5GXQ A;  3MNN D;  3REK B;  3AZN D;  1KX3 A;  1JFI A;  3AYW B;  5C3I C;  5B33 A;  3A6N B;  1P3P A;  3W99 A;  5B0Z C;  4YM6 C;  2HUE B;  5AV8 B;  5AV5 B;  3WTP C;  5B1L D;  3WKJ C;  2JSS A;  1M19 B;  2ARO B;  3KWQ B;  4J8X D;  3MGS B;  1P3I A;  2ARO D;  3MGP A;  5GT0 A;  3NQU A;  3AZJ C;  1U35 D;  2YFV A;  5BS7 C;  3WAA C;  5BT1 D;  5B32 C;  1P3M A;  1ULY A;  4UUZ B;  4DRB A;  3VH6 T;  1P34 A;  3AZF C;  4G91 B;  3AZL B;  3LZ1 D;  2F8N H;  5JRG D;  1P3F A;  3AV2 A;  4XUJ A;  5F99 C;  1P3B B;  1M1A A;  2F8N B;  5B1M B;  1EQZ A;  4R8P C;  5CPJ D;  5BNV A;  4J8V D;  3UTA C;  5BNX A;  3KXB D;  5AV6 C;  5AVC C;  4NE5 A;  4H9S C;  4YS3 C;  5B31 G;  4QLC A;  3LJA D;  4KGC C;  3B0B A;  5B24 C;  4JJN A;  3REK A;  5C3I B;  5CPI B;  3MVD B;  3B6G C;  1KX5 B;  5AVB C;  3AYW A;  1ZLA B;  5B0Z D;  3A6N A;  4YM6 D;  3WTP D;  3WKJ D;  4H9O B;  5AV8 A;  5AV5 A;  1TZY B;  3AZK B;  4WU9 B;  1P3A B;  2ARO A;  3KWQ A;  3AZJ D;  3MGS A;  1M19 A;  5B32 B;  3AFA B;  3WA9 A;  5BO0 B;  3WAA D;  3KUY B;  5GT3 C;  1F66 C;  3AZF B;  1M18 C;  3LEL C;  1HTA A;  1P3O B;  3AZF D;  3X1V C;  4UUZ A;  5F99 B;  3KSY A;  4AWL C;  5AV9 C;  5F99 D;  3AZL A;  3MNN C;  3AZN C;  4WU8 B;  2PYO B;  4R8P D;  3REL B;  4H9R B;  3VH5 A;  3W98 B;  1P3B A;  1P3K C;  2F8N A;  5B1M A;  3O62 B;  4E44 A;  3UTA D;  2HIO B;  4XZQ B;  5AVC B;  3X1U C;  4KUD C;  5AV6 D;  2BYK B;  5CPK B;  4YS3 D;  1N1J B;  4CSR B;  5B2J B;  4KGC D;  2CV5 D;  5B24 D;  3AZM C;  4ZBJ C;  1U35 C;  3B6F B;  3B6G D;  5DNM C;  5AY8 C;  5CPI A;  5AVB D;  3MVD A;  5B40 C;  3AZI C;  3B0D B;  1KX5 A;  3V9R B;  5GSU C;  1H3O B;  3NQJ B;  1ZLA A;  4H9Q B;  4H9O A;  5E5A C;  1Q9C A;  4EO5 B;  1F66 B;  1TZY A;  3AZK A;  4Z5T B;  1TAF B;  5GT3 D;  3MGR B;  4WU9 A;  1P3A A;  1F66 D;  1M18 B;  3X1S B;  3LEL B;  5B32 A;  3AFA A;  1M18 D;  5BO0 A;  3KUY A;  1KX4 C;  3X1V D;  3TU4 B;  3MNN B;  3AZN B;  5AV9 D;  1P3O A;  1S32 A;  3LJA C;  2F8N G;  1P3K D;  4WU8 A;  2PYO A;  1AOI C;  3REL A;  4H9R A;  3W96 A;  3W98 A;  4KUD B;  5B2I C;  3O62 A;  3X1U D;  2HIO A;  4KUD D;  5B1L B;  4XZQ A;  3MGQ C;  3REH C;  4J8X B;  5AVC A;  2BYK A;  3C1C C;  3REJ C;  5CPK A;  1P3L C;  3AZH A;  3AZE C;  1KU5 A;  1U35 B;  4ZBJ B;  5FUG B;  1N1J A;  4CSR A;  5B2J A;  3AZM D;  3REI C;  5DNM D;  4LD9 C;  4J8W C;  5AY8 D;  3AV1 C;  3B6F A;  3LZ1 B;  5JRG B;  4HGA B;  2IO5 C;  5B40 D;  3AZI D;  5GSU D;  5CPJ B;  3V9R A;  1H3O A;  3NQJ A;  4ZUX C;  4J8V B;  3W97 C;  5E5A D;  4H9P B;  4H9Q A;  3KXB B;  4Z66 C;  5B32 G;  1KX4 B;  4Z5T A;  1TAF A;  3UT9 C;  3MGR A;  1M18 A;  1KX4 D;  3X1S A;  3LEL A;  4J8U C;  3LJA B;  4X23 C;  1HQ3 C;  2CV5 C;  5CP6 D;  5DNN C;  3C1B C;  3TU4 A;  1KX3 C;  5GXQ C;  3MNN A;  3AZN A;  1P3G D;  1AOI D;  5B2I D;  5B0Z B;  5B33 C;  4YM6 B;  3WTP B;  3WKJ B;  3MGQ D;  3W99 C;  3REH D;  4WV4 B;  1P3P C;  1ID3 D;  3C1C D;  3REJ D;  5B1L A;  3AZE B;  1P3L D;  4J8X A;  3AZJ B;  3AZE D;  1P3I C;  3AN2 C;  3MGP C;  1B67 A;  3WAA B;  3REI D;  1U35 A;  4LD9 D;  4J8W D;  3AZG D;  5JA4 B;  1P3M C;  3AV1 D;  3WTP E;  1P34 C;  3LZ1 A;  5JRG A;  4ZUX B;  4R8P B;  3AV2 C;  2FJ7 D;  4XUJ C;  4ZUX D;  1M1A C;  3W97 D;  3UTA B;  1EQZ C;  2NQB D;  2RVQ C;  5CPJ A;  4Z66 B;  4J8V A;  4Z66 D;  3VH5 W;  5AV6 B;  4H9P A;  3KXB A;  4YS3 B;  3UT9 D;  2NZD D;  4J8U D;  4KGC B;  1KX4 A;  2CV5 B;  4X23 D;  3C1B B;  1HQ3 D;  5B31 D;  3UTB C;  5B24 B;  4QLC C;  5DNN D;  3LZ0 C;  3C1B D;  3LJA A;  5GXQ D;  1KX3 D;  3B6G B;  1BH8 B;  4JJN C;  3REK C;  5AVB B;  4CAY B;  5B33 D;  3W99 B;  3W99 D;  4M6B A;  3AYW C;  1P3P D;  4WNN B;  5B0Z A;  4YM6 A;  3WTP A;  3WKJ A;  3AN2 B;  1P3I D;  3AN2 D;  3VH5 T;  2HUE C;  5AV8 C;  5AV5 C;  3MGP D;  1M19 C;  5GT3 B;  3KWQ C;  2YFV B;  3AZJ A;  3MGS C;  4H9N B;  5BS7 A;  3WA9 C;  3WAA A;  1P3M D;  1A7W A;  3X1V B;  2LY8 A;  5JA4 A;  4AWL B;  5AV9 B;  1P34 D;  3AZF A;  1P3F D;  3AV2 D;  5CP6 C;  1P3K B;  4XUJ D;  5F99 A;  1M1A D;  4G91 C;  3AZL C;  5CHL B;  4Z2M G;  1EQZ D;  3B0C T;  4R8P A;  2RVQ D;  1P3G C;  1BFM A;  1P3B C;  5B1M C;  3UTA A;  3X1U B;  4NFT A;  4Z66 A;  3X1T C;  5AV6 A;  1ID3 C;  4H9S A;  4YS3 A;  3UTB B;  3VH6 A;  3LZ0 B;  3UTB D;  4QLC D;  3LZ0 D;  3AZM B;  4KGC A;  2CV5 A;  5DNM B;  4JJN B;  5B24 A;  4JJN D;  5AY8 B;  3REK D;  3AZG C;  3B6G A;  1BH8 A;  5B0Y C;  5B40 B;  3AZI B;  5GSU B;  5CPI C;  5AVB A;  3MVD C;  4CAY A;  4Z2M H;  4WZS B;  3AYW D;  5KDM B;  3A6N D;  1KX5 C;  1ZLA C;  2FJ7 C;  4WNN A;  5E5A B;  5AV8 D;  2NQB C;  5AV5 D;  3AN2 A;  1M19 D;  3KWQ D;  4NE3 A;  3MGS D;  3WA9 B;  3WA9 D;  1TZY C;  3AZK C;  4WU9 C;  5GT3 A;  1P3A C;  1F66 A;  4H9N A;  3AFA C;  2NZD C;  1B6W A;  3KUY C;  3X1V A;  5CP6 B;  5B31 C;  5AV9 A;  1P3O C;  1S32 C;  3AZL D;  1P3G B;  1AOI B;  4KHA B;  1P3K A;  1P3B D;  2F8N D;  5G49 B;  5B2I B;  5B1M D;  2F8N K;  4WU8 C;  2PYO C;  3X1T B;  3REL C;  3W96 C;  3W98 C;  3MGQ B;  1F1E A;  3X1T D;  3REH B;  1ID3 B;  3O62 C;  3X1U A;  2HIO C;  4KUD A;  3C1C B;  3REJ B;  2CWE A;  2YFW B;  1P3L B;  4XZQ C;  5CPK C;  3AZH C;  1WWS A;  5GT0 C;  3REI B;  3UTB A;  3LZ0 A;  4LD9 B;  4J8W B;  5B2J C;  3AZM A;  3AZG B;  4NE6 A;  5FUG A;  5B0Y B;  3AV1 B;  2BYM B;  5DNM A;  2IO5 B;  5B0Y D;  5AY8 A;  5CPI D;  3MVD D;  3B6F C;  5B40 A;  3AZI A;  1KX5 D;  5GSU A;  2FJ7 B;  1P3F C;  1ZLA D;  3W97 B;  2NQB B;  5KDM A;  1WWI A;  3B0D C;  1BH9 B;  5E5A A;  4G92 C;  1TZY D;  4WU9 D;  3UT9 B;  3AZK D;  1P3A D;  2NZD B;  5B32 D;  4EO5 C;  3AFA D;  4J8U B;  4Z5T C;  3KUY D;  3MGR C;  4X23 B;  1HQ3 B;  5B31 B;  3X1S C;  5DNN B;  1S32 B;  3R45 B;  5GXQ B;  1KX3 B;  1P3O D;  1S32 D;  1JFI B;  5CP6 A;  3TU4 C;  2L5A A; 
#chains in the Genus database with same CATH topology
 5B33 B;  4WU8 D;  1P3G A;  2PYO D;  3W96 B;  3B0C W;  1AOI A;  3REL D;  4KHA A;  3W96 D;  3W98 D;  1P3P B;  5G49 A;  5B2I A;  3O62 D;  2HIO D;  3X1T A;  3A6N C;  3MGQ A;  4XZQ D;  3REH A;  1ID3 A;  5AVC D;  1P3I B;  3AZH B;  3C1C A;  3MGP B;  2YFW A;  5GT0 B;  3REJ A;  5B1L C;  3AZH D;  3NQU B;  5CPK D;  1P3L A;  5GT0 D;  4J8X C;  3AZE A;  2ARO C;  5B2J D;  4E45 A;  3REI A;  1P3M B;  4LD9 A;  4J8W A;  3AZG A;  5BT1 C;  1P34 B;  5B0Y A;  3AV1 A;  3B6F D;  2BYM A;  3EPH A;  1P3F B;  3AV2 B;  4XUJ B;  1M1A B;  3LZ1 C;  1EQZ B;  4HGA C;  4DRA A;  5JRG C;  5BNV B;  2FJ7 A;  4ZUX A;  3W97 A;  2NQB A;  4G92 B;  5CPJ C;  1BH9 A;  5BNX B;  4J8V C;  1R4V A;  3KXB C;  2XD5 A;  4Z5T D;  3UT9 A;  3MGR D;  2NZD A;  3X1S D;  3LEL D;  4J8U A;  4QLC B;  2ZY3 A;  4X23 A;  1HQ3 A;  5B31 A;  3IP4 C;  5DNN A;  3C1B A;  3TU4 D;  3R45 A;  3VH6 W;  5GXQ A;  3MNN D;  3REK B;  3AZN D;  1KX3 A;  1JFI A;  3H0R C;  3AYW B;  5C3I C;  5B33 A;  3A6N B;  1P3P A;  3W99 A;  5B0Z C;  4YM6 C;  2HUE B;  5AV8 B;  5AV5 B;  3WTP C;  5B1L D;  3WKJ C;  2JSS A;  1M19 B;  2ARO B;  3KWQ B;  4J8X D;  3MGS B;  1P3I A;  2ARO D;  3MGP A;  5GT0 A;  3NQU A;  3AZJ C;  2G5H C;  1U35 D;  2YFV A;  5BS7 C;  3WAA C;  5BT1 D;  5B32 C;  1P3M A;  1ULY A;  4UUZ B;  4DRB A;  3VH6 T;  1P34 A;  3AZF C;  3EG5 B;  4G91 B;  3AZL B;  3LZ1 D;  2F8N H;  5JRG D;  1P3F A;  3AV2 A;  2DF4 C;  4XUJ A;  5F99 C;  1P3B B;  1M1A A;  2F8N B;  5B1M B;  1EQZ A;  3FDD A;  4R8P C;  3AL0 C;  5CPJ D;  5BNV A;  4J8V D;  3UTA C;  5BNX A;  3KXB D;  2G5I C;  5AV6 C;  5AVC C;  4NE5 A;  4H9S C;  4YS3 C;  5B31 G;  4QLC A;  3LJA D;  4KGC C;  3B0B A;  5B24 C;  4JJN A;  3REK A;  5C3I B;  5CPI B;  3MVD B;  3B6G C;  1KX5 B;  5AVB C;  3AYW A;  1ZLA B;  2Y2K A;  5B0Z D;  3A6N A;  4YM6 D;  3WTP D;  3WKJ D;  4H9O B;  5AV8 A;  5AV5 A;  3KFU G;  1TZY B;  3AZK B;  4WU9 B;  1P3A B;  2ARO A;  3KWQ A;  3AZJ D;  3MGS A;  1M19 A;  2RIQ A;  5B32 B;  3AFA B;  3EPK A;  3WA9 A;  5BO0 B;  3WAA D;  2Y2N A;  3KUY B;  5GT3 C;  1F66 C;  3AZF B;  1M18 C;  3LEL C;  1HTA A;  1P3O B;  3AZF D;  3X1V C;  4UUZ A;  5F99 B;  3KSY A;  4AWL C;  5AV9 C;  5F99 D;  3AZL A;  3MNN C;  3AZN C;  4WU8 B;  2PYO B;  4R8P D;  3REL B;  4H9R B;  3VH5 A;  3W98 B;  1P3B A;  1P3K C;  2F8N A;  5B1M A;  3O62 B;  4E44 A;  3UTA D;  2HIO B;  3F6T A;  4XZQ B;  5AVC B;  3X1U C;  4KUD C;  5AV6 D;  2BYK B;  5CPK B;  4YS3 D;  2FFF B;  1N1J B;  4CSR B;  5B2J B;  4KGC D;  2Y2L A;  2CV5 D;  4WJ3 C;  5B24 D;  3AZM C;  1Z2C B;  4ZBJ C;  1U35 C;  2JE5 A;  3B6F B;  3B6G D;  5DNM C;  5AY8 C;  5CPI A;  5AVB D;  3MVD A;  5B40 C;  2Y2P A;  3B0D B;  3AZI C;  1KX5 A;  3V9R B;  5GSU C;  1H3O B;  2J8P A;  3NQJ B;  1ZLA A;  2Y2J A;  4H9Q B;  4H9O A;  5E5A C;  1Q9C A;  4EO5 B;  1F66 B;  1TZY A;  3AZK A;  4Z5T B;  1TAF B;  2Y2G A;  5GT3 D;  3MGR B;  4WU9 A;  1P3A A;  1M18 B;  1F66 D;  3X1S B;  3LEL B;  5B32 A;  3AFA A;  1M18 D;  5BO0 A;  3KUY A;  1KX4 C;  3X1V D;  3TU4 B;  3MNN B;  3AZN B;  5AV9 D;  1P3O A;  1S32 A;  3LJA C;  2F8N G;  1P3K D;  2W8S A;  4WU8 A;  2PYO A;  1AOI C;  3REL A;  4H9R A;  3W96 A;  3W98 A;  4KUD B;  5B2I C;  3O62 A;  3X1U D;  2HIO A;  4KUD D;  5B1L B;  4XZQ A;  3MGQ C;  3REH C;  4J8X B;  5AVC A;  2BYK A;  3C1C C;  3REJ C;  5CPK A;  1P3L C;  3AZH A;  2ZY2 A;  3AZE C;  1KU5 A;  1U35 B;  2Y2Q A;  4ZBJ B;  5FUG B;  1N1J A;  4CSR A;  5B2J A;  3AZM D;  3REI C;  5DNM D;  4LD9 C;  2Y2O A;  4J8W C;  5AY8 D;  3AV1 C;  3B6F A;  3LZ1 B;  5JRG B;  4HGA B;  2IO5 C;  5B40 D;  3AZI D;  5GSU D;  4UPK A;  5CPJ B;  3V9R A;  1H3O A;  3NQJ A;  4ZUX C;  4J8V B;  3W97 C;  5E5A D;  4H9P B;  4H9Q A;  3KXB B;  4Z66 C;  5B32 G;  1KX4 B;  4Z5T A;  1TAF A;  3UT9 C;  3MGR A;  1M18 A;  1KX4 D;  3X1S A;  3LEL A;  4J8U C;  3LJA B;  4X23 C;  1HQ3 C;  2CV5 C;  5CP6 D;  5DNN C;  3C1B C;  3TU4 A;  1KX3 C;  5GXQ C;  3MNN A;  3AZN A;  1P3G D;  1AOI D;  5B2I D;  5B0Z B;  5B33 C;  4YM6 B;  3WTP B;  3WKJ B;  3MGQ D;  3W99 C;  3REH D;  4WV4 B;  1P3P C;  1ID3 D;  3C1C D;  3REJ D;  5B1L A;  3AZE B;  1P3L D;  2Y2M A;  4J8X A;  3AZJ B;  3AZE D;  1P3I C;  3AN2 C;  3MGP C;  1B67 A;  2JCH A;  3WAA B;  2F2A C;  3REI D;  1U35 A;  4LD9 D;  4J8W D;  3AZG D;  5JA4 B;  1P3M C;  3AV1 D;  3WTP E;  2Y2I A;  1P34 C;  3LZ1 A;  5JRG A;  4ZUX B;  4R8P B;  3AV2 C;  2FJ7 D;  4XUJ C;  4ZUX D;  1M1A C;  3W97 D;  3UTA B;  1EQZ C;  2NQB D;  2RVQ C;  5CPJ A;  4Z66 B;  4J8V A;  4Z66 D;  3VH5 W;  5AV6 B;  3P5J B;  1T3U A;  4H9P A;  3KXB A;  4YS3 B;  3UT9 D;  2NZD D;  2VQR A;  4J8U D;  4KGC B;  1KX4 A;  2ZM5 A;  3H0M C;  2CV5 B;  4X23 D;  3C1B B;  1HQ3 D;  5B31 D;  3UTB C;  5B24 B;  4QLC C;  5DNN D;  3LZ0 C;  3C1B D;  3LJA A;  5GXQ D;  1KX3 D;  3B6G B;  1BH8 B;  1W2E A;  4JJN C;  3REK C;  5AVB B;  4CAY B;  5B33 D;  3W99 B;  3W99 D;  4M6B A;  3AYW C;  1P3P D;  4WNN B;  5B0Z A;  4YM6 A;  3WTP A;  3WKJ A;  3AN2 B;  1P3I D;  3AN2 D;  3VH5 T;  2HUE C;  5AV8 C;  5AV5 C;  3MGP D;  1M19 C;  5GT3 B;  3KWQ C;  2YFV B;  3AZJ A;  3MGS C;  4H9N B;  5BS7 A;  3WA9 C;  3WAA A;  1P3M D;  1A7W A;  3X1V B;  2LY8 A;  2XD1 A;  5JA4 A;  4AWL B;  2ZY4 A;  5AV9 B;  1P34 D;  3AZF A;  3H0L C;  1P3F D;  3AV2 D;  5CP6 C;  1P3K B;  4XUJ D;  5F99 A;  3A1I A;  4G91 C;  3AZL C;  5CHL B;  1M1A D;  4Z2M G;  1EQZ D;  3B0C T;  4R8P A;  2RVQ D;  1P3G C;  1BFM A;  1P3B C;  5B1M C;  3UTA A;  3X1U B;  4NFT A;  4Z66 A;  3X1T C;  5AV6 A;  2ZY5 A;  1ID3 C;  4H9S A;  4YS3 A;  3UTB B;  3VH6 A;  3LZ0 B;  3UTB D;  4QLC D;  3LZ0 D;  3AZM B;  4KGC A;  3A1K A;  2CV5 A;  5DNM B;  4JJN B;  5B24 A;  4DQY B;  4JJN D;  1PZR A;  5AY8 B;  3REK D;  3AZG C;  3B6G A;  1BH8 A;  5B0Y C;  5B40 B;  3AZI B;  5GSU B;  5CPI C;  5AVB A;  3MVD C;  4CAY A;  4Z2M H;  4WZS B;  3AYW D;  5KDM B;  3A6N D;  1KX5 C;  1ZLA C;  2FJ7 C;  4WNN A;  5E5A B;  5AV8 D;  2NQB C;  5AV5 D;  3AN2 A;  1M19 D;  3KWQ D;  4NE3 A;  3MGS D;  3WA9 B;  3WA9 D;  1TZY C;  3AZK C;  4WU9 C;  5GT3 A;  2DQN C;  1P3A C;  1F66 A;  4H9N A;  3AFA C;  2NZD C;  1B6W A;  3KUY C;  3X1V A;  5CP6 B;  5B31 C;  5AV9 A;  1P3O C;  1S32 C;  3AZL D;  3EPL A;  1P3G B;  1AOI B;  4KHA B;  1P3K A;  1P3B D;  2F8N D;  5B2I B;  5G49 B;  5B1M D;  2F8N K;  4WU8 C;  2PYO C;  3X1T B;  2Y2H A;  3REL C;  3W96 C;  3W98 C;  3MGQ B;  1F1E A;  3X1T D;  3REH B;  1ID3 B;  3O62 C;  3X1U A;  2HIO C;  4KUD A;  3C1C B;  3REJ B;  2CWE A;  2YFW B;  1P3L B;  4XZQ C;  5CPK C;  3AZH C;  1WWS A;  5GT0 C;  3REI B;  3UTB A;  3LZ0 A;  4LD9 B;  4J8W B;  5B2J C;  3AZM A;  3AZG B;  4NE6 A;  5FUG A;  5B0Y B;  3AV1 B;  2BYM B;  5DNM A;  2IO5 B;  5B0Y D;  5AY8 A;  5CPI D;  3MVD D;  3B6F C;  3EPJ A;  5B40 A;  3AZI A;  1KX5 D;  5GSU A;  2FJ7 B;  1P3F C;  1ZLA D;  3W97 B;  2NQB B;  5KDM A;  1WWI A;  3B0D C;  1BH9 B;  5E5A A;  4G92 C;  1TZY D;  4WU9 D;  3UT9 B;  3AZK D;  1P3A D;  2NZD B;  5B32 D;  4EO5 C;  3AFA D;  4J8U B;  4Z5T C;  3KUY D;  3MGR C;  4X23 B;  2BG1 A;  1HQ3 B;  5B31 B;  3X1S C;  5DNN B;  1S32 B;  3R45 B;  5GXQ B;  1KX3 B;  1P3O D;  1S32 D;  2UWX A;  1JFI B;  5CP6 A;  3TU4 C;  2L5A A; 
#chains in the Genus database with same CATH homology
 5B33 B;  4WU8 D;  1P3G A;  2PYO D;  3W96 B;  3B0C W;  1AOI A;  3REL D;  4KHA A;  3W96 D;  3W98 D;  1P3P B;  5G49 A;  5B2I A;  3O62 D;  2HIO D;  3X1T A;  3A6N C;  3MGQ A;  4XZQ D;  3REH A;  1ID3 A;  5AVC D;  1P3I B;  3AZH B;  3C1C A;  3MGP B;  2YFW A;  5GT0 B;  3REJ A;  5B1L C;  3AZH D;  3NQU B;  5CPK D;  1P3L A;  5GT0 D;  4J8X C;  3AZE A;  2ARO C;  5B2J D;  4E45 A;  3REI A;  1P3M B;  4LD9 A;  4J8W A;  3AZG A;  5BT1 C;  1P34 B;  5B0Y A;  3AV1 A;  3B6F D;  2BYM A;  3EPH A;  1P3F B;  3AV2 B;  4XUJ B;  1M1A B;  3LZ1 C;  1EQZ B;  4HGA C;  4DRA A;  5JRG C;  5BNV B;  2FJ7 A;  4ZUX A;  3W97 A;  2NQB A;  4G92 B;  5CPJ C;  1BH9 A;  5BNX B;  4J8V C;  1R4V A;  3KXB C;  2XD5 A;  4Z5T D;  3UT9 A;  3MGR D;  2NZD A;  3X1S D;  3LEL D;  4J8U A;  4QLC B;  2ZY3 A;  4X23 A;  1HQ3 A;  5B31 A;  3IP4 C;  5DNN A;  3C1B A;  3TU4 D;  3R45 A;  3VH6 W;  5GXQ A;  3MNN D;  3REK B;  3AZN D;  1KX3 A;  1JFI A;  3H0R C;  3AYW B;  5C3I C;  5B33 A;  3A6N B;  1P3P A;  3W99 A;  5B0Z C;  4YM6 C;  2HUE B;  5AV8 B;  5AV5 B;  3WTP C;  5B1L D;  3WKJ C;  2JSS A;  1M19 B;  2ARO B;  3KWQ B;  4J8X D;  3MGS B;  1P3I A;  2ARO D;  3MGP A;  5GT0 A;  3NQU A;  3AZJ C;  2G5H C;  1U35 D;  2YFV A;  5BS7 C;  3WAA C;  5BT1 D;  5B32 C;  1P3M A;  1ULY A;  4UUZ B;  4DRB A;  3VH6 T;  1P34 A;  3AZF C;  3EG5 B;  4G91 B;  3AZL B;  3LZ1 D;  2F8N H;  5JRG D;  1P3F A;  3AV2 A;  2DF4 C;  4XUJ A;  5F99 C;  1P3B B;  1M1A A;  2F8N B;  5B1M B;  1EQZ A;  3FDD A;  4R8P C;  3AL0 C;  5CPJ D;  5BNV A;  4J8V D;  3UTA C;  5BNX A;  3KXB D;  2G5I C;  5AV6 C;  5AVC C;  4NE5 A;  4H9S C;  4YS3 C;  5B31 G;  4QLC A;  3LJA D;  4KGC C;  3B0B A;  5B24 C;  4JJN A;  3REK A;  5C3I B;  5CPI B;  3MVD B;  3B6G C;  1KX5 B;  5AVB C;  3AYW A;  1ZLA B;  2Y2K A;  5B0Z D;  3A6N A;  4YM6 D;  3WTP D;  3WKJ D;  4H9O B;  5AV8 A;  5AV5 A;  3KFU G;  1TZY B;  3AZK B;  4WU9 B;  1P3A B;  2ARO A;  3KWQ A;  3AZJ D;  3MGS A;  1M19 A;  2RIQ A;  5B32 B;  3AFA B;  3EPK A;  3WA9 A;  5BO0 B;  3WAA D;  2Y2N A;  3KUY B;  5GT3 C;  1F66 C;  3AZF B;  1M18 C;  3LEL C;  1HTA A;  1P3O B;  3AZF D;  3X1V C;  4UUZ A;  5F99 B;  3KSY A;  4AWL C;  5AV9 C;  5F99 D;  3AZL A;  3MNN C;  3AZN C;  4WU8 B;  2PYO B;  4R8P D;  3REL B;  4H9R B;  3VH5 A;  3W98 B;  1P3B A;  1P3K C;  2F8N A;  5B1M A;  3O62 B;  4E44 A;  3UTA D;  2HIO B;  3F6T A;  4XZQ B;  5AVC B;  3X1U C;  4KUD C;  5AV6 D;  2BYK B;  5CPK B;  4YS3 D;  2FFF B;  1N1J B;  4CSR B;  5B2J B;  4KGC D;  2Y2L A;  2CV5 D;  4WJ3 C;  5B24 D;  3AZM C;  1Z2C B;  4ZBJ C;  1U35 C;  2JE5 A;  3B6F B;  3B6G D;  5DNM C;  5AY8 C;  5CPI A;  5AVB D;  3MVD A;  5B40 C;  2Y2P A;  3B0D B;  3AZI C;  1KX5 A;  3V9R B;  5GSU C;  1H3O B;  2J8P A;  3NQJ B;  1ZLA A;  2Y2J A;  4H9Q B;  4H9O A;  5E5A C;  1Q9C A;  4EO5 B;  1F66 B;  1TZY A;  3AZK A;  4Z5T B;  1TAF B;  2Y2G A;  5GT3 D;  3MGR B;  4WU9 A;  1P3A A;  1M18 B;  1F66 D;  3X1S B;  3LEL B;  5B32 A;  3AFA A;  1M18 D;  5BO0 A;  3KUY A;  1KX4 C;  3X1V D;  3TU4 B;  3MNN B;  3AZN B;  5AV9 D;  1P3O A;  1S32 A;  3LJA C;  2F8N G;  1P3K D;  2W8S A;  4WU8 A;  2PYO A;  1AOI C;  3REL A;  4H9R A;  3W96 A;  3W98 A;  4KUD B;  5B2I C;  3O62 A;  3X1U D;  2HIO A;  4KUD D;  5B1L B;  4XZQ A;  3MGQ C;  3REH C;  4J8X B;  5AVC A;  2BYK A;  3C1C C;  3REJ C;  5CPK A;  1P3L C;  3AZH A;  2ZY2 A;  3AZE C;  1KU5 A;  1U35 B;  2Y2Q A;  4ZBJ B;  5FUG B;  1N1J A;  4CSR A;  5B2J A;  3AZM D;  3REI C;  5DNM D;  4LD9 C;  2Y2O A;  4J8W C;  5AY8 D;  3AV1 C;  3B6F A;  3LZ1 B;  5JRG B;  4HGA B;  2IO5 C;  5B40 D;  3AZI D;  5GSU D;  4UPK A;  5CPJ B;  3V9R A;  1H3O A;  3NQJ A;  4ZUX C;  4J8V B;  3W97 C;  5E5A D;  4H9P B;  4H9Q A;  3KXB B;  4Z66 C;  5B32 G;  1KX4 B;  4Z5T A;  1TAF A;  3UT9 C;  3MGR A;  1M18 A;  1KX4 D;  3X1S A;  3LEL A;  4J8U C;  3LJA B;  4X23 C;  1HQ3 C;  2CV5 C;  5CP6 D;  5DNN C;  3C1B C;  3TU4 A;  1KX3 C;  5GXQ C;  3MNN A;  3AZN A;  1P3G D;  1AOI D;  5B2I D;  5B0Z B;  5B33 C;  4YM6 B;  3WTP B;  3WKJ B;  3MGQ D;  3W99 C;  3REH D;  4WV4 B;  1P3P C;  1ID3 D;  3C1C D;  3REJ D;  5B1L A;  3AZE B;  1P3L D;  2Y2M A;  4J8X A;  3AZJ B;  3AZE D;  1P3I C;  3AN2 C;  3MGP C;  1B67 A;  2JCH A;  3WAA B;  2F2A C;  3REI D;  1U35 A;  4LD9 D;  4J8W D;  3AZG D;  5JA4 B;  1P3M C;  3AV1 D;  3WTP E;  2Y2I A;  1P34 C;  3LZ1 A;  5JRG A;  4ZUX B;  4R8P B;  3AV2 C;  2FJ7 D;  4XUJ C;  4ZUX D;  1M1A C;  3W97 D;  3UTA B;  1EQZ C;  2NQB D;  2RVQ C;  5CPJ A;  4Z66 B;  4J8V A;  4Z66 D;  3VH5 W;  5AV6 B;  3P5J B;  1T3U A;  4H9P A;  3KXB A;  4YS3 B;  3UT9 D;  2NZD D;  2VQR A;  4J8U D;  4KGC B;  1KX4 A;  2ZM5 A;  3H0M C;  2CV5 B;  4X23 D;  3C1B B;  1HQ3 D;  5B31 D;  3UTB C;  5B24 B;  4QLC C;  5DNN D;  3LZ0 C;  3C1B D;  3LJA A;  5GXQ D;  1KX3 D;  3B6G B;  1BH8 B;  1W2E A;  4JJN C;  3REK C;  5AVB B;  4CAY B;  5B33 D;  3W99 B;  3W99 D;  4M6B A;  3AYW C;  1P3P D;  4WNN B;  5B0Z A;  4YM6 A;  3WTP A;  3WKJ A;  3AN2 B;  1P3I D;  3AN2 D;  3VH5 T;  2HUE C;  5AV8 C;  5AV5 C;  3MGP D;  1M19 C;  5GT3 B;  3KWQ C;  2YFV B;  3AZJ A;  3MGS C;  4H9N B;  5BS7 A;  3WA9 C;  3WAA A;  1P3M D;  1A7W A;  3X1V B;  2LY8 A;  2XD1 A;  5JA4 A;  4AWL B;  2ZY4 A;  5AV9 B;  1P34 D;  3AZF A;  3H0L C;  1P3F D;  3AV2 D;  5CP6 C;  1P3K B;  4XUJ D;  5F99 A;  3A1I A;  4G91 C;  3AZL C;  5CHL B;  1M1A D;  4Z2M G;  1EQZ D;  3B0C T;  4R8P A;  2RVQ D;  1P3G C;  1BFM A;  1P3B C;  5B1M C;  3UTA A;  3X1U B;  4NFT A;  4Z66 A;  3X1T C;  5AV6 A;  2ZY5 A;  1ID3 C;  4H9S A;  4YS3 A;  3UTB B;  3VH6 A;  3LZ0 B;  3UTB D;  4QLC D;  3LZ0 D;  3AZM B;  4KGC A;  3A1K A;  2CV5 A;  5DNM B;  4JJN B;  5B24 A;  4DQY B;  4JJN D;  1PZR A;  5AY8 B;  3REK D;  3AZG C;  3B6G A;  1BH8 A;  5B0Y C;  5B40 B;  3AZI B;  5GSU B;  5CPI C;  5AVB A;  3MVD C;  4CAY A;  4Z2M H;  4WZS B;  3AYW D;  5KDM B;  3A6N D;  1KX5 C;  1ZLA C;  2FJ7 C;  4WNN A;  5E5A B;  5AV8 D;  2NQB C;  5AV5 D;  3AN2 A;  1M19 D;  3KWQ D;  4NE3 A;  3MGS D;  3WA9 B;  3WA9 D;  1TZY C;  3AZK C;  4WU9 C;  5GT3 A;  2DQN C;  1P3A C;  1F66 A;  4H9N A;  3AFA C;  2NZD C;  1B6W A;  3KUY C;  3X1V A;  5CP6 B;  5B31 C;  5AV9 A;  1P3O C;  1S32 C;  3AZL D;  3EPL A;  1P3G B;  1AOI B;  4KHA B;  1P3K A;  1P3B D;  2F8N D;  5B2I B;  5G49 B;  5B1M D;  2F8N K;  4WU8 C;  2PYO C;  3X1T B;  2Y2H A;  3REL C;  3W96 C;  3W98 C;  3MGQ B;  1F1E A;  3X1T D;  3REH B;  1ID3 B;  3O62 C;  3X1U A;  2HIO C;  4KUD A;  3C1C B;  3REJ B;  2CWE A;  2YFW B;  1P3L B;  4XZQ C;  5CPK C;  3AZH C;  1WWS A;  5GT0 C;  3REI B;  3UTB A;  3LZ0 A;  4LD9 B;  4J8W B;  5B2J C;  3AZM A;  3AZG B;  4NE6 A;  5FUG A;  5B0Y B;  3AV1 B;  2BYM B;  5DNM A;  2IO5 B;  5B0Y D;  5AY8 A;  5CPI D;  3MVD D;  3B6F C;  3EPJ A;  5B40 A;  3AZI A;  1KX5 D;  5GSU A;  2FJ7 B;  1P3F C;  1ZLA D;  3W97 B;  2NQB B;  5KDM A;  1WWI A;  3B0D C;  1BH9 B;  5E5A A;  4G92 C;  1TZY D;  4WU9 D;  3UT9 B;  3AZK D;  1P3A D;  2NZD B;  5B32 D;  4EO5 C;  3AFA D;  4J8U B;  4Z5T C;  3KUY D;  3MGR C;  4X23 B;  2BG1 A;  1HQ3 B;  5B31 B;  3X1S C;  5DNN B;  1S32 B;  3R45 B;  5GXQ B;  1KX3 B;  1P3O D;  1S32 D;  2UWX A;  1JFI B;  5CP6 A;  3TU4 C;  2L5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...