4QLCC

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
molecule keywords DNA (167-mer)
total genus 27
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcC00
1H3OA 1P3OB 5CPID 2CV5D 4G91C 2L5AA 2YFVB 3W97B 5DNNA 3LZ1D 3AV1A 1P3FD 3LELD 5B1LD 1A7WA 2HIOD 1KX5D 1U35D 4H9QB 5BS7A 1M19A 3REKA 1KX3D 1M18C 4NE3A 3MGQB 3AZEC 4X23C 3AZMC 3V9RA 3MVDB 5JRGD 1P34D 4XZQA 2CV5A 3X1TA 5B2JB 5AV6D 2YFVA 4QLCD 3LJAC 3AV1B 3W99B 1ID3D 5DNNB 5B2IB 4ZUXB 3UTBC 4JJND 3KUYA 3UTAD 1TAFB 3AZLD 5CPJB 4KGCD 3W96C 1JFIA 4Z2MG 3WTPE 5AV9A 2NQBB 4X23A 4XZQC 3WTPD 1AOIA 4E45A 5B33A 1Q9CA 3V9RB 1P3KC 5B0YB 1M18D 2RVQD 5B2JA 2BYMA 1P3IA 4J8VB 2LY8A 3REJB 4ZBJB 4XUJD 3W98B 3X1UB 4KGCA 3REIA 4WNNB 2NZDA 4KUDB 4YS3C 3AYWD 3WAAB 1B6WA 5B33C 5GXQC 4X23B 3WAAC 2F8ND 5B1MD 1TZYD 3AZKB 3W96B 3O62C 5GT3C 4YS3A 5CP6D 1P3ID 2HUEB 1WWSA 1M18A 5B32C 2HUEC 4UUZA 3REKD 2F8NH 3AFAC 3REJA 4J8XD 3AN2A 5CPIB 3REIC 2CV5B 1P3OC 1ZLAB 1F66C 4R8PA 3REIB 2CV5C 3LZ1B 3REHD 1M1AC 5AV6A 1P3FB 3AZHD 5B1LB 5B32A 3W97C 4XUJC 1KX4D 3X1TD 5GSUC 4JJNA 5B1MA 1JFIB 5AV5A 3MGQD 3W96A 2PYOC 3B6GA 1N1JA 1P3BA 5JRGB 5BNXB 3VH5T 3R45A 1P34B 1U35A 2FJ7C 1P3OA 5B2JD 5AY8D 3B0CW 5AVBD 5AV6B 3RELB 3AV1D 1P3FA 1BH8A 5DNND 3LZ1A 4ZUXD 3X1VC 4JJNB 3UTAB 3AZLB 4KGCB 5CPJC 3C1CD 1P3MC 3REHC 3AYWA 5B40B 3LELC 3NQJB 2NQBC 5BNXA 4LD9B 4CSRB 3A6NA 4H9RB 1ZLAC 4J8VD 3REJD 4XUJB 4KHAB 3B6FA 3X1UD 3MNNA 5B0ZA 4DRBA 4J8WA 2FJ7B 3KUYB 3AYWB 4M6BA 4QLCC 3WA9D 2F8NB 2BYMB 5GXQB 1TZYB 3AZKD 3W96D 1P3MB 5CP6B 4H9SC 3O62B 2NZDD 4HGAB 3REKB 2AROA 5JRGA 3MNNB 2IO5B 4J8XB 3B6FC 1ZLAD 4J8WC 3AZKA 5CPIC 3REID 3REHB 4J8WB 3AZIA 1F66D 1KU5A 2F8NK 2FJ7A 3AZHB 3WKJC 3UT9B 1KX4B 3MVDC 3X1TB 5AVCC 5GSUD 5B31A 3KWQC 3W99A 5B40A 1P3MA 5GT0B 3AZGA 3AZKC 5F99A 4UUZB 4EO5B 2AROD 4Z66C 1P3GB 5AY8B 5CPIA 3VH5A 5AVBB 3RELD 5AV5D 3B6GD 3A6ND 4YM6B 4KHAA 2IO5C 3B6FB 3MGRA 3X1VD 1N1JB 3C1CB 3MGSC 5B40D 3AZHC 3WKJB 5BS7C 3MGRC 1S32D 3WAAA 4LD9D 1P3GA 4Z2MH 5G49B 5C3IB 5C3IC 1P3PB 3REJC 5B24B 1P3LA 1F66A 2FJ7D 3KUYD 3UTAA 3AZLA 3AV2C 3TU4A 3KXBD 4KUDC 3WA9B 3AZHA 3AYWC 3UT9A 5GXQD 3WKJA 5B31C 3KWQA 1BFMA 1AOIC 3AZMB 4XUJA 1P3MD 5CHLB 5B0ZB 3O62D 4WNNA 2NZDB 5CP6C 2NZDC 1KX5C 4H9PB 5FUGB 3MNND 5AV8A 5AY8A 4AWLC 3TU4B 4J8WD 1F66B 1ID3A 3UT9D 1P3BC 3MGSA 4H9NA 5GSUB 1TZYA 2YFWA 4WU8A 5GT3A 1F1EA 5BO0B 5AV6C 3LJAD 5GT0D 1TAFA 5CPJA 1ID3C 4WU9A 5B0YC 3AZIB 5FUGA 3AZJC 3VH6W 5DNMD 2JSSA 3AN2C 2AROB 5JRGC 1P3GD 1EQZA 4R8PC 5AV5B 3B6GB 4CSRA 3A6NB 4WU9C 4YM6D 3B6FD 5AV5C 3B6GC 4Z5TC 5B24A 3X1VB 1P3LB 4ZUXC 4WU8C 3X1SD 2YFWB 2PYOA 3WKJD 5B32G 1EQZD 5BNVA 3LZ0A 4J8UA 3LZ1C 4G92C 3RELA 2F8NG 1S32B 3AZGB 3UTBA 5GT0C 1P3PD 1B67A 1H3OB 5B24D 3AZND 4YM6A 5B1LC 4R8PD 3X1SA 1KX4C 3RELC 3AV2D 3KXBB 4H9RA 3LELA 4J8XA 3LZ0C 4J8UC 3WA9C 3AZIC 5BNVB 3LZ0B 3AFAB 4J8UB 5GSUA 3UTBB 3AZMD 4WU8B 5B1LA 4KGCC 5B0ZD 3MGQA 3KSYA 1P3AB 1M19C 5CPKA 3C1BB 2HIOC 1R4VA 1U35C 2F8NA 4LD9C 5AVBC 5F99C 3TU4D 4G91B 2CWEA 3AZMA 1P34A 1P3PC 4ZUXA 3WA9A 4ZBJC 5AVBA 3B0BA 5AVCB 5E5AC 5E5AB 3LJAB 3AV1C 3MGRB 3MGPD 5CPKC 2BYKA 1P3AA 3WTPA 3AZID 1AOID 5DNMB 1KX5A 4EO5C 3MGSB 2AROC 4Z66D 4J8VA 5B32D 1P3LD 3NQUA 4Z5TD 5B1MC 3W99C 3TU4C 3X1SB 1TZYC 3AZEA 5AVCA 1KX3A 3B0DC 3UT9C 1EQZB 1P3FC 3VH6A 1M1AB 4G92B 3AZGD 3AZJA 3AZFC 4YS3D 4XZQB 3KWQB 3MGPC 5CPKB 1KX3C 5KDMB 3AZED 2PYOB 5CP6A 3AZNB 3O62A 4R8PB 1P34C 4CAYB 3AV2B 5AV9C 4NE6A 4H9OB 5BT1C 5AV8C 5AV9B 3REKC 1M1AA 3LZ0D 3AFAD 4J8UD 3UTBD 4WU8D 3UTAC 3AZLC 4JJNC 3B0CT 1P3AD 3MGPA 3C1BD 1M19D 1P3BB 3X1TC 1BH9A 5B2JC 1WWIA 5GT3B 3AZGC 3AZFD 5BO0A 3X1UA 1P3KD 3AZNA 1HQ3D 5F99B 4H9OA 4WZSB 4H9SA 4Z5TA 5B24C 3C1BA 1ULYA 4H9PA 3X1UC 4E44A 5AVCD 3W98C 5AY8C 4NE5A 5E5AD 3VH6T 3MGPB 3MGRD 5AV8B 3W97A 5DNNC 1AOIB 3C1CA 5B33B 5DNMC 3AZJB 3AN2D 3MGSD 1HQ3A 1P3GC 4Z66B 3C1BC 1S32A 5B31G 3W98A 5B32B 4YM6C 3A6NC 3MVDA 4WU9B 4NFTA 4Z5TB 1P3LC 4KUDA 5B31D 5B2IC 4CAYA 3AV2A 1P3OD 5GXQA 3B0DB 1EQZC 3LJAA 4QLCA 1M1AD 2BYKB 4DRAA 3W97D 1HTAA 4HGAC 5DNMA 3LELB 3KUYC 4YS3B 2HIOB 1KX5B 4XZQD 3X1VA 3KWQD 4Z66A 1U35B 5CPKD 3AFAA 3MGQC 3AZEB 2PYOD 2NQBA 1BH9B 1KX3B 2RVQC 5B2IA 1P3KA 3NQUB 3MVDD 3REHA 5JA4B 5AV9D 3KXBC 3MNNC 4QLCB 3W99D 1ID3B 5B2ID 5B0YA 5B0ZC 3C1CC 5CPJD 4H9NB 5GT0A 1P3AC 1M19B 1P3BD 3KXBA 5GT3D 5KDMA 3AZFB 3VH5W 2NQBD 3WTPC 1P3KB 1S32C 1HQ3B 3WTPB 5F99D 1HQ3C 1BH8B 4AWLB 5JA4A 4J8XC 5B0YD 1M18B 3X1SC 4J8VC 4WV4B 3W98D 3NQJA 5BT1D 5AV8D 4KUDD 5B33D 3WAAD 4LD9A 3AZFA 3AZJD 4X23D 3AN2B 5B1MB 2HIOA 1ZLAA 5B40C 5G49A 4H9QA 3AZNC 1P3IC 1P3PA 5E5AA 1P3IB 1KX4A 4WU9D 3R45B 5B31B
chains in the Genus database with same CATH superfamily
1H3OA 1P3OB 5CPID 2CV5D 4G91C 2L5AA 2YFVB 3W97B 5DNNA 3LZ1D 3AV1A 1P3FD 3LELD 5B1LD 1A7WA 2HIOD 1KX5D 1U35D 4H9QB 5BS7A 1M19A 2Y2PA 3REKA 2ZM5A 1KX3D 1M18C 4NE3A 2DQNC 3MGQB 3AZEC 4X23C 3AZMC 4DQYB 3V9RA 3MVDB 5JRGD 2Y2HA 1P34D 4XZQA 2CV5A 3X1TA 3H0RC 5B2JB 5AV6D 2YFVA 4QLCD 3LJAC 3AV1B 3W99B 1ID3D 5DNNB 5B2IB 4ZUXB 3UTBC 4JJND 3KUYA 3UTAD 1TAFB 3AZLD 5CPJB 4KGCD 3W96C 1JFIA 4Z2MG 3WTPE 2Y2GA 5AV9A 2NQBB 4X23A 4XZQC 3WTPD 2Y2QA 1AOIA 4E45A 5B33A 1Q9CA 3V9RB 1P3KC 5B0YB 1M18D 2RVQD 5B2JA 2BYMA 1P3IA 2UWXA 4J8VB 2LY8A 3REJB 4ZBJB 4XUJD 3W98B 3X1UB 4KGCA 3REIA 4WNNB 2NZDA 2G5HC 4KUDB 2RIQA 4YS3C 3AYWD 3WAAB 1B6WA 5B33C 5GXQC 4X23B 3WAAC 2F8ND 5B1MD 1TZYD 3AZKB 3W96B 3O62C 5GT3C 4YS3A 5CP6D 1P3ID 2Y2KA 2HUEB 1WWSA 2DF4C 1M18A 5B32C 2ZY2A 2HUEC 4UUZA 3REKD 2F8NH 3AFAC 3REJA 4J8XD 3AN2A 5CPIB 3REIC 2CV5B 1P3OC 1ZLAB 1F66C 4R8PA 3REIB 2CV5C 3LZ1B 3REHD 1M1AC 5AV6A 1P3FB 3AZHD 5B1LB 5B32A 3W97C 4XUJC 1KX4D 2FFFB 3X1TD 5GSUC 4JJNA 5B1MA 2Y2MA 2Y2IA 1JFIB 5AV5A 3MGQD 3W96A 2PYOC 3B6GA 3AL0C 1N1JA 1P3BA 5JRGB 5BNXB 3VH5T 3R45A 1P34B 1U35A 2FJ7C 1P3OA 5B2JD 5AY8D 3B0CW 5AVBD 5AV6B 3RELB 3AV1D 1P3FA 3EPJA 1BH8A 5DNND 3LZ1A 4ZUXD 3X1VC 4JJNB 3UTAB 3AZLB 4KGCB 5CPJC 3C1CD 4UPKA 1P3MC 3REHC 3AYWA 5B40B 2F2AC 3LELC 3NQJB 2NQBC 3EPKA 5BNXA 4LD9B 4CSRB 3A6NA 4H9RB 1ZLAC 4J8VD 3REJD 4XUJB 4KHAB 3B6FA 3X1UD 3P5JB 5B0ZA 3MNNA 4DRBA 4J8WA 2FJ7B 3KUYB 3AYWB 4M6BA 4QLCC 3WA9D 2F8NB 2BYMB 5GXQB 1TZYB 3AZKD 2BG1A 3W96D 1P3MB 5CP6B 2JE5A 4H9SC 3O62B 2NZDD 4HGAB 2J8PA 3REKB 2AROA 5JRGA 3MNNB 2IO5B 4J8XB 3B6FC 1ZLAD 4J8WC 3AZKA 5CPIC 3REID 3REHB 4J8WB 3AZIA 3FDDA 1KU5A 1F66D 2F8NK 3AZHB 2FJ7A 3WKJC 3UT9B 1KX4B 3MVDC 3X1TB 5AVCC 5GSUD 5B31A 3KWQC 3W99A 5B40A 1P3MA 5GT0B 3AZGA 3AZKC 5F99A 4UUZB 4EO5B 2AROD 4Z66C 1P3GB 5AY8B 5CPIA 3VH5A 5AVBB 3RELD 5AV5D 3B6GD 3A6ND 4YM6B 2IO5C 4KHAA 3B6FB 3MGRA 3X1VD 1N1JB 3C1CB 3MGSC 5B40D 3AZHC 3WKJB 5BS7C 3MGRC 2Y2JA 1S32D 3WAAA 4LD9D 1P3GA 4Z2MH 5G49B 5C3IB 3A1KA 5C3IC 1P3PB 3REJC 5B24B 1P3LA 1F66A 2FJ7D 3KUYD 3UTAA 3AZLA 3AV2C 3TU4A 3KXBD 4KUDC 3WA9B 3AZHA 3AYWC 3UT9A 5GXQD 3WKJA 5B31C 3KWQA 1BFMA 1AOIC 3AZMB 4XUJA 1P3MD 5CHLB 5B0ZB 2Y2OA 3O62D 4WNNA 3A1IA 5CP6C 2NZDB 2NZDC 1KX5C 4H9PB 5FUGB 3MNND 5AV8A 5AY8A 4AWLC 3TU4B 4J8WD 1F66B 1ID3A 3UT9D 1P3BC 3MGSA 4H9NA 5GSUB 1TZYA 2YFWA 3H0LC 4WU8A 5GT3A 1F1EA 5BO0B 5AV6C 3LJAD 1TAFA 5GT0D 5CPJA 1ID3C 4WU9A 5B0YC 3AZIB 5FUGA 3AZJC 3VH6W 5DNMD 2JSSA 2G5IC 3AN2C 2AROB 5JRGC 1P3GD 1EQZA 4R8PC 2ZY3A 5AV5B 3B6GB 4CSRA 3A6NB 4WU9C 4YM6D 3B6FD 5AV5C 3B6GC 3KFUG 4Z5TC 5B24A 3X1VB 1P3LB 4ZUXC 2JCHA 4WU8C 1PZRA 3X1SD 2YFWB 2PYOA 3WKJD 5B32G 1EQZD 5BNVA 3LZ0A 4J8UA 3LZ1C 4G92C 2XD5A 3RELA 2F8NG 1S32B 3AZGB 3UTBA 5GT0C 1P3PD 1B67A 1H3OB 5B24D 3AZND 4YM6A 5B1LC 4R8PD 3X1SA 1KX4C 3RELC 3AV2D 3KXBB 4H9RA 3LELA 4J8XA 3LZ0C 4J8UC 3WA9C 3AZIC 5BNVB 3LZ0B 3AFAB 4J8UB 5GSUA 3UTBB 3AZMD 4WU8B 4WJ3C 5B1LA 4KGCC 5B0ZD 3MGQA 3KSYA 1P3AB 1M19C 5CPKA 3C1BB 2HIOC 1R4VA 1U35C 2F8NA 4LD9C 5AVBC 5F99C 3TU4D 4G91B 2CWEA 3AZMA 1P34A 1P3PC 4ZUXA 3WA9A 4ZBJC 5AVBA 3B0BA 5AVCB 5E5AC 5E5AB 3LJAB 3AV1C 3MGRB 3MGPD 5CPKC 2BYKA 1P3AA 3WTPA 3AZID 1AOID 5DNMB 1KX5A 4EO5C 3MGSB 2AROC 4Z66D 4J8VA 5B32D 1P3LD 3NQUA 4Z5TD 5B1MC 3W99C 3TU4C 3X1SB 1TZYC 3AZEA 5AVCA 1KX3A 3B0DC 3UT9C 1EQZB 3EG5B 1P3FC 3VH6A 1M1AB 4G92B 3AZGD 3AZJA 3AZFC 4YS3D 4XZQB 3KWQB 3MGPC 5CPKB 1KX3C 5KDMB 3AZED 2PYOB 5CP6A 3AZNB 3O62A 4R8PB 1P34C 4CAYB 3AV2B 5AV9C 4NE6A 4H9OB 5BT1C 5AV8C 5AV9B 2Y2LA 3REKC 1M1AA 3LZ0D 3AFAD 4J8UD 1T3UA 3UTBD 4WU8D 3UTAC 3AZLC 4JJNC 3B0CT 1W2EA 1P3AD 3MGPA 3C1BD 1M19D 1P3BB 3X1TC 1BH9A 5B2JC 1WWIA 5GT3B 3AZGC 3AZFD 5BO0A 3X1UA 1P3KD 3AZNA 2VQRA 1HQ3D 3EPLA 5F99B 4H9OA 4WZSB 4H9SA 4Z5TA 5B24C 3C1BA 1ULYA 4H9PA 3X1UC 4E44A 5AVCD 3W98C 5AY8C 4NE5A 5E5AD 3VH6T 3MGPB 3MGRD 5AV8B 3W97A 5DNNC 1AOIB 3C1CA 5B33B 3F6TA 5DNMC 3AZJB 3AN2D 3MGSD 1HQ3A 1P3GC 4Z66B 3C1BC 1S32A 2ZY4A 5B31G 3W98A 5B32B 3IP4C 4YM6C 3A6NC 3MVDA 4WU9B 4NFTA 4Z5TB 1P3LC 4KUDA 5B31D 5B2IC 4CAYA 3AV2A 1P3OD 5GXQA 3B0DB 1EQZC 3LJAA 4QLCA 1M1AD 2BYKB 4DRAA 3W97D 1HTAA 4HGAC 5DNMA 3LELB 3KUYC 4YS3B 2HIOB 1KX5B 4XZQD 3X1VA 3KWQD 4Z66A 1U35B 5CPKD 3AFAA 3MGQC 3AZEB 2PYOD 2NQBA 1BH9B 1KX3B 2RVQC 5B2IA 2Y2NA 1P3KA 3NQUB 3MVDD 3REHA 5JA4B 5AV9D 3KXBC 3H0MC 3MNNC 4QLCB 2W8SA 3W99D 1ID3B 5B2ID 5B0YA 5B0ZC 3C1CC 5CPJD 4H9NB 5GT0A 1P3AC 1M19B 1P3BD 3KXBA 2XD1A 5GT3D 5KDMA 3AZFB 3VH5W 2NQBD 3WTPC 1P3KB 1S32C 1HQ3B 3WTPB 5F99D 1HQ3C 1BH8B 4AWLB 5JA4A 4J8XC 2ZY5A 5B0YD 1M18B 3X1SC 4J8VC 4WV4B 3W98D 3EPHA 3NQJA 1Z2CB 5BT1D 5AV8D 4KUDD 5B33D 3WAAD 4LD9A 3AZFA 3AZJD 4X23D 3AN2B 5B1MB 2HIOA 1ZLAA 5B40C 5G49A 4H9QA 3AZNC 1P3IC 1P3PA 5E5AA 1P3IB 1KX4A 4WU9D 3R45B 5B31B
chains in the Genus database with same CATH topology
1H3OA 1P3OB 5CPID 2CV5D 4G91C 2L5AA 2YFVB 3W97B 5DNNA 3LZ1D 3AV1A 1P3FD 3LELD 5B1LD 1A7WA 2HIOD 1KX5D 1U35D 4H9QB 5BS7A 1M19A 2Y2PA 3REKA 2ZM5A 1KX3D 1M18C 4NE3A 2DQNC 3MGQB 3AZEC 4X23C 3AZMC 4DQYB 3V9RA 3MVDB 5JRGD 2Y2HA 1P34D 4XZQA 2CV5A 3X1TA 3H0RC 5B2JB 5AV6D 2YFVA 4QLCD 3LJAC 3AV1B 3W99B 1ID3D 5DNNB 5B2IB 4ZUXB 3UTBC 4JJND 3KUYA 3UTAD 1TAFB 3AZLD 5CPJB 4KGCD 3W96C 1JFIA 4Z2MG 3WTPE 2Y2GA 5AV9A 2NQBB 4X23A 4XZQC 3WTPD 2Y2QA 1AOIA 4E45A 5B33A 1Q9CA 3V9RB 1P3KC 5B0YB 1M18D 2RVQD 5B2JA 2BYMA 1P3IA 2UWXA 4J8VB 2LY8A 3REJB 4ZBJB 4XUJD 3W98B 3X1UB 4KGCA 3REIA 4WNNB 2NZDA 2G5HC 4KUDB 2RIQA 4YS3C 3AYWD 3WAAB 1B6WA 5B33C 5GXQC 4X23B 3WAAC 2F8ND 5B1MD 1TZYD 3AZKB 3W96B 3O62C 5GT3C 4YS3A 5CP6D 1P3ID 2Y2KA 2HUEB 1WWSA 2DF4C 1M18A 5B32C 2ZY2A 2HUEC 4UUZA 3REKD 2F8NH 3AFAC 3REJA 4J8XD 3AN2A 5CPIB 3REIC 2CV5B 1P3OC 1ZLAB 1F66C 4R8PA 3REIB 2CV5C 3LZ1B 3REHD 1M1AC 5AV6A 1P3FB 3AZHD 5B1LB 5B32A 3W97C 4XUJC 1KX4D 2FFFB 3X1TD 5GSUC 4JJNA 5B1MA 2Y2MA 2Y2IA 1JFIB 5AV5A 3MGQD 3W96A 2PYOC 3B6GA 3AL0C 1N1JA 1P3BA 5JRGB 5BNXB 3VH5T 3R45A 1P34B 1U35A 2FJ7C 1P3OA 5B2JD 5AY8D 3B0CW 5AVBD 5AV6B 3RELB 3AV1D 1P3FA 3EPJA 1BH8A 5DNND 3LZ1A 4ZUXD 3X1VC 4JJNB 3UTAB 3AZLB 4KGCB 5CPJC 3C1CD 4UPKA 1P3MC 3REHC 3AYWA 5B40B 2F2AC 3LELC 3NQJB 2NQBC 3EPKA 5BNXA 4LD9B 4CSRB 3A6NA 4H9RB 1ZLAC 4J8VD 3REJD 4XUJB 4KHAB 3B6FA 3X1UD 3P5JB 5B0ZA 3MNNA 4DRBA 4J8WA 2FJ7B 3KUYB 3AYWB 4M6BA 4QLCC 3WA9D 2F8NB 2BYMB 5GXQB 1TZYB 3AZKD 2BG1A 3W96D 1P3MB 5CP6B 2JE5A 4H9SC 3O62B 2NZDD 4HGAB 2J8PA 3REKB 2AROA 5JRGA 3MNNB 2IO5B 4J8XB 3B6FC 1ZLAD 4J8WC 3AZKA 5CPIC 3REID 3REHB 4J8WB 3AZIA 3FDDA 1KU5A 1F66D 2F8NK 3AZHB 2FJ7A 3WKJC 3UT9B 1KX4B 3MVDC 3X1TB 5AVCC 5GSUD 5B31A 3KWQC 3W99A 5B40A 1P3MA 5GT0B 3AZGA 3AZKC 5F99A 4UUZB 4EO5B 2AROD 4Z66C 1P3GB 5AY8B 5CPIA 3VH5A 5AVBB 3RELD 5AV5D 3B6GD 3A6ND 4YM6B 2IO5C 4KHAA 3B6FB 3MGRA 3X1VD 1N1JB 3C1CB 3MGSC 5B40D 3AZHC 3WKJB 5BS7C 3MGRC 2Y2JA 1S32D 3WAAA 4LD9D 1P3GA 4Z2MH 5G49B 5C3IB 3A1KA 5C3IC 1P3PB 3REJC 5B24B 1P3LA 1F66A 2FJ7D 3KUYD 3UTAA 3AZLA 3AV2C 3TU4A 3KXBD 4KUDC 3WA9B 3AZHA 3AYWC 3UT9A 5GXQD 3WKJA 5B31C 3KWQA 1BFMA 1AOIC 3AZMB 4XUJA 1P3MD 5CHLB 5B0ZB 2Y2OA 3O62D 4WNNA 3A1IA 5CP6C 2NZDB 2NZDC 1KX5C 4H9PB 5FUGB 3MNND 5AV8A 5AY8A 4AWLC 3TU4B 4J8WD 1F66B 1ID3A 3UT9D 1P3BC 3MGSA 4H9NA 5GSUB 1TZYA 2YFWA 3H0LC 4WU8A 5GT3A 1F1EA 5BO0B 5AV6C 3LJAD 1TAFA 5GT0D 5CPJA 1ID3C 4WU9A 5B0YC 3AZIB 5FUGA 3AZJC 3VH6W 5DNMD 2JSSA 2G5IC 3AN2C 2AROB 5JRGC 1P3GD 1EQZA 4R8PC 2ZY3A 5AV5B 3B6GB 4CSRA 3A6NB 4WU9C 4YM6D 3B6FD 5AV5C 3B6GC 3KFUG 4Z5TC 5B24A 3X1VB 1P3LB 4ZUXC 2JCHA 4WU8C 1PZRA 3X1SD 2YFWB 2PYOA 3WKJD 5B32G 1EQZD 5BNVA 3LZ0A 4J8UA 3LZ1C 4G92C 2XD5A 3RELA 2F8NG 1S32B 3AZGB 3UTBA 5GT0C 1P3PD 1B67A 1H3OB 5B24D 3AZND 4YM6A 5B1LC 4R8PD 3X1SA 1KX4C 3RELC 3AV2D 3KXBB 4H9RA 3LELA 4J8XA 3LZ0C 4J8UC 3WA9C 3AZIC 5BNVB 3LZ0B 3AFAB 4J8UB 5GSUA 3UTBB 3AZMD 4WU8B 4WJ3C 5B1LA 4KGCC 5B0ZD 3MGQA 3KSYA 1P3AB 1M19C 5CPKA 3C1BB 2HIOC 1R4VA 1U35C 2F8NA 4LD9C 5AVBC 5F99C 3TU4D 4G91B 2CWEA 3AZMA 1P34A 1P3PC 4ZUXA 3WA9A 4ZBJC 5AVBA 3B0BA 5AVCB 5E5AC 5E5AB 3LJAB 3AV1C 3MGRB 3MGPD 5CPKC 2BYKA 1P3AA 3WTPA 3AZID 1AOID 5DNMB 1KX5A 4EO5C 3MGSB 2AROC 4Z66D 4J8VA 5B32D 1P3LD 3NQUA 4Z5TD 5B1MC 3W99C 3TU4C 3X1SB 1TZYC 3AZEA 5AVCA 1KX3A 3B0DC 3UT9C 1EQZB 3EG5B 1P3FC 3VH6A 1M1AB 4G92B 3AZGD 3AZJA 3AZFC 4YS3D 4XZQB 3KWQB 3MGPC 5CPKB 1KX3C 5KDMB 3AZED 2PYOB 5CP6A 3AZNB 3O62A 4R8PB 1P34C 4CAYB 3AV2B 5AV9C 4NE6A 4H9OB 5BT1C 5AV8C 5AV9B 2Y2LA 3REKC 1M1AA 3LZ0D 3AFAD 4J8UD 1T3UA 3UTBD 4WU8D 3UTAC 3AZLC 4JJNC 3B0CT 1W2EA 1P3AD 3MGPA 3C1BD 1M19D 1P3BB 3X1TC 1BH9A 5B2JC 1WWIA 5GT3B 3AZGC 3AZFD 5BO0A 3X1UA 1P3KD 3AZNA 2VQRA 1HQ3D 3EPLA 5F99B 4H9OA 4WZSB 4H9SA 4Z5TA 5B24C 3C1BA 1ULYA 4H9PA 3X1UC 4E44A 5AVCD 3W98C 5AY8C 4NE5A 5E5AD 3VH6T 3MGPB 3MGRD 5AV8B 3W97A 5DNNC 1AOIB 3C1CA 5B33B 3F6TA 5DNMC 3AZJB 3AN2D 3MGSD 1HQ3A 1P3GC 4Z66B 3C1BC 1S32A 2ZY4A 5B31G 3W98A 5B32B 3IP4C 4YM6C 3A6NC 3MVDA 4WU9B 4NFTA 4Z5TB 1P3LC 4KUDA 5B31D 5B2IC 4CAYA 3AV2A 1P3OD 5GXQA 3B0DB 1EQZC 3LJAA 4QLCA 1M1AD 2BYKB 4DRAA 3W97D 1HTAA 4HGAC 5DNMA 3LELB 3KUYC 4YS3B 2HIOB 1KX5B 4XZQD 3X1VA 3KWQD 4Z66A 1U35B 5CPKD 3AFAA 3MGQC 3AZEB 2PYOD 2NQBA 1BH9B 1KX3B 2RVQC 5B2IA 2Y2NA 1P3KA 3NQUB 3MVDD 3REHA 5JA4B 5AV9D 3KXBC 3H0MC 3MNNC 4QLCB 2W8SA 3W99D 1ID3B 5B2ID 5B0YA 5B0ZC 3C1CC 5CPJD 4H9NB 5GT0A 1P3AC 1M19B 1P3BD 3KXBA 2XD1A 5GT3D 5KDMA 3AZFB 3VH5W 2NQBD 3WTPC 1P3KB 1S32C 1HQ3B 3WTPB 5F99D 1HQ3C 1BH8B 4AWLB 5JA4A 4J8XC 2ZY5A 5B0YD 1M18B 3X1SC 4J8VC 4WV4B 3W98D 3EPHA 3NQJA 1Z2CB 5BT1D 5AV8D 4KUDD 5B33D 3WAAD 4LD9A 3AZFA 3AZJD 4X23D 3AN2B 5B1MB 2HIOA 1ZLAA 5B40C 5G49A 4H9QA 3AZNC 1P3IC 1P3PA 5E5AA 1P3IB 1KX4A 4WU9D 3R45B 5B31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3O A;  1P3O B;  5CPI D;  2CV5 D;  4G91 C;  2L5A A;  2YFV B;  3W97 B;  5DNN A;  3LZ1 D;  3AV1 A;  1P3F D;  3LEL D;  5B1L D;  1A7W A;  2HIO D;  1KX5 D;  1U35 D;  4H9Q B;  5BS7 A;  1M19 A;  3REK A;  1KX3 D;  1M18 C;  4NE3 A;  3MGQ B;  3AZE C;  4X23 C;  3AZM C;  3V9R A;  3MVD B;  5JRG D;  1P34 D;  4XZQ A;  2CV5 A;  3X1T A;  5B2J B;  5AV6 D;  2YFV A;  4QLC D;  3LJA C;  3AV1 B;  3W99 B;  1ID3 D;  5DNN B;  5B2I B;  4ZUX B;  3UTB C;  4JJN D;  3KUY A;  3UTA D;  1TAF B;  3AZL D;  5CPJ B;  4KGC D;  3W96 C;  1JFI A;  4Z2M G;  3WTP E;  5AV9 A;  2NQB B;  4X23 A;  4XZQ C;  3WTP D;  1AOI A;  4E45 A;  5B33 A;  1Q9C A;  3V9R B;  1P3K C;  5B0Y B;  1M18 D;  2RVQ D;  5B2J A;  2BYM A;  1P3I A;  4J8V B;  2LY8 A;  3REJ B;  4ZBJ B;  4XUJ D;  3W98 B;  3X1U B;  4KGC A;  3REI A;  4WNN B;  2NZD A;  4KUD B;  4YS3 C;  3AYW D;  3WAA B;  1B6W A;  5B33 C;  5GXQ C;  4X23 B;  3WAA C;  2F8N D;  5B1M D;  1TZY D;  3AZK B;  3W96 B;  3O62 C;  5GT3 C;  4YS3 A;  5CP6 D;  1P3I D;  2HUE B;  1WWS A;  1M18 A;  5B32 C;  2HUE C;  4UUZ A;  3REK D;  2F8N H;  3AFA C;  3REJ A;  4J8X D;  3AN2 A;  5CPI B;  3REI C;  2CV5 B;  1P3O C;  1ZLA B;  1F66 C;  4R8P A;  3REI B;  2CV5 C;  3LZ1 B;  3REH D;  1M1A C;  5AV6 A;  1P3F B;  3AZH D;  5B1L B;  5B32 A;  3W97 C;  4XUJ C;  1KX4 D;  3X1T D;  5GSU C;  4JJN A;  5B1M A;  1JFI B;  5AV5 A;  3MGQ D;  3W96 A;  2PYO C;  3B6G A;  1N1J A;  1P3B A;  5JRG B;  5BNX B;  3VH5 T;  3R45 A;  1P34 B;  1U35 A;  2FJ7 C;  1P3O A;  5B2J D;  5AY8 D;  3B0C W;  5AVB D;  5AV6 B;  3REL B;  3AV1 D;  1P3F A;  1BH8 A;  5DNN D;  3LZ1 A;  4ZUX D;  3X1V C;  4JJN B;  3UTA B;  3AZL B;  4KGC B;  5CPJ C;  3C1C D;  1P3M C;  3REH C;  3AYW A;  5B40 B;  3LEL C;  3NQJ B;  2NQB C;  5BNX A;  4LD9 B;  4CSR B;  3A6N A;  4H9R B;  1ZLA C;  4J8V D;  3REJ D;  4XUJ B;  4KHA B;  3B6F A;  3X1U D;  3MNN A;  5B0Z A;  4DRB A;  4J8W A;  2FJ7 B;  3KUY B;  3AYW B;  4M6B A;  4QLC C;  3WA9 D;  2F8N B;  2BYM B;  5GXQ B;  1TZY B;  3AZK D;  3W96 D;  1P3M B;  5CP6 B;  4H9S C;  3O62 B;  2NZD D;  4HGA B;  3REK B;  2ARO A;  5JRG A;  3MNN B;  2IO5 B;  4J8X B;  3B6F C;  1ZLA D;  4J8W C;  3AZK A;  5CPI C;  3REI D;  3REH B;  4J8W B;  3AZI A;  1F66 D;  1KU5 A;  2F8N K;  2FJ7 A;  3AZH B;  3WKJ C;  3UT9 B;  1KX4 B;  3MVD C;  3X1T B;  5AVC C;  5GSU D;  5B31 A;  3KWQ C;  3W99 A;  5B40 A;  1P3M A;  5GT0 B;  3AZG A;  3AZK C;  5F99 A;  4UUZ B;  4EO5 B;  2ARO D;  4Z66 C;  1P3G B;  5AY8 B;  5CPI A;  3VH5 A;  5AVB B;  3REL D;  5AV5 D;  3B6G D;  3A6N D;  4YM6 B;  4KHA A;  2IO5 C;  3B6F B;  3MGR A;  3X1V D;  1N1J B;  3C1C B;  3MGS C;  5B40 D;  3AZH C;  3WKJ B;  5BS7 C;  3MGR C;  1S32 D;  3WAA A;  4LD9 D;  1P3G A;  4Z2M H;  5G49 B;  5C3I B;  5C3I C;  1P3P B;  3REJ C;  5B24 B;  1P3L A;  1F66 A;  2FJ7 D;  3KUY D;  3UTA A;  3AZL A;  3AV2 C;  3TU4 A;  3KXB D;  4KUD C;  3WA9 B;  3AZH A;  3AYW C;  3UT9 A;  5GXQ D;  3WKJ A;  5B31 C;  3KWQ A;  1BFM A;  1AOI C;  3AZM B;  4XUJ A;  1P3M D;  5CHL B;  5B0Z B;  3O62 D;  4WNN A;  2NZD B;  5CP6 C;  2NZD C;  1KX5 C;  4H9P B;  5FUG B;  3MNN D;  5AV8 A;  5AY8 A;  4AWL C;  3TU4 B;  4J8W D;  1F66 B;  1ID3 A;  3UT9 D;  1P3B C;  3MGS A;  4H9N A;  5GSU B;  1TZY A;  2YFW A;  4WU8 A;  5GT3 A;  1F1E A;  5BO0 B;  5AV6 C;  3LJA D;  5GT0 D;  1TAF A;  5CPJ A;  1ID3 C;  4WU9 A;  5B0Y C;  3AZI B;  5FUG A;  3AZJ C;  3VH6 W;  5DNM D;  2JSS A;  3AN2 C;  2ARO B;  5JRG C;  1P3G D;  1EQZ A;  4R8P C;  5AV5 B;  3B6G B;  4CSR A;  3A6N B;  4WU9 C;  4YM6 D;  3B6F D;  5AV5 C;  3B6G C;  4Z5T C;  5B24 A;  3X1V B;  1P3L B;  4ZUX C;  4WU8 C;  3X1S D;  2YFW B;  2PYO A;  3WKJ D;  5B32 G;  1EQZ D;  5BNV A;  3LZ0 A;  4J8U A;  3LZ1 C;  4G92 C;  3REL A;  2F8N G;  1S32 B;  3AZG B;  3UTB A;  5GT0 C;  1P3P D;  1B67 A;  1H3O B;  5B24 D;  3AZN D;  4YM6 A;  5B1L C;  4R8P D;  3X1S A;  1KX4 C;  3REL C;  3AV2 D;  3KXB B;  4H9R A;  3LEL A;  4J8X A;  3LZ0 C;  4J8U C;  3WA9 C;  3AZI C;  5BNV B;  3LZ0 B;  3AFA B;  4J8U B;  5GSU A;  3UTB B;  3AZM D;  4WU8 B;  5B1L A;  4KGC C;  5B0Z D;  3MGQ A;  3KSY A;  1P3A B;  1M19 C;  5CPK A;  3C1B B;  2HIO C;  1R4V A;  1U35 C;  2F8N A;  4LD9 C;  5AVB C;  5F99 C;  3TU4 D;  4G91 B;  2CWE A;  3AZM A;  1P34 A;  1P3P C;  4ZUX A;  3WA9 A;  4ZBJ C;  5AVB A;  3B0B A;  5AVC B;  5E5A C;  5E5A B;  3LJA B;  3AV1 C;  3MGR B;  3MGP D;  5CPK C;  2BYK A;  1P3A A;  3WTP A;  3AZI D;  1AOI D;  5DNM B;  1KX5 A;  4EO5 C;  3MGS B;  2ARO C;  4Z66 D;  4J8V A;  5B32 D;  1P3L D;  3NQU A;  4Z5T D;  5B1M C;  3W99 C;  3TU4 C;  3X1S B;  1TZY C;  3AZE A;  5AVC A;  1KX3 A;  3B0D C;  3UT9 C;  1EQZ B;  1P3F C;  3VH6 A;  1M1A B;  4G92 B;  3AZG D;  3AZJ A;  3AZF C;  4YS3 D;  4XZQ B;  3KWQ B;  3MGP C;  5CPK B;  1KX3 C;  5KDM B;  3AZE D;  2PYO B;  5CP6 A;  3AZN B;  3O62 A;  4R8P B;  1P34 C;  4CAY B;  3AV2 B;  5AV9 C;  4NE6 A;  4H9O B;  5BT1 C;  5AV8 C;  5AV9 B;  3REK C;  1M1A A;  3LZ0 D;  3AFA D;  4J8U D;  3UTB D;  4WU8 D;  3UTA C;  3AZL C;  4JJN C;  3B0C T;  1P3A D;  3MGP A;  3C1B D;  1M19 D;  1P3B B;  3X1T C;  1BH9 A;  5B2J C;  1WWI A;  5GT3 B;  3AZG C;  3AZF D;  5BO0 A;  3X1U A;  1P3K D;  3AZN A;  1HQ3 D;  5F99 B;  4H9O A;  4WZS B;  4H9S A;  4Z5T A;  5B24 C;  3C1B A;  1ULY A;  4H9P A;  3X1U C;  4E44 A;  5AVC D;  3W98 C;  5AY8 C;  4NE5 A;  5E5A D;  3VH6 T;  3MGP B;  3MGR D;  5AV8 B;  3W97 A;  5DNN C;  1AOI B;  3C1C A;  5B33 B;  5DNM C;  3AZJ B;  3AN2 D;  3MGS D;  1HQ3 A;  1P3G C;  4Z66 B;  3C1B C;  1S32 A;  5B31 G;  3W98 A;  5B32 B;  4YM6 C;  3A6N C;  3MVD A;  4WU9 B;  4NFT A;  4Z5T B;  1P3L C;  4KUD A;  5B31 D;  5B2I C;  4CAY A;  3AV2 A;  1P3O D;  5GXQ A;  3B0D B;  1EQZ C;  3LJA A;  4QLC A;  1M1A D;  2BYK B;  4DRA A;  3W97 D;  1HTA A;  4HGA C;  5DNM A;  3LEL B;  3KUY C;  4YS3 B;  2HIO B;  1KX5 B;  4XZQ D;  3X1V A;  3KWQ D;  4Z66 A;  1U35 B;  5CPK D;  3AFA A;  3MGQ C;  3AZE B;  2PYO D;  2NQB A;  1BH9 B;  1KX3 B;  2RVQ C;  5B2I A;  1P3K A;  3NQU B;  3MVD D;  3REH A;  5JA4 B;  5AV9 D;  3KXB C;  3MNN C;  4QLC B;  3W99 D;  1ID3 B;  5B2I D;  5B0Y A;  5B0Z C;  3C1C C;  5CPJ D;  4H9N B;  5GT0 A;  1P3A C;  1M19 B;  1P3B D;  3KXB A;  5GT3 D;  5KDM A;  3AZF B;  3VH5 W;  2NQB D;  3WTP C;  1P3K B;  1S32 C;  1HQ3 B;  3WTP B;  5F99 D;  1HQ3 C;  1BH8 B;  4AWL B;  5JA4 A;  4J8X C;  5B0Y D;  1M18 B;  3X1S C;  4J8V C;  4WV4 B;  3W98 D;  3NQJ A;  5BT1 D;  5AV8 D;  4KUD D;  5B33 D;  3WAA D;  4LD9 A;  3AZF A;  3AZJ D;  4X23 D;  3AN2 B;  5B1M B;  2HIO A;  1ZLA A;  5B40 C;  5G49 A;  4H9Q A;  3AZN C;  1P3I C;  1P3P A;  5E5A A;  1P3I B;  1KX4 A;  4WU9 D;  3R45 B;  5B31 B; 
#chains in the Genus database with same CATH topology
 1H3O A;  1P3O B;  5CPI D;  2CV5 D;  4G91 C;  2L5A A;  2YFV B;  3W97 B;  5DNN A;  3LZ1 D;  3AV1 A;  1P3F D;  3LEL D;  5B1L D;  1A7W A;  2HIO D;  1KX5 D;  1U35 D;  4H9Q B;  5BS7 A;  1M19 A;  2Y2P A;  3REK A;  2ZM5 A;  1KX3 D;  1M18 C;  4NE3 A;  2DQN C;  3MGQ B;  3AZE C;  4X23 C;  3AZM C;  4DQY B;  3V9R A;  3MVD B;  5JRG D;  2Y2H A;  1P34 D;  4XZQ A;  2CV5 A;  3X1T A;  3H0R C;  5B2J B;  5AV6 D;  2YFV A;  4QLC D;  3LJA C;  3AV1 B;  3W99 B;  1ID3 D;  5DNN B;  5B2I B;  4ZUX B;  3UTB C;  4JJN D;  3KUY A;  3UTA D;  1TAF B;  3AZL D;  5CPJ B;  4KGC D;  3W96 C;  1JFI A;  4Z2M G;  3WTP E;  2Y2G A;  5AV9 A;  2NQB B;  4X23 A;  4XZQ C;  3WTP D;  2Y2Q A;  1AOI A;  4E45 A;  5B33 A;  1Q9C A;  3V9R B;  1P3K C;  5B0Y B;  1M18 D;  2RVQ D;  5B2J A;  2BYM A;  1P3I A;  2UWX A;  4J8V B;  2LY8 A;  3REJ B;  4ZBJ B;  4XUJ D;  3W98 B;  3X1U B;  4KGC A;  3REI A;  4WNN B;  2NZD A;  2G5H C;  4KUD B;  2RIQ A;  4YS3 C;  3AYW D;  3WAA B;  1B6W A;  5B33 C;  5GXQ C;  4X23 B;  3WAA C;  2F8N D;  5B1M D;  1TZY D;  3AZK B;  3W96 B;  3O62 C;  5GT3 C;  4YS3 A;  5CP6 D;  1P3I D;  2Y2K A;  2HUE B;  1WWS A;  2DF4 C;  1M18 A;  5B32 C;  2ZY2 A;  2HUE C;  4UUZ A;  3REK D;  2F8N H;  3AFA C;  3REJ A;  4J8X D;  3AN2 A;  5CPI B;  3REI C;  2CV5 B;  1P3O C;  1ZLA B;  1F66 C;  4R8P A;  3REI B;  2CV5 C;  3LZ1 B;  3REH D;  1M1A C;  5AV6 A;  1P3F B;  3AZH D;  5B1L B;  5B32 A;  3W97 C;  4XUJ C;  1KX4 D;  2FFF B;  3X1T D;  5GSU C;  4JJN A;  5B1M A;  2Y2M A;  2Y2I A;  1JFI B;  5AV5 A;  3MGQ D;  3W96 A;  2PYO C;  3B6G A;  3AL0 C;  1N1J A;  1P3B A;  5JRG B;  5BNX B;  3VH5 T;  3R45 A;  1P34 B;  1U35 A;  2FJ7 C;  1P3O A;  5B2J D;  5AY8 D;  3B0C W;  5AVB D;  5AV6 B;  3REL B;  3AV1 D;  1P3F A;  3EPJ A;  1BH8 A;  5DNN D;  3LZ1 A;  4ZUX D;  3X1V C;  4JJN B;  3UTA B;  3AZL B;  4KGC B;  5CPJ C;  3C1C D;  4UPK A;  1P3M C;  3REH C;  3AYW A;  5B40 B;  2F2A C;  3LEL C;  3NQJ B;  2NQB C;  3EPK A;  5BNX A;  4LD9 B;  4CSR B;  3A6N A;  4H9R B;  1ZLA C;  4J8V D;  3REJ D;  4XUJ B;  4KHA B;  3B6F A;  3X1U D;  3P5J B;  5B0Z A;  3MNN A;  4DRB A;  4J8W A;  2FJ7 B;  3KUY B;  3AYW B;  4M6B A;  4QLC C;  3WA9 D;  2F8N B;  2BYM B;  5GXQ B;  1TZY B;  3AZK D;  2BG1 A;  3W96 D;  1P3M B;  5CP6 B;  2JE5 A;  4H9S C;  3O62 B;  2NZD D;  4HGA B;  2J8P A;  3REK B;  2ARO A;  5JRG A;  3MNN B;  2IO5 B;  4J8X B;  3B6F C;  1ZLA D;  4J8W C;  3AZK A;  5CPI C;  3REI D;  3REH B;  4J8W B;  3AZI A;  3FDD A;  1KU5 A;  1F66 D;  2F8N K;  3AZH B;  2FJ7 A;  3WKJ C;  3UT9 B;  1KX4 B;  3MVD C;  3X1T B;  5AVC C;  5GSU D;  5B31 A;  3KWQ C;  3W99 A;  5B40 A;  1P3M A;  5GT0 B;  3AZG A;  3AZK C;  5F99 A;  4UUZ B;  4EO5 B;  2ARO D;  4Z66 C;  1P3G B;  5AY8 B;  5CPI A;  3VH5 A;  5AVB B;  3REL D;  5AV5 D;  3B6G D;  3A6N D;  4YM6 B;  2IO5 C;  4KHA A;  3B6F B;  3MGR A;  3X1V D;  1N1J B;  3C1C B;  3MGS C;  5B40 D;  3AZH C;  3WKJ B;  5BS7 C;  3MGR C;  2Y2J A;  1S32 D;  3WAA A;  4LD9 D;  1P3G A;  4Z2M H;  5G49 B;  5C3I B;  3A1K A;  5C3I C;  1P3P B;  3REJ C;  5B24 B;  1P3L A;  1F66 A;  2FJ7 D;  3KUY D;  3UTA A;  3AZL A;  3AV2 C;  3TU4 A;  3KXB D;  4KUD C;  3WA9 B;  3AZH A;  3AYW C;  3UT9 A;  5GXQ D;  3WKJ A;  5B31 C;  3KWQ A;  1BFM A;  1AOI C;  3AZM B;  4XUJ A;  1P3M D;  5CHL B;  5B0Z B;  2Y2O A;  3O62 D;  4WNN A;  3A1I A;  5CP6 C;  2NZD B;  2NZD C;  1KX5 C;  4H9P B;  5FUG B;  3MNN D;  5AV8 A;  5AY8 A;  4AWL C;  3TU4 B;  4J8W D;  1F66 B;  1ID3 A;  3UT9 D;  1P3B C;  3MGS A;  4H9N A;  5GSU B;  1TZY A;  2YFW A;  3H0L C;  4WU8 A;  5GT3 A;  1F1E A;  5BO0 B;  5AV6 C;  3LJA D;  1TAF A;  5GT0 D;  5CPJ A;  1ID3 C;  4WU9 A;  5B0Y C;  3AZI B;  5FUG A;  3AZJ C;  3VH6 W;  5DNM D;  2JSS A;  2G5I C;  3AN2 C;  2ARO B;  5JRG C;  1P3G D;  1EQZ A;  4R8P C;  2ZY3 A;  5AV5 B;  3B6G B;  4CSR A;  3A6N B;  4WU9 C;  4YM6 D;  3B6F D;  5AV5 C;  3B6G C;  3KFU G;  4Z5T C;  5B24 A;  3X1V B;  1P3L B;  4ZUX C;  2JCH A;  4WU8 C;  1PZR A;  3X1S D;  2YFW B;  2PYO A;  3WKJ D;  5B32 G;  1EQZ D;  5BNV A;  3LZ0 A;  4J8U A;  3LZ1 C;  4G92 C;  2XD5 A;  3REL A;  2F8N G;  1S32 B;  3AZG B;  3UTB A;  5GT0 C;  1P3P D;  1B67 A;  1H3O B;  5B24 D;  3AZN D;  4YM6 A;  5B1L C;  4R8P D;  3X1S A;  1KX4 C;  3REL C;  3AV2 D;  3KXB B;  4H9R A;  3LEL A;  4J8X A;  3LZ0 C;  4J8U C;  3WA9 C;  3AZI C;  5BNV B;  3LZ0 B;  3AFA B;  4J8U B;  5GSU A;  3UTB B;  3AZM D;  4WU8 B;  4WJ3 C;  5B1L A;  4KGC C;  5B0Z D;  3MGQ A;  3KSY A;  1P3A B;  1M19 C;  5CPK A;  3C1B B;  2HIO C;  1R4V A;  1U35 C;  2F8N A;  4LD9 C;  5AVB C;  5F99 C;  3TU4 D;  4G91 B;  2CWE A;  3AZM A;  1P34 A;  1P3P C;  4ZUX A;  3WA9 A;  4ZBJ C;  5AVB A;  3B0B A;  5AVC B;  5E5A C;  5E5A B;  3LJA B;  3AV1 C;  3MGR B;  3MGP D;  5CPK C;  2BYK A;  1P3A A;  3WTP A;  3AZI D;  1AOI D;  5DNM B;  1KX5 A;  4EO5 C;  3MGS B;  2ARO C;  4Z66 D;  4J8V A;  5B32 D;  1P3L D;  3NQU A;  4Z5T D;  5B1M C;  3W99 C;  3TU4 C;  3X1S B;  1TZY C;  3AZE A;  5AVC A;  1KX3 A;  3B0D C;  3UT9 C;  1EQZ B;  3EG5 B;  1P3F C;  3VH6 A;  1M1A B;  4G92 B;  3AZG D;  3AZJ A;  3AZF C;  4YS3 D;  4XZQ B;  3KWQ B;  3MGP C;  5CPK B;  1KX3 C;  5KDM B;  3AZE D;  2PYO B;  5CP6 A;  3AZN B;  3O62 A;  4R8P B;  1P34 C;  4CAY B;  3AV2 B;  5AV9 C;  4NE6 A;  4H9O B;  5BT1 C;  5AV8 C;  5AV9 B;  2Y2L A;  3REK C;  1M1A A;  3LZ0 D;  3AFA D;  4J8U D;  1T3U A;  3UTB D;  4WU8 D;  3UTA C;  3AZL C;  4JJN C;  3B0C T;  1W2E A;  1P3A D;  3MGP A;  3C1B D;  1M19 D;  1P3B B;  3X1T C;  1BH9 A;  5B2J C;  1WWI A;  5GT3 B;  3AZG C;  3AZF D;  5BO0 A;  3X1U A;  1P3K D;  3AZN A;  2VQR A;  1HQ3 D;  3EPL A;  5F99 B;  4H9O A;  4WZS B;  4H9S A;  4Z5T A;  5B24 C;  3C1B A;  1ULY A;  4H9P A;  3X1U C;  4E44 A;  5AVC D;  3W98 C;  5AY8 C;  4NE5 A;  5E5A D;  3VH6 T;  3MGP B;  3MGR D;  5AV8 B;  3W97 A;  5DNN C;  1AOI B;  3C1C A;  5B33 B;  3F6T A;  5DNM C;  3AZJ B;  3AN2 D;  3MGS D;  1HQ3 A;  1P3G C;  4Z66 B;  3C1B C;  1S32 A;  2ZY4 A;  5B31 G;  3W98 A;  5B32 B;  3IP4 C;  4YM6 C;  3A6N C;  3MVD A;  4WU9 B;  4NFT A;  4Z5T B;  1P3L C;  4KUD A;  5B31 D;  5B2I C;  4CAY A;  3AV2 A;  1P3O D;  5GXQ A;  3B0D B;  1EQZ C;  3LJA A;  4QLC A;  1M1A D;  2BYK B;  4DRA A;  3W97 D;  1HTA A;  4HGA C;  5DNM A;  3LEL B;  3KUY C;  4YS3 B;  2HIO B;  1KX5 B;  4XZQ D;  3X1V A;  3KWQ D;  4Z66 A;  1U35 B;  5CPK D;  3AFA A;  3MGQ C;  3AZE B;  2PYO D;  2NQB A;  1BH9 B;  1KX3 B;  2RVQ C;  5B2I A;  2Y2N A;  1P3K A;  3NQU B;  3MVD D;  3REH A;  5JA4 B;  5AV9 D;  3KXB C;  3H0M C;  3MNN C;  4QLC B;  2W8S A;  3W99 D;  1ID3 B;  5B2I D;  5B0Y A;  5B0Z C;  3C1C C;  5CPJ D;  4H9N B;  5GT0 A;  1P3A C;  1M19 B;  1P3B D;  3KXB A;  2XD1 A;  5GT3 D;  5KDM A;  3AZF B;  3VH5 W;  2NQB D;  3WTP C;  1P3K B;  1S32 C;  1HQ3 B;  3WTP B;  5F99 D;  1HQ3 C;  1BH8 B;  4AWL B;  5JA4 A;  4J8X C;  2ZY5 A;  5B0Y D;  1M18 B;  3X1S C;  4J8V C;  4WV4 B;  3W98 D;  3EPH A;  3NQJ A;  1Z2C B;  5BT1 D;  5AV8 D;  4KUD D;  5B33 D;  3WAA D;  4LD9 A;  3AZF A;  3AZJ D;  4X23 D;  3AN2 B;  5B1M B;  2HIO A;  1ZLA A;  5B40 C;  5G49 A;  4H9Q A;  3AZN C;  1P3I C;  1P3P A;  5E5A A;  1P3I B;  1KX4 A;  4WU9 D;  3R45 B;  5B31 B; 
#chains in the Genus database with same CATH homology
 1H3O A;  1P3O B;  5CPI D;  2CV5 D;  4G91 C;  2L5A A;  2YFV B;  3W97 B;  5DNN A;  3LZ1 D;  3AV1 A;  1P3F D;  3LEL D;  5B1L D;  1A7W A;  2HIO D;  1KX5 D;  1U35 D;  4H9Q B;  5BS7 A;  1M19 A;  2Y2P A;  3REK A;  2ZM5 A;  1KX3 D;  1M18 C;  4NE3 A;  2DQN C;  3MGQ B;  3AZE C;  4X23 C;  3AZM C;  4DQY B;  3V9R A;  3MVD B;  5JRG D;  2Y2H A;  1P34 D;  4XZQ A;  2CV5 A;  3X1T A;  3H0R C;  5B2J B;  5AV6 D;  2YFV A;  4QLC D;  3LJA C;  3AV1 B;  3W99 B;  1ID3 D;  5DNN B;  5B2I B;  4ZUX B;  3UTB C;  4JJN D;  3KUY A;  3UTA D;  1TAF B;  3AZL D;  5CPJ B;  4KGC D;  3W96 C;  1JFI A;  4Z2M G;  3WTP E;  2Y2G A;  5AV9 A;  2NQB B;  4X23 A;  4XZQ C;  3WTP D;  2Y2Q A;  1AOI A;  4E45 A;  5B33 A;  1Q9C A;  3V9R B;  1P3K C;  5B0Y B;  1M18 D;  2RVQ D;  5B2J A;  2BYM A;  1P3I A;  2UWX A;  4J8V B;  2LY8 A;  3REJ B;  4ZBJ B;  4XUJ D;  3W98 B;  3X1U B;  4KGC A;  3REI A;  4WNN B;  2NZD A;  2G5H C;  4KUD B;  2RIQ A;  4YS3 C;  3AYW D;  3WAA B;  1B6W A;  5B33 C;  5GXQ C;  4X23 B;  3WAA C;  2F8N D;  5B1M D;  1TZY D;  3AZK B;  3W96 B;  3O62 C;  5GT3 C;  4YS3 A;  5CP6 D;  1P3I D;  2Y2K A;  2HUE B;  1WWS A;  2DF4 C;  1M18 A;  5B32 C;  2ZY2 A;  2HUE C;  4UUZ A;  3REK D;  2F8N H;  3AFA C;  3REJ A;  4J8X D;  3AN2 A;  5CPI B;  3REI C;  2CV5 B;  1P3O C;  1ZLA B;  1F66 C;  4R8P A;  3REI B;  2CV5 C;  3LZ1 B;  3REH D;  1M1A C;  5AV6 A;  1P3F B;  3AZH D;  5B1L B;  5B32 A;  3W97 C;  4XUJ C;  1KX4 D;  2FFF B;  3X1T D;  5GSU C;  4JJN A;  5B1M A;  2Y2M A;  2Y2I A;  1JFI B;  5AV5 A;  3MGQ D;  3W96 A;  2PYO C;  3B6G A;  3AL0 C;  1N1J A;  1P3B A;  5JRG B;  5BNX B;  3VH5 T;  3R45 A;  1P34 B;  1U35 A;  2FJ7 C;  1P3O A;  5B2J D;  5AY8 D;  3B0C W;  5AVB D;  5AV6 B;  3REL B;  3AV1 D;  1P3F A;  3EPJ A;  1BH8 A;  5DNN D;  3LZ1 A;  4ZUX D;  3X1V C;  4JJN B;  3UTA B;  3AZL B;  4KGC B;  5CPJ C;  3C1C D;  4UPK A;  1P3M C;  3REH C;  3AYW A;  5B40 B;  2F2A C;  3LEL C;  3NQJ B;  2NQB C;  3EPK A;  5BNX A;  4LD9 B;  4CSR B;  3A6N A;  4H9R B;  1ZLA C;  4J8V D;  3REJ D;  4XUJ B;  4KHA B;  3B6F A;  3X1U D;  3P5J B;  5B0Z A;  3MNN A;  4DRB A;  4J8W A;  2FJ7 B;  3KUY B;  3AYW B;  4M6B A;  4QLC C;  3WA9 D;  2F8N B;  2BYM B;  5GXQ B;  1TZY B;  3AZK D;  2BG1 A;  3W96 D;  1P3M B;  5CP6 B;  2JE5 A;  4H9S C;  3O62 B;  2NZD D;  4HGA B;  2J8P A;  3REK B;  2ARO A;  5JRG A;  3MNN B;  2IO5 B;  4J8X B;  3B6F C;  1ZLA D;  4J8W C;  3AZK A;  5CPI C;  3REI D;  3REH B;  4J8W B;  3AZI A;  3FDD A;  1KU5 A;  1F66 D;  2F8N K;  3AZH B;  2FJ7 A;  3WKJ C;  3UT9 B;  1KX4 B;  3MVD C;  3X1T B;  5AVC C;  5GSU D;  5B31 A;  3KWQ C;  3W99 A;  5B40 A;  1P3M A;  5GT0 B;  3AZG A;  3AZK C;  5F99 A;  4UUZ B;  4EO5 B;  2ARO D;  4Z66 C;  1P3G B;  5AY8 B;  5CPI A;  3VH5 A;  5AVB B;  3REL D;  5AV5 D;  3B6G D;  3A6N D;  4YM6 B;  2IO5 C;  4KHA A;  3B6F B;  3MGR A;  3X1V D;  1N1J B;  3C1C B;  3MGS C;  5B40 D;  3AZH C;  3WKJ B;  5BS7 C;  3MGR C;  2Y2J A;  1S32 D;  3WAA A;  4LD9 D;  1P3G A;  4Z2M H;  5G49 B;  5C3I B;  3A1K A;  5C3I C;  1P3P B;  3REJ C;  5B24 B;  1P3L A;  1F66 A;  2FJ7 D;  3KUY D;  3UTA A;  3AZL A;  3AV2 C;  3TU4 A;  3KXB D;  4KUD C;  3WA9 B;  3AZH A;  3AYW C;  3UT9 A;  5GXQ D;  3WKJ A;  5B31 C;  3KWQ A;  1BFM A;  1AOI C;  3AZM B;  4XUJ A;  1P3M D;  5CHL B;  5B0Z B;  2Y2O A;  3O62 D;  4WNN A;  3A1I A;  5CP6 C;  2NZD B;  2NZD C;  1KX5 C;  4H9P B;  5FUG B;  3MNN D;  5AV8 A;  5AY8 A;  4AWL C;  3TU4 B;  4J8W D;  1F66 B;  1ID3 A;  3UT9 D;  1P3B C;  3MGS A;  4H9N A;  5GSU B;  1TZY A;  2YFW A;  3H0L C;  4WU8 A;  5GT3 A;  1F1E A;  5BO0 B;  5AV6 C;  3LJA D;  1TAF A;  5GT0 D;  5CPJ A;  1ID3 C;  4WU9 A;  5B0Y C;  3AZI B;  5FUG A;  3AZJ C;  3VH6 W;  5DNM D;  2JSS A;  2G5I C;  3AN2 C;  2ARO B;  5JRG C;  1P3G D;  1EQZ A;  4R8P C;  2ZY3 A;  5AV5 B;  3B6G B;  4CSR A;  3A6N B;  4WU9 C;  4YM6 D;  3B6F D;  5AV5 C;  3B6G C;  3KFU G;  4Z5T C;  5B24 A;  3X1V B;  1P3L B;  4ZUX C;  2JCH A;  4WU8 C;  1PZR A;  3X1S D;  2YFW B;  2PYO A;  3WKJ D;  5B32 G;  1EQZ D;  5BNV A;  3LZ0 A;  4J8U A;  3LZ1 C;  4G92 C;  2XD5 A;  3REL A;  2F8N G;  1S32 B;  3AZG B;  3UTB A;  5GT0 C;  1P3P D;  1B67 A;  1H3O B;  5B24 D;  3AZN D;  4YM6 A;  5B1L C;  4R8P D;  3X1S A;  1KX4 C;  3REL C;  3AV2 D;  3KXB B;  4H9R A;  3LEL A;  4J8X A;  3LZ0 C;  4J8U C;  3WA9 C;  3AZI C;  5BNV B;  3LZ0 B;  3AFA B;  4J8U B;  5GSU A;  3UTB B;  3AZM D;  4WU8 B;  4WJ3 C;  5B1L A;  4KGC C;  5B0Z D;  3MGQ A;  3KSY A;  1P3A B;  1M19 C;  5CPK A;  3C1B B;  2HIO C;  1R4V A;  1U35 C;  2F8N A;  4LD9 C;  5AVB C;  5F99 C;  3TU4 D;  4G91 B;  2CWE A;  3AZM A;  1P34 A;  1P3P C;  4ZUX A;  3WA9 A;  4ZBJ C;  5AVB A;  3B0B A;  5AVC B;  5E5A C;  5E5A B;  3LJA B;  3AV1 C;  3MGR B;  3MGP D;  5CPK C;  2BYK A;  1P3A A;  3WTP A;  3AZI D;  1AOI D;  5DNM B;  1KX5 A;  4EO5 C;  3MGS B;  2ARO C;  4Z66 D;  4J8V A;  5B32 D;  1P3L D;  3NQU A;  4Z5T D;  5B1M C;  3W99 C;  3TU4 C;  3X1S B;  1TZY C;  3AZE A;  5AVC A;  1KX3 A;  3B0D C;  3UT9 C;  1EQZ B;  3EG5 B;  1P3F C;  3VH6 A;  1M1A B;  4G92 B;  3AZG D;  3AZJ A;  3AZF C;  4YS3 D;  4XZQ B;  3KWQ B;  3MGP C;  5CPK B;  1KX3 C;  5KDM B;  3AZE D;  2PYO B;  5CP6 A;  3AZN B;  3O62 A;  4R8P B;  1P34 C;  4CAY B;  3AV2 B;  5AV9 C;  4NE6 A;  4H9O B;  5BT1 C;  5AV8 C;  5AV9 B;  2Y2L A;  3REK C;  1M1A A;  3LZ0 D;  3AFA D;  4J8U D;  1T3U A;  3UTB D;  4WU8 D;  3UTA C;  3AZL C;  4JJN C;  3B0C T;  1W2E A;  1P3A D;  3MGP A;  3C1B D;  1M19 D;  1P3B B;  3X1T C;  1BH9 A;  5B2J C;  1WWI A;  5GT3 B;  3AZG C;  3AZF D;  5BO0 A;  3X1U A;  1P3K D;  3AZN A;  2VQR A;  1HQ3 D;  3EPL A;  5F99 B;  4H9O A;  4WZS B;  4H9S A;  4Z5T A;  5B24 C;  3C1B A;  1ULY A;  4H9P A;  3X1U C;  4E44 A;  5AVC D;  3W98 C;  5AY8 C;  4NE5 A;  5E5A D;  3VH6 T;  3MGP B;  3MGR D;  5AV8 B;  3W97 A;  5DNN C;  1AOI B;  3C1C A;  5B33 B;  3F6T A;  5DNM C;  3AZJ B;  3AN2 D;  3MGS D;  1HQ3 A;  1P3G C;  4Z66 B;  3C1B C;  1S32 A;  2ZY4 A;  5B31 G;  3W98 A;  5B32 B;  3IP4 C;  4YM6 C;  3A6N C;  3MVD A;  4WU9 B;  4NFT A;  4Z5T B;  1P3L C;  4KUD A;  5B31 D;  5B2I C;  4CAY A;  3AV2 A;  1P3O D;  5GXQ A;  3B0D B;  1EQZ C;  3LJA A;  4QLC A;  1M1A D;  2BYK B;  4DRA A;  3W97 D;  1HTA A;  4HGA C;  5DNM A;  3LEL B;  3KUY C;  4YS3 B;  2HIO B;  1KX5 B;  4XZQ D;  3X1V A;  3KWQ D;  4Z66 A;  1U35 B;  5CPK D;  3AFA A;  3MGQ C;  3AZE B;  2PYO D;  2NQB A;  1BH9 B;  1KX3 B;  2RVQ C;  5B2I A;  2Y2N A;  1P3K A;  3NQU B;  3MVD D;  3REH A;  5JA4 B;  5AV9 D;  3KXB C;  3H0M C;  3MNN C;  4QLC B;  2W8S A;  3W99 D;  1ID3 B;  5B2I D;  5B0Y A;  5B0Z C;  3C1C C;  5CPJ D;  4H9N B;  5GT0 A;  1P3A C;  1M19 B;  1P3B D;  3KXB A;  2XD1 A;  5GT3 D;  5KDM A;  3AZF B;  3VH5 W;  2NQB D;  3WTP C;  1P3K B;  1S32 C;  1HQ3 B;  3WTP B;  5F99 D;  1HQ3 C;  1BH8 B;  4AWL B;  5JA4 A;  4J8X C;  2ZY5 A;  5B0Y D;  1M18 B;  3X1S C;  4J8V C;  4WV4 B;  3W98 D;  3EPH A;  3NQJ A;  1Z2C B;  5BT1 D;  5AV8 D;  4KUD D;  5B33 D;  3WAA D;  4LD9 A;  3AZF A;  3AZJ D;  4X23 D;  3AN2 B;  5B1M B;  2HIO A;  1ZLA A;  5B40 C;  5G49 A;  4H9Q A;  3AZN C;  1P3I C;  1P3P A;  5E5A A;  1P3I B;  1KX4 A;  4WU9 D;  3R45 B;  5B31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...