4QLCC

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 27
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcC00
2PYOA 3O62B 4KHAA 1P3IA 5B24B 3W96D 3MGQC 1EQZC 1WWSA 3UTBB 5AVCC 3X1TB 1P3LC 1ZLAB 1HQ3C 5GT0A 2NZDB 3AZLC 3RELD 3X1SA 4WU8A 4XUJD 3B6GC 5CPIC 4UUZA 3MVDA 5JRGD 4G91C 4KGCC 1EQZA 5AV6D 3MNNC 5AVCA 3AN2C 1P3LA 3C1BC 1HQ3A 4H9OA 1M18D 3AZFB 3AZLA 1F66B 5B40C 3B6GA 4X23C 5CPIA 4ZUXC 1P34B 4JJNB 5AV8D 4YM6C 2JSSA 5BNXB 3W98B 5CPJD 1P3OA 4KGCA 1ID3B 4HGAB 3MNNA 3AN2A 3C1BA 3AZND 4KUDD 4Z5TD 4WU9D 3REHC 3TU4D 5B1LC 5AV5D 5CPKB 4H9PA 5B40A 5AV9B 3AYWC 3AZHD 3LJAC 4X23A 3WAAC 2AROD 4ZUXA 1P3LB 3UTAB 4ZBJB 5GXQB 5B0YA 1BH9A 4YM6A 2CV5C 4H9NB 3AZJD 5B31B 3KSYA 3KUYC 5CPIB 1AOIA 1BH8A 3W97A 5G49A 5B1MB 3REHA 5B1LA 1N1JB 5AY8B 4R8PD 4QLCB 3AYWA 3X1VB 1P3OB 5B2JC 3WKJC 2RVQD 3MGRD 2L5AA 3MGSC 1KX3B 4XZQD 4J8UA 2YFWB 3AZMB 5DNNC 2CV5A 1P3AC 4J8XC 3KUYA 5B0ZB 4LD9C 1P3PC 5KDMB 1U35C 3REKB 5B0YB 4WV4B 2BYMA 1BH9B 3AV2B 5B2JA 4NFTA 3REJB 1S32D 5GT3D 1AOIB 1P3BD 3VH6A 3UT9D 3W97B 3AFAB 4J8VD 3MGSA 1H3OB 3W99D 3KXBC 1P3AA 5DNNA 4J8WB 5B2IC 2NQBD 3WA9B 4J8XA 3WTPD 2HIOB 3MGPD 3REIB 1P3KD 5AVBB 1P3PA 4LD9A 1TAFA 1TZYD 5GSUC 5BT1D 1P3FC 2FJ7B 3AZGC 4H9QB 5B31G 1P3GC 4J8UB 3AZED 1M1AD 5F99C 3LZ1D 4Z66B 5C3IB 3A6ND 2LY8A 2BYMB 5E5AB 3C1CC 5CP6D 1KX4C 3AV1B 3KXBA 3O62D 1KX5A 4M6BA 5GSUA 3X1UD 1P3FA 3UTBD 3LZ0B 3AZGA 3AZKC 3X1TD 2F8NA 1P3GA 2NZDD 5DNMB 5B33C 2F8NH 3B6FB 5F99A 2IO5C 4YS3A 3R45B 3W96C 3NQUA 3C1CA 4CSRB 1KX4A 1M19A 3KWQB 1JFIA 1P3MB 3RELC 5JA4A 3V9RB 4XUJC 5B32B 3AZFD 5B33A 5BNVA 3VH6W 3LELB 1F66D 1KX5B 5JRGC 5GSUB 4AWLC 3W96A 2F8NB 1P34D 4JJND 5AV6C 1B67A 1M18C 3W98D 3MGQA 4EO5C 3RELA 1WWIA 4YS3B 1ID3D 1KX4B 1M19B 2PYOB 4KHAB 1P3IB 5AV8C 5CPKD 1F1EA 5JRGA 5AV9D 2YFVA 5JA4B 5CPJC 1P3LD 3UTAD 5GXQD 5AV6A 5GT0B 5B33B 3AZNC 1M18A 4Z5TC 4KUDC 3X1SB 4WU9C 4WU8B 1A7WA 3TU4C 5AV5C 5B31D 5CPID 4UUZB 3AZHC 3MVDB 2AROC 4Z2MH 5B1MD 5AV8A 5AY8D 4QLCD 3MGQB 3X1VD 1P3OD 5B32G 1EQZB 5AVCB 3AZJC 1HQ3B 4H9OB 3AZLB 3AZID 3AZNA 1KX3D 4Z5TA 4WU9A 2F8NG 3AZMD 4G92C 3TU4A 4R8PC 3B6GB 5BO0A 5B0ZD 3REKD 5B0YD 5FUGA 2RVQC 3AV2D 4G91B 3MGRC 2BYKA 4KGCB 4XZQC 3LJAA 1KU5A 3WAAA 3MNNB 3REJD 3AZJA 4NE6A 3C1BB 3AN2B 1AOID 3W97D 3AFAD 4H9PB 5B40B 4J8WD 4R8PA 3WA9D 2HUEC 4X23B 2HIOD 3REID 4ZUXB 5AVBD 4NE5A 2FJ7D 5GT3C 4E45A 1P3BC 4YM6B 4Z5TB 3UT9C 3MGRA 4J8VC 4J8UD 4XZQA 3W99C 2NQBC 4Z66D 3WKJA 1BH8B 3WTPC 5G49B 3MGPC 1P3KC 3REHB 1TZYC 5E5AD 4H9RA 5B1LB 3VH5A 5BT1C 3B0DC 3AV1D 3AYWB 3LJAB 3WAAB 3AZEC 3VH6T 1U35A 1M1AC 3LZ1C 3LZ0D 1P3BA 3A6NC 3UT9A 4J8VA 5DNMD 2CV5B 5CP6C 4R8PB 3KUYB 3W99A 3B6FD 2NQBA 3O62C 3NQJA 3WTPA 1TZYA 3X1UC 3UTBC 3KWQD 5B2IA 3X1TC 5B2JB 2NZDC 3AZEA 5B24D 1P3MD 1M1AA 3WKJB 3LZ1A 3MGSB 1ZLAD 3A6NA 5B32D 1P3AB 5DNNB 5CP6A 4J8XB 3LELD 4LD9B 1P3PB 1KX5D 3O62A 1U35B 1TAFB 3B0BA 1P3BB 2F8ND 3X1UA 3UTBA 3X1TA 2NZDA 3AZFC 1F66C 4YS3D 4CAYA 3AZKA 5BS7C 1B6WA 1KX4D 3KXBB 1M19D 5B2IB 2PYOD 1P34C 1P3ID 4JJNC 4H9SC 3VH5W 1P3FB 3AZGB 3W98C 1P3GB 1ID3C 4HGAC 5GT0D 5B33D 5F99B 3X1SD 3AZFA 4WU8D 1F66A 5CPKC 4XUJA 5BS7A 3NQUB 5AV9C 3X1UB 3C1CB 3MVDD 1P34A 4JJNA 4ZBJC 5GXQC 3UTAC 1JFIB 4H9SA 3MGQD 3B0CT 1EQZD 5BNXA 4CAYB 3W98A 3AZKB 5AVCD 5CHLB 5B31C 1HQ3D 1ID3A 3AZLD 5BNVB 2IO5B 5B1MC 3B6GD 5AY8C 5CPKA 3W96B 1Q9CA 4QLCC 5AV9A 3X1VC 1P3OC 3UTAA 5GXQA 4DRBA 3AZIC 1KX3C 4KGCD 3RELB 3AZMC 5CPJA 3MNND 3AN2D 4H9NA 4XUJB 3C1BD 5B31A 5B0ZC 3REKC 4KUDA 5B0YC 5B1MA 5JRGB 5B40D 5AV5A 3AV2C 1N1JA 2YFVB 5AY8A 4AWLB 4X23D 4QLCA 4ZUXD 3AZHA 3X1VA 5AV6B 2AROA 3REJC 1AOIC 1M18B 4YM6D 3W97C 3AFAC 3AZIA 4EO5B 1KX3A 3AZMA 2YFWA 4J8WC 1HTAA 3WA9C 5B0ZA 2HIOC 3REIC 5AVBC 5KDMA 3REHD 3REKA 2FJ7C 5AV8B 5B1LD 3B0CW 3AYWD 3AV2A 3LJAD 4J8UC 3WAAD 5CPJB 1S32C 3REJA 4Z66C 5C3IC 3AZNB 4KUDB 1BFMA 4WU9B 3AFAA 2CV5D 5E5AC 3TU4B 1H3OA 5AV5B 5BO0B 3KUYD 3AV1C 4J8WA 3AZHB 3WA9A 2AROB 2HIOA 5FUGB 4DRAA 5AVBA 3REIA 2FJ7A 3LZ0C 4H9QA 2BYKB 3AZIB 5B2JD 5DNMC 3AZJB 3WKJD 4NE3A 1S32A 3B6FC 5GT3A 3VH5T 4Z66A 3MGSD 4WNNA 1P3AD 5DNND 4G92B 5E5AA 4J8XD 3AV1A 3KWQC 4LD9D 1P3PD 1U35D 3MGPA 1P3KA 5B24C 1P3MC 4Z2MG 3MGRB 3LZ0A 1ULYA 1ZLAC 4XZQB 5B32C 5DNMA 3LELC 3B6FA 4WZSB 1KX5C 4H9RB 3R45A 3KXBD 5B2ID 2HUEB 4CSRA 3KWQA 5GSUD 1P3FD 1S32B 5GT3B 5B24A 3AZGD 1P3MA 2CWEA 1P3GD 3UT9B 4YS3C 4WNNB 4J8VB 1ZLAA 3V9RA 3W99B 5B32A 1M19C 5F99D 2NQBB 2PYOC 1P3IC 3NQJB 3WTPB 3LELA 3MGPB 1P3KB 1TZYB 3C1CD 3B0DB 4E44A 2F8NK 5GT0C 3AZEB 1M1AB 3X1SC 3LZ1B 4WU8C 3AZKD 3A6NB 3WTPE 1R4VA 5CP6B 3MVDC
chains in the Genus database with same CATH superfamily
2PYOA 3O62B 2ZM5A 4KHAA 1P3IA 5B24B 3W96D 3MGQC 1EQZC 1WWSA 3UTBB 5AVCC 3X1TB 1P3LC 1ZLAB 1HQ3C 2G5HC 2Y2LA 5GT0A 2NZDB 3AZLC 3RELD 3X1SA 4WU8A 4XUJD 3B6GC 5CPIC 4UUZA 3MVDA 5JRGD 4G91C 4KGCC 1EQZA 3A1KA 5AV6D 3MNNC 5AVCA 3AN2C 1P3LA 3C1BC 1HQ3A 4H9OA 1M18D 3AZFB 3AZLA 1F66B 5B40C 3B6GA 4X23C 5CPIA 4ZUXC 1P34B 4JJNB 5AV8D 4YM6C 2JSSA 5BNXB 3W98B 5CPJD 1P3OA 4KGCA 1ID3B 4HGAB 3MNNA 3AN2A 3C1BA 3AZND 4KUDD 4Z5TD 4WU9D 3REHC 3TU4D 5B1LC 5AV5D 5CPKB 4H9PA 5B40A 5AV9B 3AYWC 3AZHD 3LJAC 4X23A 3WAAC 2AROD 4ZUXA 1PZRA 1P3LB 3UTAB 4ZBJB 5GXQB 5B0YA 1BH9A 4YM6A 2CV5C 4H9NB 3AZJD 5B31B 3KSYA 3KUYC 5CPIB 1AOIA 1BH8A 3W97A 5G49A 5B1MB 3REHA 5B1LA 1N1JB 5AY8B 4R8PD 4QLCB 3AYWA 3X1VB 1P3OB 5B2JC 3WKJC 2RVQD 2Y2JA 3MGRD 2L5AA 3MGSC 1KX3B 4XZQD 4J8UA 2YFWB 3AZMB 5DNNC 2CV5A 1P3AC 3A1IA 4J8XC 3KUYA 5B0ZB 4LD9C 1P3PC 5KDMB 1U35C 3REKB 5B0YB 4WV4B 2BYMA 1BH9B 3AV2B 5B2JA 4NFTA 2Y2NA 3REJB 1S32D 5GT3D 1AOIB 1P3BD 3VH6A 3UT9D 3W97B 3AFAB 4J8VD 3MGSA 1H3OB 3W99D 3KXBC 1P3AA 5DNNA 4J8WB 5B2IC 2NQBD 3WA9B 4J8XA 3WTPD 2HIOB 3MGPD 3REIB 1P3KD 5AVBB 1P3PA 4LD9A 1TAFA 1TZYD 5GSUC 5BT1D 1P3FC 2FJ7B 3AZGC 4H9QB 5B31G 1P3GC 4J8UB 3AZED 1M1AD 5F99C 3LZ1D 4Z66B 5C3IB 3A6ND 2LY8A 2BYMB 5E5AB 3C1CC 5CP6D 1KX4C 3AV1B 3KXBA 3EPHA 3O62D 3EPLA 1KX5A 3IP4C 4M6BA 5GSUA 3X1UD 1P3FA 3UTBD 3LZ0B 3AZGA 3AZKC 3X1TD 2F8NA 1P3GA 2NZDD 5DNMB 5B33C 3EPJA 2F8NH 3B6FB 5F99A 2IO5C 4YS3A 3R45B 4WJ3C 2G5IC 3W96C 3NQUA 3C1CA 4CSRB 1KX4A 1M19A 3KWQB 1JFIA 1P3MB 3RELC 5JA4A 4DQYB 3EG5B 3V9RB 4XUJC 5B32B 3AZFD 5B33A 5BNVA 3VH6W 3LELB 1F66D 1KX5B 5JRGC 2Y2QA 5GSUB 4AWLC 3W96A 2F8NB 1P34D 4JJND 5AV6C 1B67A 1M18C 3F6TA 3W98D 3MGQA 4EO5C 3RELA 1WWIA 4YS3B 1ID3D 2ZY2A 1KX4B 1M19B 2PYOB 4KHAB 1P3IB 5AV8C 5CPKD 1F1EA 5JRGA 5AV9D 2YFVA 5JA4B 5CPJC 1P3LD 3UTAD 5GXQD 5AV6A 5GT0B 5B33B 3AZNC 1M18A 4Z5TC 4KUDC 3X1SB 4WU9C 4WU8B 1Z2CB 1A7WA 3TU4C 5AV5C 5B31D 5CPID 4UUZB 3AZHC 3MVDB 2AROC 4Z2MH 5B1MD 5AV8A 5AY8D 4QLCD 3MGQB 3X1VD 1P3OD 2DF4C 5B32G 1EQZB 5AVCB 3AZJC 1HQ3B 4H9OB 3AZLB 3AZID 3AZNA 1KX3D 4Z5TA 4WU9A 2F8NG 3AZMD 4G92C 2W8SA 3TU4A 4R8PC 3B6GB 5BO0A 5B0ZD 1T3UA 3REKD 5B0YD 5FUGA 3H0RC 2RVQC 3AV2D 4G91B 3MGRC 2BYKA 4KGCB 4XZQC 3LJAA 1KU5A 3WAAA 3MNNB 3REJD 3AZJA 4NE6A 3C1BB 3AN2B 1AOID 3W97D 3AFAD 4H9PB 5B40B 2ZY4A 4J8WD 4R8PA 3WA9D 2HUEC 4X23B 2HIOD 3REID 4ZUXB 5AVBD 3AL0C 4NE5A 2FJ7D 5GT3C 4E45A 1P3BC 4YM6B 4Z5TB 3UT9C 3MGRA 4J8VC 4J8UD 2Y2OA 4XZQA 3W99C 2NQBC 2J8PA 4Z66D 3WKJA 1BH8B 1W2EA 3WTPC 5G49B 3MGPC 1P3KC 3REHB 1TZYC 5E5AD 4H9RA 4UPKA 5B1LB 3VH5A 5BT1C 3EPKA 3B0DC 3AV1D 2UWXA 3AYWB 3LJAB 3WAAB 3AZEC 3VH6T 1U35A 1M1AC 3FDDA 3LZ1C 3LZ0D 1P3BA 3A6NC 2Y2HA 3UT9A 4J8VA 2Y2MA 5DNMD 2CV5B 5CP6C 4R8PB 3KUYB 3W99A 3B6FD 2NQBA 3O62C 3NQJA 3WTPA 1TZYA 3X1UC 3UTBC 3KWQD 5B2IA 3X1TC 2VQRA 5B2JB 2Y2KA 2NZDC 3AZEA 5B24D 1P3MD 1M1AA 3WKJB 3LZ1A 2XD5A 3MGSB 1ZLAD 3A6NA 5B32D 1P3AB 5DNNB 5CP6A 4J8XB 3LELD 4LD9B 1P3PB 1KX5D 3O62A 1U35B 1TAFB 3B0BA 1P3BB 2F8ND 3X1UA 3UTBA 3X1TA 2BG1A 2NZDA 3AZFC 2FFFB 1F66C 4YS3D 4CAYA 3AZKA 5BS7C 1B6WA 1KX4D 3KXBB 1M19D 5B2IB 2PYOD 1P34C 1P3ID 4JJNC 4H9SC 3VH5W 1P3FB 3AZGB 2RIQA 3W98C 1P3GB 1ID3C 4HGAC 5GT0D 5B33D 2ZY5A 5F99B 3X1SD 3AZFA 4WU8D 1F66A 5CPKC 4XUJA 5BS7A 3NQUB 5AV9C 3X1UB 3C1CB 3MVDD 2JE5A 1P34A 4JJNA 4ZBJC 5GXQC 2F2AC 3UTAC 1JFIB 4H9SA 3MGQD 3B0CT 3KFUG 1EQZD 5BNXA 4CAYB 3W98A 3AZKB 5AVCD 5CHLB 5B31C 1HQ3D 1ID3A 3AZLD 5BNVB 2IO5B 5B1MC 3B6GD 5AY8C 5CPKA 3W96B 1Q9CA 4QLCC 5AV9A 3X1VC 1P3OC 3UTAA 5GXQA 4DRBA 3AZIC 1KX3C 4KGCD 3RELB 3AZMC 5CPJA 3MNND 3AN2D 4H9NA 4XUJB 3C1BD 5B31A 5B0ZC 3REKC 4KUDA 5B0YC 5B1MA 5JRGB 5B40D 5AV5A 3AV2C 1N1JA 2YFVB 5AY8A 4AWLB 4X23D 4QLCA 2JCHA 4ZUXD 3AZHA 3X1VA 5AV6B 2AROA 3REJC 2Y2IA 1AOIC 1M18B 4YM6D 3W97C 3AFAC 3AZIA 4EO5B 1KX3A 3AZMA 2YFWA 4J8WC 1HTAA 3WA9C 5B0ZA 2HIOC 3REIC 5AVBC 5KDMA 3REHD 3REKA 2FJ7C 5AV8B 5B1LD 3B0CW 3AYWD 3AV2A 3LJAD 4J8UC 3WAAD 5CPJB 1S32C 3H0LC 3REJA 4Z66C 5C3IC 3AZNB 4KUDB 1BFMA 4WU9B 3AFAA 2CV5D 5E5AC 3TU4B 1H3OA 5AV5B 5BO0B 3P5JB 3KUYD 3AV1C 2Y2PA 4J8WA 3AZHB 3WA9A 2AROB 2HIOA 5FUGB 4DRAA 5AVBA 3REIA 2FJ7A 3LZ0C 4H9QA 2BYKB 3AZIB 5B2JD 5DNMC 3AZJB 3WKJD 4NE3A 1S32A 3B6FC 2XD1A 5GT3A 3VH5T 4Z66A 3MGSD 4WNNA 1P3AD 5DNND 4G92B 5E5AA 4J8XD 3AV1A 3KWQC 4LD9D 1P3PD 2Y2GA 1U35D 3MGPA 1P3KA 5B24C 1P3MC 4Z2MG 3MGRB 3LZ0A 1ULYA 1ZLAC 4XZQB 2ZY3A 5B32C 5DNMA 3LELC 3B6FA 4WZSB 1KX5C 4H9RB 3R45A 3KXBD 5B2ID 2HUEB 4CSRA 3KWQA 5GSUD 1P3FD 1S32B 5GT3B 5B24A 3AZGD 1P3MA 2CWEA 1P3GD 3UT9B 4YS3C 4WNNB 4J8VB 1ZLAA 3V9RA 3W99B 5B32A 1M19C 5F99D 2NQBB 2PYOC 1P3IC 3NQJB 3WTPB 3LELA 3MGPB 1P3KB 1TZYB 3C1CD 3B0DB 4E44A 2F8NK 5GT0C 3AZEB 3H0MC 1M1AB 2DQNC 3X1SC 3LZ1B 4WU8C 3AZKD 3A6NB 3WTPE 1R4VA 5CP6B 3MVDC
chains in the Genus database with same CATH topology
2PYOA 3O62B 2ZM5A 4KHAA 1P3IA 5B24B 3W96D 3MGQC 1EQZC 1WWSA 3UTBB 5AVCC 3X1TB 1P3LC 1ZLAB 1HQ3C 2G5HC 2Y2LA 5GT0A 2NZDB 3AZLC 3RELD 3X1SA 4WU8A 4XUJD 3B6GC 5CPIC 4UUZA 3MVDA 5JRGD 4G91C 4KGCC 1EQZA 3A1KA 5AV6D 3MNNC 5AVCA 3AN2C 1P3LA 3C1BC 1HQ3A 4H9OA 1M18D 3AZFB 3AZLA 1F66B 5B40C 3B6GA 4X23C 5CPIA 4ZUXC 1P34B 4JJNB 5AV8D 4YM6C 2JSSA 5BNXB 3W98B 5CPJD 1P3OA 4KGCA 1ID3B 4HGAB 3MNNA 3AN2A 3C1BA 3AZND 4KUDD 4Z5TD 4WU9D 3REHC 3TU4D 5B1LC 5AV5D 5CPKB 4H9PA 5B40A 5AV9B 3AYWC 3AZHD 3LJAC 4X23A 3WAAC 2AROD 4ZUXA 1PZRA 1P3LB 3UTAB 4ZBJB 5GXQB 5B0YA 1BH9A 4YM6A 2CV5C 4H9NB 3AZJD 5B31B 3KSYA 3KUYC 5CPIB 1AOIA 1BH8A 3W97A 5G49A 5B1MB 3REHA 5B1LA 1N1JB 5AY8B 4R8PD 4QLCB 3AYWA 3X1VB 1P3OB 5B2JC 3WKJC 2RVQD 2Y2JA 3MGRD 2L5AA 3MGSC 1KX3B 4XZQD 4J8UA 2YFWB 3AZMB 5DNNC 2CV5A 1P3AC 3A1IA 4J8XC 3KUYA 5B0ZB 4LD9C 1P3PC 5KDMB 1U35C 3REKB 5B0YB 4WV4B 2BYMA 1BH9B 3AV2B 5B2JA 4NFTA 2Y2NA 3REJB 1S32D 5GT3D 1AOIB 1P3BD 3VH6A 3UT9D 3W97B 3AFAB 4J8VD 3MGSA 1H3OB 3W99D 3KXBC 1P3AA 5DNNA 4J8WB 5B2IC 2NQBD 3WA9B 4J8XA 3WTPD 2HIOB 3MGPD 3REIB 1P3KD 5AVBB 1P3PA 4LD9A 1TAFA 1TZYD 5GSUC 5BT1D 1P3FC 2FJ7B 3AZGC 4H9QB 5B31G 1P3GC 4J8UB 3AZED 1M1AD 5F99C 3LZ1D 4Z66B 5C3IB 3A6ND 2LY8A 2BYMB 5E5AB 3C1CC 5CP6D 1KX4C 3AV1B 3KXBA 3EPHA 3O62D 3EPLA 1KX5A 3IP4C 4M6BA 5GSUA 3X1UD 1P3FA 3UTBD 3LZ0B 3AZGA 3AZKC 3X1TD 2F8NA 1P3GA 2NZDD 5DNMB 5B33C 3EPJA 2F8NH 3B6FB 5F99A 2IO5C 4YS3A 3R45B 4WJ3C 2G5IC 3W96C 3NQUA 3C1CA 4CSRB 1KX4A 1M19A 3KWQB 1JFIA 1P3MB 3RELC 5JA4A 4DQYB 3EG5B 3V9RB 4XUJC 5B32B 3AZFD 5B33A 5BNVA 3VH6W 3LELB 1F66D 1KX5B 5JRGC 2Y2QA 5GSUB 4AWLC 3W96A 2F8NB 1P34D 4JJND 5AV6C 1B67A 1M18C 3F6TA 3W98D 3MGQA 4EO5C 3RELA 1WWIA 4YS3B 1ID3D 2ZY2A 1KX4B 1M19B 2PYOB 4KHAB 1P3IB 5AV8C 5CPKD 1F1EA 5JRGA 5AV9D 2YFVA 5JA4B 5CPJC 1P3LD 3UTAD 5GXQD 5AV6A 5GT0B 5B33B 3AZNC 1M18A 4Z5TC 4KUDC 3X1SB 4WU9C 4WU8B 1Z2CB 1A7WA 3TU4C 5AV5C 5B31D 5CPID 4UUZB 3AZHC 3MVDB 2AROC 4Z2MH 5B1MD 5AV8A 5AY8D 4QLCD 3MGQB 3X1VD 1P3OD 2DF4C 5B32G 1EQZB 5AVCB 3AZJC 1HQ3B 4H9OB 3AZLB 3AZID 3AZNA 1KX3D 4Z5TA 4WU9A 2F8NG 3AZMD 4G92C 2W8SA 3TU4A 4R8PC 3B6GB 5BO0A 5B0ZD 1T3UA 3REKD 5B0YD 5FUGA 3H0RC 2RVQC 3AV2D 4G91B 3MGRC 2BYKA 4KGCB 4XZQC 3LJAA 1KU5A 3WAAA 3MNNB 3REJD 3AZJA 4NE6A 3C1BB 3AN2B 1AOID 3W97D 3AFAD 4H9PB 5B40B 2ZY4A 4J8WD 4R8PA 3WA9D 2HUEC 4X23B 2HIOD 3REID 4ZUXB 5AVBD 3AL0C 4NE5A 2FJ7D 5GT3C 4E45A 1P3BC 4YM6B 4Z5TB 3UT9C 3MGRA 4J8VC 4J8UD 2Y2OA 4XZQA 3W99C 2NQBC 2J8PA 4Z66D 3WKJA 1BH8B 1W2EA 3WTPC 5G49B 3MGPC 1P3KC 3REHB 1TZYC 5E5AD 4H9RA 4UPKA 5B1LB 3VH5A 5BT1C 3EPKA 3B0DC 3AV1D 2UWXA 3AYWB 3LJAB 3WAAB 3AZEC 3VH6T 1U35A 1M1AC 3FDDA 3LZ1C 3LZ0D 1P3BA 3A6NC 2Y2HA 3UT9A 4J8VA 2Y2MA 5DNMD 2CV5B 5CP6C 4R8PB 3KUYB 3W99A 3B6FD 2NQBA 3O62C 3NQJA 3WTPA 1TZYA 3X1UC 3UTBC 3KWQD 5B2IA 3X1TC 2VQRA 5B2JB 2Y2KA 2NZDC 3AZEA 5B24D 1P3MD 1M1AA 3WKJB 3LZ1A 2XD5A 3MGSB 1ZLAD 3A6NA 5B32D 1P3AB 5DNNB 5CP6A 4J8XB 3LELD 4LD9B 1P3PB 1KX5D 3O62A 1U35B 1TAFB 3B0BA 1P3BB 2F8ND 3X1UA 3UTBA 3X1TA 2BG1A 2NZDA 3AZFC 2FFFB 1F66C 4YS3D 4CAYA 3AZKA 5BS7C 1B6WA 1KX4D 3KXBB 1M19D 5B2IB 2PYOD 1P34C 1P3ID 4JJNC 4H9SC 3VH5W 1P3FB 3AZGB 2RIQA 3W98C 1P3GB 1ID3C 4HGAC 5GT0D 5B33D 2ZY5A 5F99B 3X1SD 3AZFA 4WU8D 1F66A 5CPKC 4XUJA 5BS7A 3NQUB 5AV9C 3X1UB 3C1CB 3MVDD 2JE5A 1P34A 4JJNA 4ZBJC 5GXQC 2F2AC 3UTAC 1JFIB 4H9SA 3MGQD 3B0CT 3KFUG 1EQZD 5BNXA 4CAYB 3W98A 3AZKB 5AVCD 5CHLB 5B31C 1HQ3D 1ID3A 3AZLD 5BNVB 2IO5B 5B1MC 3B6GD 5AY8C 5CPKA 3W96B 1Q9CA 4QLCC 5AV9A 3X1VC 1P3OC 3UTAA 5GXQA 4DRBA 3AZIC 1KX3C 4KGCD 3RELB 3AZMC 5CPJA 3MNND 3AN2D 4H9NA 4XUJB 3C1BD 5B31A 5B0ZC 3REKC 4KUDA 5B0YC 5B1MA 5JRGB 5B40D 5AV5A 3AV2C 1N1JA 2YFVB 5AY8A 4AWLB 4X23D 4QLCA 2JCHA 4ZUXD 3AZHA 3X1VA 5AV6B 2AROA 3REJC 2Y2IA 1AOIC 1M18B 4YM6D 3W97C 3AFAC 3AZIA 4EO5B 1KX3A 3AZMA 2YFWA 4J8WC 1HTAA 3WA9C 5B0ZA 2HIOC 3REIC 5AVBC 5KDMA 3REHD 3REKA 2FJ7C 5AV8B 5B1LD 3B0CW 3AYWD 3AV2A 3LJAD 4J8UC 3WAAD 5CPJB 1S32C 3H0LC 3REJA 4Z66C 5C3IC 3AZNB 4KUDB 1BFMA 4WU9B 3AFAA 2CV5D 5E5AC 3TU4B 1H3OA 5AV5B 5BO0B 3P5JB 3KUYD 3AV1C 2Y2PA 4J8WA 3AZHB 3WA9A 2AROB 2HIOA 5FUGB 4DRAA 5AVBA 3REIA 2FJ7A 3LZ0C 4H9QA 2BYKB 3AZIB 5B2JD 5DNMC 3AZJB 3WKJD 4NE3A 1S32A 3B6FC 2XD1A 5GT3A 3VH5T 4Z66A 3MGSD 4WNNA 1P3AD 5DNND 4G92B 5E5AA 4J8XD 3AV1A 3KWQC 4LD9D 1P3PD 2Y2GA 1U35D 3MGPA 1P3KA 5B24C 1P3MC 4Z2MG 3MGRB 3LZ0A 1ULYA 1ZLAC 4XZQB 2ZY3A 5B32C 5DNMA 3LELC 3B6FA 4WZSB 1KX5C 4H9RB 3R45A 3KXBD 5B2ID 2HUEB 4CSRA 3KWQA 5GSUD 1P3FD 1S32B 5GT3B 5B24A 3AZGD 1P3MA 2CWEA 1P3GD 3UT9B 4YS3C 4WNNB 4J8VB 1ZLAA 3V9RA 3W99B 5B32A 1M19C 5F99D 2NQBB 2PYOC 1P3IC 3NQJB 3WTPB 3LELA 3MGPB 1P3KB 1TZYB 3C1CD 3B0DB 4E44A 2F8NK 5GT0C 3AZEB 3H0MC 1M1AB 2DQNC 3X1SC 3LZ1B 4WU8C 3AZKD 3A6NB 3WTPE 1R4VA 5CP6B 3MVDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO A;  3O62 B;  4KHA A;  1P3I A;  5B24 B;  3W96 D;  3MGQ C;  1EQZ C;  1WWS A;  3UTB B;  5AVC C;  3X1T B;  1P3L C;  1ZLA B;  1HQ3 C;  5GT0 A;  2NZD B;  3AZL C;  3REL D;  3X1S A;  4WU8 A;  4XUJ D;  3B6G C;  5CPI C;  4UUZ A;  3MVD A;  5JRG D;  4G91 C;  4KGC C;  1EQZ A;  5AV6 D;  3MNN C;  5AVC A;  3AN2 C;  1P3L A;  3C1B C;  1HQ3 A;  4H9O A;  1M18 D;  3AZF B;  3AZL A;  1F66 B;  5B40 C;  3B6G A;  4X23 C;  5CPI A;  4ZUX C;  1P34 B;  4JJN B;  5AV8 D;  4YM6 C;  2JSS A;  5BNX B;  3W98 B;  5CPJ D;  1P3O A;  4KGC A;  1ID3 B;  4HGA B;  3MNN A;  3AN2 A;  3C1B A;  3AZN D;  4KUD D;  4Z5T D;  4WU9 D;  3REH C;  3TU4 D;  5B1L C;  5AV5 D;  5CPK B;  4H9P A;  5B40 A;  5AV9 B;  3AYW C;  3AZH D;  3LJA C;  4X23 A;  3WAA C;  2ARO D;  4ZUX A;  1P3L B;  3UTA B;  4ZBJ B;  5GXQ B;  5B0Y A;  1BH9 A;  4YM6 A;  2CV5 C;  4H9N B;  3AZJ D;  5B31 B;  3KSY A;  3KUY C;  5CPI B;  1AOI A;  1BH8 A;  3W97 A;  5G49 A;  5B1M B;  3REH A;  5B1L A;  1N1J B;  5AY8 B;  4R8P D;  4QLC B;  3AYW A;  3X1V B;  1P3O B;  5B2J C;  3WKJ C;  2RVQ D;  3MGR D;  2L5A A;  3MGS C;  1KX3 B;  4XZQ D;  4J8U A;  2YFW B;  3AZM B;  5DNN C;  2CV5 A;  1P3A C;  4J8X C;  3KUY A;  5B0Z B;  4LD9 C;  1P3P C;  5KDM B;  1U35 C;  3REK B;  5B0Y B;  4WV4 B;  2BYM A;  1BH9 B;  3AV2 B;  5B2J A;  4NFT A;  3REJ B;  1S32 D;  5GT3 D;  1AOI B;  1P3B D;  3VH6 A;  3UT9 D;  3W97 B;  3AFA B;  4J8V D;  3MGS A;  1H3O B;  3W99 D;  3KXB C;  1P3A A;  5DNN A;  4J8W B;  5B2I C;  2NQB D;  3WA9 B;  4J8X A;  3WTP D;  2HIO B;  3MGP D;  3REI B;  1P3K D;  5AVB B;  1P3P A;  4LD9 A;  1TAF A;  1TZY D;  5GSU C;  5BT1 D;  1P3F C;  2FJ7 B;  3AZG C;  4H9Q B;  5B31 G;  1P3G C;  4J8U B;  3AZE D;  1M1A D;  5F99 C;  3LZ1 D;  4Z66 B;  5C3I B;  3A6N D;  2LY8 A;  2BYM B;  5E5A B;  3C1C C;  5CP6 D;  1KX4 C;  3AV1 B;  3KXB A;  3O62 D;  1KX5 A;  4M6B A;  5GSU A;  3X1U D;  1P3F A;  3UTB D;  3LZ0 B;  3AZG A;  3AZK C;  3X1T D;  2F8N A;  1P3G A;  2NZD D;  5DNM B;  5B33 C;  2F8N H;  3B6F B;  5F99 A;  2IO5 C;  4YS3 A;  3R45 B;  3W96 C;  3NQU A;  3C1C A;  4CSR B;  1KX4 A;  1M19 A;  3KWQ B;  1JFI A;  1P3M B;  3REL C;  5JA4 A;  3V9R B;  4XUJ C;  5B32 B;  3AZF D;  5B33 A;  5BNV A;  3VH6 W;  3LEL B;  1F66 D;  1KX5 B;  5JRG C;  5GSU B;  4AWL C;  3W96 A;  2F8N B;  1P34 D;  4JJN D;  5AV6 C;  1B67 A;  1M18 C;  3W98 D;  3MGQ A;  4EO5 C;  3REL A;  1WWI A;  4YS3 B;  1ID3 D;  1KX4 B;  1M19 B;  2PYO B;  4KHA B;  1P3I B;  5AV8 C;  5CPK D;  1F1E A;  5JRG A;  5AV9 D;  2YFV A;  5JA4 B;  5CPJ C;  1P3L D;  3UTA D;  5GXQ D;  5AV6 A;  5GT0 B;  5B33 B;  3AZN C;  1M18 A;  4Z5T C;  4KUD C;  3X1S B;  4WU9 C;  4WU8 B;  1A7W A;  3TU4 C;  5AV5 C;  5B31 D;  5CPI D;  4UUZ B;  3AZH C;  3MVD B;  2ARO C;  4Z2M H;  5B1M D;  5AV8 A;  5AY8 D;  4QLC D;  3MGQ B;  3X1V D;  1P3O D;  5B32 G;  1EQZ B;  5AVC B;  3AZJ C;  1HQ3 B;  4H9O B;  3AZL B;  3AZI D;  3AZN A;  1KX3 D;  4Z5T A;  4WU9 A;  2F8N G;  3AZM D;  4G92 C;  3TU4 A;  4R8P C;  3B6G B;  5BO0 A;  5B0Z D;  3REK D;  5B0Y D;  5FUG A;  2RVQ C;  3AV2 D;  4G91 B;  3MGR C;  2BYK A;  4KGC B;  4XZQ C;  3LJA A;  1KU5 A;  3WAA A;  3MNN B;  3REJ D;  3AZJ A;  4NE6 A;  3C1B B;  3AN2 B;  1AOI D;  3W97 D;  3AFA D;  4H9P B;  5B40 B;  4J8W D;  4R8P A;  3WA9 D;  2HUE C;  4X23 B;  2HIO D;  3REI D;  4ZUX B;  5AVB D;  4NE5 A;  2FJ7 D;  5GT3 C;  4E45 A;  1P3B C;  4YM6 B;  4Z5T B;  3UT9 C;  3MGR A;  4J8V C;  4J8U D;  4XZQ A;  3W99 C;  2NQB C;  4Z66 D;  3WKJ A;  1BH8 B;  3WTP C;  5G49 B;  3MGP C;  1P3K C;  3REH B;  1TZY C;  5E5A D;  4H9R A;  5B1L B;  3VH5 A;  5BT1 C;  3B0D C;  3AV1 D;  3AYW B;  3LJA B;  3WAA B;  3AZE C;  3VH6 T;  1U35 A;  1M1A C;  3LZ1 C;  3LZ0 D;  1P3B A;  3A6N C;  3UT9 A;  4J8V A;  5DNM D;  2CV5 B;  5CP6 C;  4R8P B;  3KUY B;  3W99 A;  3B6F D;  2NQB A;  3O62 C;  3NQJ A;  3WTP A;  1TZY A;  3X1U C;  3UTB C;  3KWQ D;  5B2I A;  3X1T C;  5B2J B;  2NZD C;  3AZE A;  5B24 D;  1P3M D;  1M1A A;  3WKJ B;  3LZ1 A;  3MGS B;  1ZLA D;  3A6N A;  5B32 D;  1P3A B;  5DNN B;  5CP6 A;  4J8X B;  3LEL D;  4LD9 B;  1P3P B;  1KX5 D;  3O62 A;  1U35 B;  1TAF B;  3B0B A;  1P3B B;  2F8N D;  3X1U A;  3UTB A;  3X1T A;  2NZD A;  3AZF C;  1F66 C;  4YS3 D;  4CAY A;  3AZK A;  5BS7 C;  1B6W A;  1KX4 D;  3KXB B;  1M19 D;  5B2I B;  2PYO D;  1P34 C;  1P3I D;  4JJN C;  4H9S C;  3VH5 W;  1P3F B;  3AZG B;  3W98 C;  1P3G B;  1ID3 C;  4HGA C;  5GT0 D;  5B33 D;  5F99 B;  3X1S D;  3AZF A;  4WU8 D;  1F66 A;  5CPK C;  4XUJ A;  5BS7 A;  3NQU B;  5AV9 C;  3X1U B;  3C1C B;  3MVD D;  1P34 A;  4JJN A;  4ZBJ C;  5GXQ C;  3UTA C;  1JFI B;  4H9S A;  3MGQ D;  3B0C T;  1EQZ D;  5BNX A;  4CAY B;  3W98 A;  3AZK B;  5AVC D;  5CHL B;  5B31 C;  1HQ3 D;  1ID3 A;  3AZL D;  5BNV B;  2IO5 B;  5B1M C;  3B6G D;  5AY8 C;  5CPK A;  3W96 B;  1Q9C A;  4QLC C;  5AV9 A;  3X1V C;  1P3O C;  3UTA A;  5GXQ A;  4DRB A;  3AZI C;  1KX3 C;  4KGC D;  3REL B;  3AZM C;  5CPJ A;  3MNN D;  3AN2 D;  4H9N A;  4XUJ B;  3C1B D;  5B31 A;  5B0Z C;  3REK C;  4KUD A;  5B0Y C;  5B1M A;  5JRG B;  5B40 D;  5AV5 A;  3AV2 C;  1N1J A;  2YFV B;  5AY8 A;  4AWL B;  4X23 D;  4QLC A;  4ZUX D;  3AZH A;  3X1V A;  5AV6 B;  2ARO A;  3REJ C;  1AOI C;  1M18 B;  4YM6 D;  3W97 C;  3AFA C;  3AZI A;  4EO5 B;  1KX3 A;  3AZM A;  2YFW A;  4J8W C;  1HTA A;  3WA9 C;  5B0Z A;  2HIO C;  3REI C;  5AVB C;  5KDM A;  3REH D;  3REK A;  2FJ7 C;  5AV8 B;  5B1L D;  3B0C W;  3AYW D;  3AV2 A;  3LJA D;  4J8U C;  3WAA D;  5CPJ B;  1S32 C;  3REJ A;  4Z66 C;  5C3I C;  3AZN B;  4KUD B;  1BFM A;  4WU9 B;  3AFA A;  2CV5 D;  5E5A C;  3TU4 B;  1H3O A;  5AV5 B;  5BO0 B;  3KUY D;  3AV1 C;  4J8W A;  3AZH B;  3WA9 A;  2ARO B;  2HIO A;  5FUG B;  4DRA A;  5AVB A;  3REI A;  2FJ7 A;  3LZ0 C;  4H9Q A;  2BYK B;  3AZI B;  5B2J D;  5DNM C;  3AZJ B;  3WKJ D;  4NE3 A;  1S32 A;  3B6F C;  5GT3 A;  3VH5 T;  4Z66 A;  3MGS D;  4WNN A;  1P3A D;  5DNN D;  4G92 B;  5E5A A;  4J8X D;  3AV1 A;  3KWQ C;  4LD9 D;  1P3P D;  1U35 D;  3MGP A;  1P3K A;  5B24 C;  1P3M C;  4Z2M G;  3MGR B;  3LZ0 A;  1ULY A;  1ZLA C;  4XZQ B;  5B32 C;  5DNM A;  3LEL C;  3B6F A;  4WZS B;  1KX5 C;  4H9R B;  3R45 A;  3KXB D;  5B2I D;  2HUE B;  4CSR A;  3KWQ A;  5GSU D;  1P3F D;  1S32 B;  5GT3 B;  5B24 A;  3AZG D;  1P3M A;  2CWE A;  1P3G D;  3UT9 B;  4YS3 C;  4WNN B;  4J8V B;  1ZLA A;  3V9R A;  3W99 B;  5B32 A;  1M19 C;  5F99 D;  2NQB B;  2PYO C;  1P3I C;  3NQJ B;  3WTP B;  3LEL A;  3MGP B;  1P3K B;  1TZY B;  3C1C D;  3B0D B;  4E44 A;  2F8N K;  5GT0 C;  3AZE B;  1M1A B;  3X1S C;  3LZ1 B;  4WU8 C;  3AZK D;  3A6N B;  3WTP E;  1R4V A;  5CP6 B;  3MVD C; 
#chains in the Genus database with same CATH topology
 2PYO A;  3O62 B;  2ZM5 A;  4KHA A;  1P3I A;  5B24 B;  3W96 D;  3MGQ C;  1EQZ C;  1WWS A;  3UTB B;  5AVC C;  3X1T B;  1P3L C;  1ZLA B;  1HQ3 C;  2G5H C;  2Y2L A;  5GT0 A;  2NZD B;  3AZL C;  3REL D;  3X1S A;  4WU8 A;  4XUJ D;  3B6G C;  5CPI C;  4UUZ A;  3MVD A;  5JRG D;  4G91 C;  4KGC C;  1EQZ A;  3A1K A;  5AV6 D;  3MNN C;  5AVC A;  3AN2 C;  1P3L A;  3C1B C;  1HQ3 A;  4H9O A;  1M18 D;  3AZF B;  3AZL A;  1F66 B;  5B40 C;  3B6G A;  4X23 C;  5CPI A;  4ZUX C;  1P34 B;  4JJN B;  5AV8 D;  4YM6 C;  2JSS A;  5BNX B;  3W98 B;  5CPJ D;  1P3O A;  4KGC A;  1ID3 B;  4HGA B;  3MNN A;  3AN2 A;  3C1B A;  3AZN D;  4KUD D;  4Z5T D;  4WU9 D;  3REH C;  3TU4 D;  5B1L C;  5AV5 D;  5CPK B;  4H9P A;  5B40 A;  5AV9 B;  3AYW C;  3AZH D;  3LJA C;  4X23 A;  3WAA C;  2ARO D;  4ZUX A;  1PZR A;  1P3L B;  3UTA B;  4ZBJ B;  5GXQ B;  5B0Y A;  1BH9 A;  4YM6 A;  2CV5 C;  4H9N B;  3AZJ D;  5B31 B;  3KSY A;  3KUY C;  5CPI B;  1AOI A;  1BH8 A;  3W97 A;  5G49 A;  5B1M B;  3REH A;  5B1L A;  1N1J B;  5AY8 B;  4R8P D;  4QLC B;  3AYW A;  3X1V B;  1P3O B;  5B2J C;  3WKJ C;  2RVQ D;  2Y2J A;  3MGR D;  2L5A A;  3MGS C;  1KX3 B;  4XZQ D;  4J8U A;  2YFW B;  3AZM B;  5DNN C;  2CV5 A;  1P3A C;  3A1I A;  4J8X C;  3KUY A;  5B0Z B;  4LD9 C;  1P3P C;  5KDM B;  1U35 C;  3REK B;  5B0Y B;  4WV4 B;  2BYM A;  1BH9 B;  3AV2 B;  5B2J A;  4NFT A;  2Y2N A;  3REJ B;  1S32 D;  5GT3 D;  1AOI B;  1P3B D;  3VH6 A;  3UT9 D;  3W97 B;  3AFA B;  4J8V D;  3MGS A;  1H3O B;  3W99 D;  3KXB C;  1P3A A;  5DNN A;  4J8W B;  5B2I C;  2NQB D;  3WA9 B;  4J8X A;  3WTP D;  2HIO B;  3MGP D;  3REI B;  1P3K D;  5AVB B;  1P3P A;  4LD9 A;  1TAF A;  1TZY D;  5GSU C;  5BT1 D;  1P3F C;  2FJ7 B;  3AZG C;  4H9Q B;  5B31 G;  1P3G C;  4J8U B;  3AZE D;  1M1A D;  5F99 C;  3LZ1 D;  4Z66 B;  5C3I B;  3A6N D;  2LY8 A;  2BYM B;  5E5A B;  3C1C C;  5CP6 D;  1KX4 C;  3AV1 B;  3KXB A;  3EPH A;  3O62 D;  3EPL A;  1KX5 A;  3IP4 C;  4M6B A;  5GSU A;  3X1U D;  1P3F A;  3UTB D;  3LZ0 B;  3AZG A;  3AZK C;  3X1T D;  2F8N A;  1P3G A;  2NZD D;  5DNM B;  5B33 C;  3EPJ A;  2F8N H;  3B6F B;  5F99 A;  2IO5 C;  4YS3 A;  3R45 B;  4WJ3 C;  2G5I C;  3W96 C;  3NQU A;  3C1C A;  4CSR B;  1KX4 A;  1M19 A;  3KWQ B;  1JFI A;  1P3M B;  3REL C;  5JA4 A;  4DQY B;  3EG5 B;  3V9R B;  4XUJ C;  5B32 B;  3AZF D;  5B33 A;  5BNV A;  3VH6 W;  3LEL B;  1F66 D;  1KX5 B;  5JRG C;  2Y2Q A;  5GSU B;  4AWL C;  3W96 A;  2F8N B;  1P34 D;  4JJN D;  5AV6 C;  1B67 A;  1M18 C;  3F6T A;  3W98 D;  3MGQ A;  4EO5 C;  3REL A;  1WWI A;  4YS3 B;  1ID3 D;  2ZY2 A;  1KX4 B;  1M19 B;  2PYO B;  4KHA B;  1P3I B;  5AV8 C;  5CPK D;  1F1E A;  5JRG A;  5AV9 D;  2YFV A;  5JA4 B;  5CPJ C;  1P3L D;  3UTA D;  5GXQ D;  5AV6 A;  5GT0 B;  5B33 B;  3AZN C;  1M18 A;  4Z5T C;  4KUD C;  3X1S B;  4WU9 C;  4WU8 B;  1Z2C B;  1A7W A;  3TU4 C;  5AV5 C;  5B31 D;  5CPI D;  4UUZ B;  3AZH C;  3MVD B;  2ARO C;  4Z2M H;  5B1M D;  5AV8 A;  5AY8 D;  4QLC D;  3MGQ B;  3X1V D;  1P3O D;  2DF4 C;  5B32 G;  1EQZ B;  5AVC B;  3AZJ C;  1HQ3 B;  4H9O B;  3AZL B;  3AZI D;  3AZN A;  1KX3 D;  4Z5T A;  4WU9 A;  2F8N G;  3AZM D;  4G92 C;  2W8S A;  3TU4 A;  4R8P C;  3B6G B;  5BO0 A;  5B0Z D;  1T3U A;  3REK D;  5B0Y D;  5FUG A;  3H0R C;  2RVQ C;  3AV2 D;  4G91 B;  3MGR C;  2BYK A;  4KGC B;  4XZQ C;  3LJA A;  1KU5 A;  3WAA A;  3MNN B;  3REJ D;  3AZJ A;  4NE6 A;  3C1B B;  3AN2 B;  1AOI D;  3W97 D;  3AFA D;  4H9P B;  5B40 B;  2ZY4 A;  4J8W D;  4R8P A;  3WA9 D;  2HUE C;  4X23 B;  2HIO D;  3REI D;  4ZUX B;  5AVB D;  3AL0 C;  4NE5 A;  2FJ7 D;  5GT3 C;  4E45 A;  1P3B C;  4YM6 B;  4Z5T B;  3UT9 C;  3MGR A;  4J8V C;  4J8U D;  2Y2O A;  4XZQ A;  3W99 C;  2NQB C;  2J8P A;  4Z66 D;  3WKJ A;  1BH8 B;  1W2E A;  3WTP C;  5G49 B;  3MGP C;  1P3K C;  3REH B;  1TZY C;  5E5A D;  4H9R A;  4UPK A;  5B1L B;  3VH5 A;  5BT1 C;  3EPK A;  3B0D C;  3AV1 D;  2UWX A;  3AYW B;  3LJA B;  3WAA B;  3AZE C;  3VH6 T;  1U35 A;  1M1A C;  3FDD A;  3LZ1 C;  3LZ0 D;  1P3B A;  3A6N C;  2Y2H A;  3UT9 A;  4J8V A;  2Y2M A;  5DNM D;  2CV5 B;  5CP6 C;  4R8P B;  3KUY B;  3W99 A;  3B6F D;  2NQB A;  3O62 C;  3NQJ A;  3WTP A;  1TZY A;  3X1U C;  3UTB C;  3KWQ D;  5B2I A;  3X1T C;  2VQR A;  5B2J B;  2Y2K A;  2NZD C;  3AZE A;  5B24 D;  1P3M D;  1M1A A;  3WKJ B;  3LZ1 A;  2XD5 A;  3MGS B;  1ZLA D;  3A6N A;  5B32 D;  1P3A B;  5DNN B;  5CP6 A;  4J8X B;  3LEL D;  4LD9 B;  1P3P B;  1KX5 D;  3O62 A;  1U35 B;  1TAF B;  3B0B A;  1P3B B;  2F8N D;  3X1U A;  3UTB A;  3X1T A;  2BG1 A;  2NZD A;  3AZF C;  2FFF B;  1F66 C;  4YS3 D;  4CAY A;  3AZK A;  5BS7 C;  1B6W A;  1KX4 D;  3KXB B;  1M19 D;  5B2I B;  2PYO D;  1P34 C;  1P3I D;  4JJN C;  4H9S C;  3VH5 W;  1P3F B;  3AZG B;  2RIQ A;  3W98 C;  1P3G B;  1ID3 C;  4HGA C;  5GT0 D;  5B33 D;  2ZY5 A;  5F99 B;  3X1S D;  3AZF A;  4WU8 D;  1F66 A;  5CPK C;  4XUJ A;  5BS7 A;  3NQU B;  5AV9 C;  3X1U B;  3C1C B;  3MVD D;  2JE5 A;  1P34 A;  4JJN A;  4ZBJ C;  5GXQ C;  2F2A C;  3UTA C;  1JFI B;  4H9S A;  3MGQ D;  3B0C T;  3KFU G;  1EQZ D;  5BNX A;  4CAY B;  3W98 A;  3AZK B;  5AVC D;  5CHL B;  5B31 C;  1HQ3 D;  1ID3 A;  3AZL D;  5BNV B;  2IO5 B;  5B1M C;  3B6G D;  5AY8 C;  5CPK A;  3W96 B;  1Q9C A;  4QLC C;  5AV9 A;  3X1V C;  1P3O C;  3UTA A;  5GXQ A;  4DRB A;  3AZI C;  1KX3 C;  4KGC D;  3REL B;  3AZM C;  5CPJ A;  3MNN D;  3AN2 D;  4H9N A;  4XUJ B;  3C1B D;  5B31 A;  5B0Z C;  3REK C;  4KUD A;  5B0Y C;  5B1M A;  5JRG B;  5B40 D;  5AV5 A;  3AV2 C;  1N1J A;  2YFV B;  5AY8 A;  4AWL B;  4X23 D;  4QLC A;  2JCH A;  4ZUX D;  3AZH A;  3X1V A;  5AV6 B;  2ARO A;  3REJ C;  2Y2I A;  1AOI C;  1M18 B;  4YM6 D;  3W97 C;  3AFA C;  3AZI A;  4EO5 B;  1KX3 A;  3AZM A;  2YFW A;  4J8W C;  1HTA A;  3WA9 C;  5B0Z A;  2HIO C;  3REI C;  5AVB C;  5KDM A;  3REH D;  3REK A;  2FJ7 C;  5AV8 B;  5B1L D;  3B0C W;  3AYW D;  3AV2 A;  3LJA D;  4J8U C;  3WAA D;  5CPJ B;  1S32 C;  3H0L C;  3REJ A;  4Z66 C;  5C3I C;  3AZN B;  4KUD B;  1BFM A;  4WU9 B;  3AFA A;  2CV5 D;  5E5A C;  3TU4 B;  1H3O A;  5AV5 B;  5BO0 B;  3P5J B;  3KUY D;  3AV1 C;  2Y2P A;  4J8W A;  3AZH B;  3WA9 A;  2ARO B;  2HIO A;  5FUG B;  4DRA A;  5AVB A;  3REI A;  2FJ7 A;  3LZ0 C;  4H9Q A;  2BYK B;  3AZI B;  5B2J D;  5DNM C;  3AZJ B;  3WKJ D;  4NE3 A;  1S32 A;  3B6F C;  2XD1 A;  5GT3 A;  3VH5 T;  4Z66 A;  3MGS D;  4WNN A;  1P3A D;  5DNN D;  4G92 B;  5E5A A;  4J8X D;  3AV1 A;  3KWQ C;  4LD9 D;  1P3P D;  2Y2G A;  1U35 D;  3MGP A;  1P3K A;  5B24 C;  1P3M C;  4Z2M G;  3MGR B;  3LZ0 A;  1ULY A;  1ZLA C;  4XZQ B;  2ZY3 A;  5B32 C;  5DNM A;  3LEL C;  3B6F A;  4WZS B;  1KX5 C;  4H9R B;  3R45 A;  3KXB D;  5B2I D;  2HUE B;  4CSR A;  3KWQ A;  5GSU D;  1P3F D;  1S32 B;  5GT3 B;  5B24 A;  3AZG D;  1P3M A;  2CWE A;  1P3G D;  3UT9 B;  4YS3 C;  4WNN B;  4J8V B;  1ZLA A;  3V9R A;  3W99 B;  5B32 A;  1M19 C;  5F99 D;  2NQB B;  2PYO C;  1P3I C;  3NQJ B;  3WTP B;  3LEL A;  3MGP B;  1P3K B;  1TZY B;  3C1C D;  3B0D B;  4E44 A;  2F8N K;  5GT0 C;  3AZE B;  3H0M C;  1M1A B;  2DQN C;  3X1S C;  3LZ1 B;  4WU8 C;  3AZK D;  3A6N B;  3WTP E;  1R4V A;  5CP6 B;  3MVD C; 
#chains in the Genus database with same CATH homology
 2PYO A;  3O62 B;  2ZM5 A;  4KHA A;  1P3I A;  5B24 B;  3W96 D;  3MGQ C;  1EQZ C;  1WWS A;  3UTB B;  5AVC C;  3X1T B;  1P3L C;  1ZLA B;  1HQ3 C;  2G5H C;  2Y2L A;  5GT0 A;  2NZD B;  3AZL C;  3REL D;  3X1S A;  4WU8 A;  4XUJ D;  3B6G C;  5CPI C;  4UUZ A;  3MVD A;  5JRG D;  4G91 C;  4KGC C;  1EQZ A;  3A1K A;  5AV6 D;  3MNN C;  5AVC A;  3AN2 C;  1P3L A;  3C1B C;  1HQ3 A;  4H9O A;  1M18 D;  3AZF B;  3AZL A;  1F66 B;  5B40 C;  3B6G A;  4X23 C;  5CPI A;  4ZUX C;  1P34 B;  4JJN B;  5AV8 D;  4YM6 C;  2JSS A;  5BNX B;  3W98 B;  5CPJ D;  1P3O A;  4KGC A;  1ID3 B;  4HGA B;  3MNN A;  3AN2 A;  3C1B A;  3AZN D;  4KUD D;  4Z5T D;  4WU9 D;  3REH C;  3TU4 D;  5B1L C;  5AV5 D;  5CPK B;  4H9P A;  5B40 A;  5AV9 B;  3AYW C;  3AZH D;  3LJA C;  4X23 A;  3WAA C;  2ARO D;  4ZUX A;  1PZR A;  1P3L B;  3UTA B;  4ZBJ B;  5GXQ B;  5B0Y A;  1BH9 A;  4YM6 A;  2CV5 C;  4H9N B;  3AZJ D;  5B31 B;  3KSY A;  3KUY C;  5CPI B;  1AOI A;  1BH8 A;  3W97 A;  5G49 A;  5B1M B;  3REH A;  5B1L A;  1N1J B;  5AY8 B;  4R8P D;  4QLC B;  3AYW A;  3X1V B;  1P3O B;  5B2J C;  3WKJ C;  2RVQ D;  2Y2J A;  3MGR D;  2L5A A;  3MGS C;  1KX3 B;  4XZQ D;  4J8U A;  2YFW B;  3AZM B;  5DNN C;  2CV5 A;  1P3A C;  3A1I A;  4J8X C;  3KUY A;  5B0Z B;  4LD9 C;  1P3P C;  5KDM B;  1U35 C;  3REK B;  5B0Y B;  4WV4 B;  2BYM A;  1BH9 B;  3AV2 B;  5B2J A;  4NFT A;  2Y2N A;  3REJ B;  1S32 D;  5GT3 D;  1AOI B;  1P3B D;  3VH6 A;  3UT9 D;  3W97 B;  3AFA B;  4J8V D;  3MGS A;  1H3O B;  3W99 D;  3KXB C;  1P3A A;  5DNN A;  4J8W B;  5B2I C;  2NQB D;  3WA9 B;  4J8X A;  3WTP D;  2HIO B;  3MGP D;  3REI B;  1P3K D;  5AVB B;  1P3P A;  4LD9 A;  1TAF A;  1TZY D;  5GSU C;  5BT1 D;  1P3F C;  2FJ7 B;  3AZG C;  4H9Q B;  5B31 G;  1P3G C;  4J8U B;  3AZE D;  1M1A D;  5F99 C;  3LZ1 D;  4Z66 B;  5C3I B;  3A6N D;  2LY8 A;  2BYM B;  5E5A B;  3C1C C;  5CP6 D;  1KX4 C;  3AV1 B;  3KXB A;  3EPH A;  3O62 D;  3EPL A;  1KX5 A;  3IP4 C;  4M6B A;  5GSU A;  3X1U D;  1P3F A;  3UTB D;  3LZ0 B;  3AZG A;  3AZK C;  3X1T D;  2F8N A;  1P3G A;  2NZD D;  5DNM B;  5B33 C;  3EPJ A;  2F8N H;  3B6F B;  5F99 A;  2IO5 C;  4YS3 A;  3R45 B;  4WJ3 C;  2G5I C;  3W96 C;  3NQU A;  3C1C A;  4CSR B;  1KX4 A;  1M19 A;  3KWQ B;  1JFI A;  1P3M B;  3REL C;  5JA4 A;  4DQY B;  3EG5 B;  3V9R B;  4XUJ C;  5B32 B;  3AZF D;  5B33 A;  5BNV A;  3VH6 W;  3LEL B;  1F66 D;  1KX5 B;  5JRG C;  2Y2Q A;  5GSU B;  4AWL C;  3W96 A;  2F8N B;  1P34 D;  4JJN D;  5AV6 C;  1B67 A;  1M18 C;  3F6T A;  3W98 D;  3MGQ A;  4EO5 C;  3REL A;  1WWI A;  4YS3 B;  1ID3 D;  2ZY2 A;  1KX4 B;  1M19 B;  2PYO B;  4KHA B;  1P3I B;  5AV8 C;  5CPK D;  1F1E A;  5JRG A;  5AV9 D;  2YFV A;  5JA4 B;  5CPJ C;  1P3L D;  3UTA D;  5GXQ D;  5AV6 A;  5GT0 B;  5B33 B;  3AZN C;  1M18 A;  4Z5T C;  4KUD C;  3X1S B;  4WU9 C;  4WU8 B;  1Z2C B;  1A7W A;  3TU4 C;  5AV5 C;  5B31 D;  5CPI D;  4UUZ B;  3AZH C;  3MVD B;  2ARO C;  4Z2M H;  5B1M D;  5AV8 A;  5AY8 D;  4QLC D;  3MGQ B;  3X1V D;  1P3O D;  2DF4 C;  5B32 G;  1EQZ B;  5AVC B;  3AZJ C;  1HQ3 B;  4H9O B;  3AZL B;  3AZI D;  3AZN A;  1KX3 D;  4Z5T A;  4WU9 A;  2F8N G;  3AZM D;  4G92 C;  2W8S A;  3TU4 A;  4R8P C;  3B6G B;  5BO0 A;  5B0Z D;  1T3U A;  3REK D;  5B0Y D;  5FUG A;  3H0R C;  2RVQ C;  3AV2 D;  4G91 B;  3MGR C;  2BYK A;  4KGC B;  4XZQ C;  3LJA A;  1KU5 A;  3WAA A;  3MNN B;  3REJ D;  3AZJ A;  4NE6 A;  3C1B B;  3AN2 B;  1AOI D;  3W97 D;  3AFA D;  4H9P B;  5B40 B;  2ZY4 A;  4J8W D;  4R8P A;  3WA9 D;  2HUE C;  4X23 B;  2HIO D;  3REI D;  4ZUX B;  5AVB D;  3AL0 C;  4NE5 A;  2FJ7 D;  5GT3 C;  4E45 A;  1P3B C;  4YM6 B;  4Z5T B;  3UT9 C;  3MGR A;  4J8V C;  4J8U D;  2Y2O A;  4XZQ A;  3W99 C;  2NQB C;  2J8P A;  4Z66 D;  3WKJ A;  1BH8 B;  1W2E A;  3WTP C;  5G49 B;  3MGP C;  1P3K C;  3REH B;  1TZY C;  5E5A D;  4H9R A;  4UPK A;  5B1L B;  3VH5 A;  5BT1 C;  3EPK A;  3B0D C;  3AV1 D;  2UWX A;  3AYW B;  3LJA B;  3WAA B;  3AZE C;  3VH6 T;  1U35 A;  1M1A C;  3FDD A;  3LZ1 C;  3LZ0 D;  1P3B A;  3A6N C;  2Y2H A;  3UT9 A;  4J8V A;  2Y2M A;  5DNM D;  2CV5 B;  5CP6 C;  4R8P B;  3KUY B;  3W99 A;  3B6F D;  2NQB A;  3O62 C;  3NQJ A;  3WTP A;  1TZY A;  3X1U C;  3UTB C;  3KWQ D;  5B2I A;  3X1T C;  2VQR A;  5B2J B;  2Y2K A;  2NZD C;  3AZE A;  5B24 D;  1P3M D;  1M1A A;  3WKJ B;  3LZ1 A;  2XD5 A;  3MGS B;  1ZLA D;  3A6N A;  5B32 D;  1P3A B;  5DNN B;  5CP6 A;  4J8X B;  3LEL D;  4LD9 B;  1P3P B;  1KX5 D;  3O62 A;  1U35 B;  1TAF B;  3B0B A;  1P3B B;  2F8N D;  3X1U A;  3UTB A;  3X1T A;  2BG1 A;  2NZD A;  3AZF C;  2FFF B;  1F66 C;  4YS3 D;  4CAY A;  3AZK A;  5BS7 C;  1B6W A;  1KX4 D;  3KXB B;  1M19 D;  5B2I B;  2PYO D;  1P34 C;  1P3I D;  4JJN C;  4H9S C;  3VH5 W;  1P3F B;  3AZG B;  2RIQ A;  3W98 C;  1P3G B;  1ID3 C;  4HGA C;  5GT0 D;  5B33 D;  2ZY5 A;  5F99 B;  3X1S D;  3AZF A;  4WU8 D;  1F66 A;  5CPK C;  4XUJ A;  5BS7 A;  3NQU B;  5AV9 C;  3X1U B;  3C1C B;  3MVD D;  2JE5 A;  1P34 A;  4JJN A;  4ZBJ C;  5GXQ C;  2F2A C;  3UTA C;  1JFI B;  4H9S A;  3MGQ D;  3B0C T;  3KFU G;  1EQZ D;  5BNX A;  4CAY B;  3W98 A;  3AZK B;  5AVC D;  5CHL B;  5B31 C;  1HQ3 D;  1ID3 A;  3AZL D;  5BNV B;  2IO5 B;  5B1M C;  3B6G D;  5AY8 C;  5CPK A;  3W96 B;  1Q9C A;  4QLC C;  5AV9 A;  3X1V C;  1P3O C;  3UTA A;  5GXQ A;  4DRB A;  3AZI C;  1KX3 C;  4KGC D;  3REL B;  3AZM C;  5CPJ A;  3MNN D;  3AN2 D;  4H9N A;  4XUJ B;  3C1B D;  5B31 A;  5B0Z C;  3REK C;  4KUD A;  5B0Y C;  5B1M A;  5JRG B;  5B40 D;  5AV5 A;  3AV2 C;  1N1J A;  2YFV B;  5AY8 A;  4AWL B;  4X23 D;  4QLC A;  2JCH A;  4ZUX D;  3AZH A;  3X1V A;  5AV6 B;  2ARO A;  3REJ C;  2Y2I A;  1AOI C;  1M18 B;  4YM6 D;  3W97 C;  3AFA C;  3AZI A;  4EO5 B;  1KX3 A;  3AZM A;  2YFW A;  4J8W C;  1HTA A;  3WA9 C;  5B0Z A;  2HIO C;  3REI C;  5AVB C;  5KDM A;  3REH D;  3REK A;  2FJ7 C;  5AV8 B;  5B1L D;  3B0C W;  3AYW D;  3AV2 A;  3LJA D;  4J8U C;  3WAA D;  5CPJ B;  1S32 C;  3H0L C;  3REJ A;  4Z66 C;  5C3I C;  3AZN B;  4KUD B;  1BFM A;  4WU9 B;  3AFA A;  2CV5 D;  5E5A C;  3TU4 B;  1H3O A;  5AV5 B;  5BO0 B;  3P5J B;  3KUY D;  3AV1 C;  2Y2P A;  4J8W A;  3AZH B;  3WA9 A;  2ARO B;  2HIO A;  5FUG B;  4DRA A;  5AVB A;  3REI A;  2FJ7 A;  3LZ0 C;  4H9Q A;  2BYK B;  3AZI B;  5B2J D;  5DNM C;  3AZJ B;  3WKJ D;  4NE3 A;  1S32 A;  3B6F C;  2XD1 A;  5GT3 A;  3VH5 T;  4Z66 A;  3MGS D;  4WNN A;  1P3A D;  5DNN D;  4G92 B;  5E5A A;  4J8X D;  3AV1 A;  3KWQ C;  4LD9 D;  1P3P D;  2Y2G A;  1U35 D;  3MGP A;  1P3K A;  5B24 C;  1P3M C;  4Z2M G;  3MGR B;  3LZ0 A;  1ULY A;  1ZLA C;  4XZQ B;  2ZY3 A;  5B32 C;  5DNM A;  3LEL C;  3B6F A;  4WZS B;  1KX5 C;  4H9R B;  3R45 A;  3KXB D;  5B2I D;  2HUE B;  4CSR A;  3KWQ A;  5GSU D;  1P3F D;  1S32 B;  5GT3 B;  5B24 A;  3AZG D;  1P3M A;  2CWE A;  1P3G D;  3UT9 B;  4YS3 C;  4WNN B;  4J8V B;  1ZLA A;  3V9R A;  3W99 B;  5B32 A;  1M19 C;  5F99 D;  2NQB B;  2PYO C;  1P3I C;  3NQJ B;  3WTP B;  3LEL A;  3MGP B;  1P3K B;  1TZY B;  3C1C D;  3B0D B;  4E44 A;  2F8N K;  5GT0 C;  3AZE B;  3H0M C;  1M1A B;  2DQN C;  3X1S C;  3LZ1 B;  4WU8 C;  3AZK D;  3A6N B;  3WTP E;  1R4V A;  5CP6 B;  3MVD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...