3AZHA

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPQDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhA00
4R8PB 3MGSD 4WU8C 1EQZB 5B32G 1P3IA 2NQBD 3V9RB 1P3PB 5JA4A 1H3OB 3REIC 2HUEC 5BNXA 4H9QB 5B2JB 3AZGB 3C1BA 4QLCA 4JJNB 3W98D 1F66A 3X1SD 3RELC 3REJA 3AZFA 5GT0D 3AZJD 5JRGD 3AFAD 5AVBA 5BS7C 4ZUXA 5AVBB 3UTAA 3VH5A 3KXBD 3W97C 3LZ1B 3WA9C 4Z2MG 3R45A 5AV8D 4YM6C 5DNMB 1M1AA 3UT9B 4EO5B 1KX5D 5B0ZD 1JFIB 3NQUB 4J8WC 3C1CB 1KX4B 2F8ND 4YS3A 3AZLD 1U35A 3VH5T 4J8XA 3AZMD 3MNNA 1U35B 3AV1C 5DNND 3REKB 5F99C 4J8VC 3MNNB 1ID3C 4WU8B 5CPIC 2F8NH 1P34C 3A6ND 3VH6A 4ZBJC 4XZQA 3REIB 2HUEB 3AZKC 4XUJC 1TZYC 5CPKD 2FJ7C 3X1VD 3VH6T 3AZID 5AVCC 3W99C 2NQBC 4G92C 2BYMB 4WU9D 4KUDA 5B31G 5AY8A 4WNNB 3WKJD 1P3AA 5AY8B 2YFWB 3WA9B 5GT3A 4YM6B 5B1LA 5B0YD 4J8WB 5B32D 1P3KA 5JRGC 3MVDA 5B24C 3AFAC 5GSUC 3LZ0A 3AV1B 1KU5A 5F99B 1F66D 1ID3B 3KXBC 3AZFD 5CPIB 2PYOD 4Z5TC 4ZBJB 2BYKA 3MGQA 1M18A 5CP6C 5B0ZC 5AV9C 3AZKB 4XUJB 3AZLC 4ZUXD 1TZYB 5B33D 3UTAD 3AZMC 3AV2C 5B2IA 1S32C 1WWSA 3AN2A 2NZDC 2FJ7B 5B40A 5AVCB 1M1AD 3AZED 3B6GA 4G92B 3REHA 3W99B 2F8NG 4G91B 4YS3D 4X23D 4J8XD 5E5AA 3W96A 3KUYC 1P3MC 4Z2MH 3KWQC 3B6FA 3X1VC 3AZHA 4H9SA 5AV6A 3AZIC 4XZQD 3WTPD 4LD9C 2AROA 5B24B 3X1TC 1N1JA 3LJAA 1R4VA 5GSUB 1ZLAD 1F1EA 3KSYA 5GXQA 3AZNA 4NE5A 5AV5A 2YFVB 4Z5TB 2CV5C 4DRBA 5CP6B 5B0YC 1BH9B 5AV9B 5B32C 1P3GC 3AZLB 3MGRA 2HIOA 3AV2B 3AZMB 4J8UD 1S32B 2NZDB 5GT3D 4R8PA 1P3FD 1P3LC 4HGAC 1EQZA 3V9RA 1P3PA 5B1LD 1H3OA 2PYOC 3MGPC 1P3KD 4H9QA 5B2JA 3KUYB 3AZGA 4JJNA 1P3MB 3KWQB 5B33C 1P3BC 3AZEC 3MGQD 4LD9B 3B0CW 3X1TB 1AOIC 1P3OC 4X23C 5B2ID 3LZ1A 3AN2D 5B40D 5DNMA 3UT9A 1M19C 3REHD 1BH8B 1JFIA 2CV5B 5CPJD 3NQUA 5B0YB 3AYWC 3C1CA 1P3GB 1KX4A 3WTPC 3O62C 3LELD 4E44A 3W96D 3REKA 1ZLAC 4WU8A 1P3LB 4HGAB 3B6FD 5KDMB 2IO5C 2RVQD 5AV6D 5B1MC 3MGPB 3REIA 4KGCC 2AROD 3X1UD 4Z66C 3LJAD 3WAAC 1HQ3C 5B31C 3RELA 4J8UC 3UTBC 3AZND 5AV5D 1KX3D 3RELB 3TU4C 1P3BB 1P3FC 2BYMA 3AZEB 3MGSC 4WNNA 1AOIB 1P3OB 5BS7A 4X23B 3MGRD 2HIOD 2YFWA 3W97A 3WA9A 4R8PD 3W97B 4YM6A 3W98C 1P3PD 1M19B 3X1SC 1P3ID 4J8WA 3AYWB 1TAFB 3WTPB 5GT0C 5B2JD 3AZJC 3O62B 3AZGD 4JJND 3AV1A 5F99A 4J8VA 3C1BD 4QLCD 1ID3A 1Q9CA 4CSRB 5CPIA 2IO5B 4J8VB 1P34A 3REJD 5B1MB 1P34B 2LY8A 5AV8C 4KGCB 5CPJC 3AZKA 4XUJA 5BO0B 4Z66B 1KX5C 3WAAB 1TZYA 5FUGB 5AVBD 3LELC 1HQ3B 5B31B 3LZ1D 3UTBB 2FJ7A 3TU4B 5DNMD 5AVCA 5DNNC 2NQBA 3UT9D 3VH5W 3W99A 3MGSB 2NQBB 3C1CD 3A6NC 1KX4D 2CWEA 3X1UC 4H9NB 1U35D 5BT1D 3MNND 4WU8D 3W98B 1KX3C 3X1SB 5CPKC 4NFTA 2JSSA 5JRGA 3REID 5GT0B 5B24A 3AFAA 3AZJB 3VH6W 5JRGB 4WU9C 5GSUA 3AFAB 3WKJC 3KXBA 2YFVA 4UUZB 3KXBB 4Z5TA 1P3IC 5CP6A 5B0ZA 5AV8B 4H9RA 1BH9A 5AV9A 5CPJB 1KX5B 2L5AA 5B0ZB 4KUDD 4H9RB 5AY8D 3AZLA 3AV2A 3AZMA 1P3AD 1S32A 2F8NB 2NZDA 3C1BC 4QLCC 4YM6D 5DNNB 5G49B 4WZSB 1F66C 4NE3A 3REJC 3AZFC 4J8WD 4CAYB 3A6NB 3KUYA 3MVDD 1P3MA 3AV1D 5C3IC 3KWQA 5F99D 5AVBC 1ID3D 3LZ0D 4ZUXC 3UTAC 3X1VA 3AZIA 5CPKB 3UT9C 3X1VB 4EO5C 3AZIB 1M1AC 4LD9A 3AZKD 1M18D 3X1TA 4WU9B 1KX4C 1TZYD 3WKJB 4YS3C 1U35C 4J8XC 3MNNC 4AWLC 5BNVB 5AVCD 3W99D 1BH8A 2CV5A 1P3IB 3B6GD 5B0YA 5JA4B 5B32A 4E45A 1P3GA 4XZQC 5B32B 4WV4B 4NE6A 5BNXB 5E5AD 1P3LA 3C1BB 4QLCB 5KDMA 1F66B 2PYOA 4H9PA 3REJB 3MGPA 3AZFB 3AZHD 2PYOB 4H9PB 5B24D 4KUDC 5GSUD 5AY8C 5C3IB 5B33A 1P3AC 4M6BA 3B0BA 4ZUXB 5B33B 3UTAB 1P3BA 5GXQD 4H9OA 4Z5TD 3AZEA 5GT3C 3R45B 5CP6D 4H9OB 5AV9D 1M1AB 5B1LC 1AOIA 1P3OA 4X23A 1P3KC 3AV2D 3MVDC 1S32D 4YS3B 2NZDD 4J8XB 4AWLB 3LZ0C 1M19A 1EQZD 3AYWA 1TAFA 3WTPA 1B6WA 4XZQB 3MGQC 1M18C 3O62A 3KUYD 1P3MD 1HTAA 3KWQD 1ZLAA 4CSRA 1ZLAB 5B2IC 3AN2C 5B1MA 3WTPE 5B40C 5CHLB 4KGCA 4LD9D 3B6GC 3REHC 5BO0A 3X1TD 4Z66A 4G91C 3WAAA 4KUDB 5FUGA 1HQ3A 5B31A 1P3AB 4J8UA 3UTBA 5E5AC 1BFMA 3W96C 3TU4A 4J8UB 1P3FA 5GT3B 3MGSA 1P3FB 2CV5D 3B6FC 2F8NK 2RVQC 5B1LB 1P3GD 3AZHC 4H9SC 5AV6C 4H9NA 1P3KB 3MVDB 2AROC 1P3LD 3LJAC 3REKD 3LZ0B 3W98A 3B0DC 3X1SA 5GXQC 3AZNC 3MGPD 5AV5C 1ULYA 5GT0A 3AZJA 2BYKB 3MGQB 1M18B 3MGRC 2HIOC 4UUZA 3RELD 1P3BD 5B2IB 3AN2B 3B0CT 4R8PC 1EQZC 1B67A 5B40B 5AV8A 5CPJA 1P3PC 3B6GB 3REHB 1KX5A 1AOID 1P3OD 3LELA 2F8NA 5B2JC 5E5AB 3W96B 3LELB 3AZGC 4JJNC 3W97D 3WA9D 5DNNA 5G49A 1M19D 3B6FB 1WWIA 3AYWD 4CAYA 3A6NA 3AZHB 5AV6B 4KHAA 3X1UA 3O62D 4DRAA 2AROB 3NQJA 4KHAB 3X1UB 1N1JB 3LJAB 3NQJB 1KX3A 4J8VD 3B0DB 3LZ1C 5CPKA 5GXQB 5B1MD 3AZNB 5CPID 5AV5B 1KX3B 1P34D 4KGCD 5DNMC 4Z66D 4WU9A 3WAAD 4XUJD 3C1CC 1HQ3D 5B31D 3WKJA 3UTBD 3MGRB 2HIOB 1A7WA 3TU4D 5BNVA 3REKC 2FJ7D 5BT1C
chains in the Genus database with same CATH superfamily
4R8PB 3MGSD 4WU8C 1EQZB 5B32G 1P3IA 2NQBD 3V9RB 1P3PB 5JA4A 1H3OB 2JE5A 3REIC 2HUEC 5BNXA 4H9QB 5B2JB 3AZGB 3C1BA 4QLCA 4JJNB 3W98D 1F66A 3X1SD 3RELC 3REJA 3AZFA 5GT0D 3AZJD 5JRGD 2BG1A 3AFAD 5AVBA 5BS7C 4ZUXA 5AVBB 3UTAA 3VH5A 3KXBD 3W97C 3LZ1B 3WA9C 4Z2MG 3R45A 5AV8D 4YM6C 5DNMB 1M1AA 3UT9B 4EO5B 2XD5A 1KX5D 5B0ZD 1JFIB 3NQUB 4J8WC 3C1CB 1Z2CB 1KX4B 2F8ND 4YS3A 3AZLD 1U35A 3VH5T 4J8XA 3AZMD 3MNNA 1U35B 3AV1C 5DNND 3REKB 5F99C 4UPKA 3MNNB 4J8VC 4WU8B 1ID3C 5CPIC 2F8NH 2ZY3A 1P34C 3A6ND 3VH6A 4ZBJC 4XZQA 3REIB 2HUEB 3AZKC 4XUJC 1TZYC 5CPKD 2FJ7C 3X1VD 3VH6T 3AZID 5AVCC 3W99C 2NQBC 4G92C 2BYMB 4WU9D 1T3UA 4KUDA 2FFFB 5B31G 5AY8A 4WNNB 3WKJD 1P3AA 2Y2NA 5AY8B 2YFWB 3WA9B 5GT3A 4YM6B 2F2AC 5B1LA 5B0YD 4J8WB 5B32D 1P3KA 5JRGC 3MVDA 5B24C 2ZY5A 3AFAC 5GSUC 3LZ0A 2RIQA 3AV1B 1KU5A 5F99B 1F66D 1ID3B 3KXBC 3AZFD 5CPIB 2PYOD 2ZM5A 4Z5TC 4ZBJB 2BYKA 3MGQA 1M18A 5CP6C 5B0ZC 5AV9C 3AZKB 4XUJB 3AZLC 4ZUXD 1TZYB 5B33D 3UTAD 3AZMC 3AV2C 5B2IA 1S32C 2Y2KA 1WWSA 3AN2A 2NZDC 2FJ7B 5B40A 5AVCB 1M1AD 3AZED 3B6GA 4G92B 3REHA 3W99B 2F8NG 3FDDA 1W2EA 1PZRA 3H0MC 4G91B 4YS3D 4X23D 5E5AA 4J8XD 3W96A 3KUYC 1P3MC 4Z2MH 3KWQC 3B6FA 4DQYB 3X1VC 3AZHA 4H9SA 5AV6A 3AZIC 4XZQD 3WTPD 4LD9C 2AROA 5B24B 3X1TC 1N1JA 3LJAA 1R4VA 5GSUB 1ZLAD 1F1EA 3KSYA 5GXQA 3AZNA 4NE5A 5AV5A 2YFVB 2J8PA 2ZY4A 4Z5TB 2CV5C 4DRBA 5CP6B 3KFUG 5B0YC 1BH9B 5AV9B 5B32C 1P3GC 3AZLB 3MGRA 2HIOA 3AV2B 3AZMB 4J8UD 1S32B 2NZDB 5GT3D 4R8PA 1P3FD 1P3LC 4HGAC 1EQZA 3V9RA 1P3PA 5B1LD 1H3OA 2PYOC 3MGPC 1P3KD 4H9QA 5B2JA 3EPLA 3KUYB 3EPJA 3AZGA 4JJNA 1P3MB 3KWQB 3H0RC 5B33C 1P3BC 3AZEC 3MGQD 4LD9B 3B0CW 3X1TB 1AOIC 1P3OC 4X23C 5B2ID 3LZ1A 3AN2D 5B40D 5DNMA 3UT9A 1M19C 3REHD 1BH8B 1JFIA 2CV5B 5CPJD 3NQUA 2Y2HA 5B0YB 3AYWC 3C1CA 1P3GB 1KX4A 3WTPC 3O62C 3LELD 4E44A 3W96D 3REKA 1ZLAC 4WU8A 1P3LB 4HGAB 3B6FD 5KDMB 2IO5C 2RVQD 5AV6D 2G5IC 2Y2QA 3F6TA 5B1MC 3MGPB 3REIA 4KGCC 2AROD 3X1UD 4Z66C 3LJAD 3WAAC 3AL0C 1HQ3C 5B31C 3RELA 4J8UC 3UTBC 3AZND 5AV5D 1KX3D 3RELB 3TU4C 1P3BB 1P3FC 2BYMA 3AZEB 3MGSC 3IP4C 2Y2JA 4WNNA 1AOIB 1P3OB 5BS7A 4X23B 3MGRD 2HIOD 2YFWA 4WJ3C 3W97A 3WA9A 4R8PD 3W97B 4YM6A 3W98C 1P3PD 1M19B 3X1SC 1P3ID 4J8WA 3AYWB 1TAFB 3WTPB 5GT0C 5B2JD 3AZJC 3O62B 3AZGD 4JJND 3AV1A 5F99A 2Y2OA 3C1BD 4QLCD 4J8VA 1ID3A 1Q9CA 4CSRB 5CPIA 2IO5B 4J8VB 1P34A 3REJD 5B1MB 1P34B 2LY8A 5AV8C 4KGCB 5CPJC 3AZKA 4XUJA 5BO0B 4Z66B 1KX5C 3WAAB 1TZYA 5FUGB 5AVBD 3LELC 1HQ3B 5B31B 3LZ1D 3UTBB 2FJ7A 3TU4B 5DNMD 5AVCA 5DNNC 2NQBA 3UT9D 3VH5W 3W99A 3MGSB 2NQBB 3C1CD 2Y2MA 3A6NC 1KX4D 3EPKA 2CWEA 3X1UC 4H9NB 1U35D 5BT1D 3MNND 4WU8D 3W98B 1KX3C 3X1SB 5CPKC 4NFTA 2JSSA 5JRGA 3REID 5GT0B 5B24A 3AFAA 3AZJB 3VH6W 5JRGB 4WU9C 5GSUA 3AFAB 3WKJC 3KXBA 2YFVA 4UUZB 3KXBB 3A1KA 4Z5TA 1P3IC 5CP6A 5B0ZA 5AV8B 4H9RA 1BH9A 5AV9A 5CPJB 1KX5B 2L5AA 5B0ZB 4KUDD 4H9RB 5AY8D 3AZLA 3AV2A 3AZMA 1P3AD 1S32A 2F8NB 2NZDA 3C1BC 4QLCC 4YM6D 5DNNB 5G49B 4WZSB 1F66C 4NE3A 3REJC 3AZFC 4J8WD 4CAYB 3A6NB 3KUYA 3MVDD 1P3MA 3AV1D 5C3IC 3KWQA 5F99D 5AVBC 1ID3D 2VQRA 3LZ0D 4ZUXC 3UTAC 3X1VA 3AZIA 5CPKB 3UT9C 3X1VB 4EO5C 3AZIB 2Y2GA 1M1AC 4LD9A 3AZKD 1M18D 3X1TA 4WU9B 1KX4C 1TZYD 3WKJB 4YS3C 1U35C 4J8XC 3MNNC 4AWLC 5BNVB 5AVCD 3W99D 1BH8A 2CV5A 3EG5B 1P3IB 3B6GD 5B0YA 5JA4B 5B32A 4E45A 1P3GA 4XZQC 5B32B 4WV4B 4NE6A 5BNXB 5E5AD 1P3LA 3C1BB 4QLCB 5KDMA 1F66B 2PYOA 4H9PA 3REJB 3MGPA 3AZFB 3AZHD 2PYOB 4H9PB 5B24D 2JCHA 4KUDC 5GSUD 5AY8C 5C3IB 3EPHA 5B33A 1P3AC 4M6BA 3B0BA 3A1IA 4ZUXB 2DF4C 5B33B 3UTAB 1P3BA 5GXQD 4H9OA 4Z5TD 3AZEA 5GT3C 3R45B 5CP6D 4H9OB 5AV9D 1M1AB 3P5JB 5B1LC 1AOIA 1P3OA 4X23A 1P3KC 3AV2D 3MVDC 1S32D 4YS3B 2NZDD 4J8XB 4AWLB 3LZ0C 1M19A 1EQZD 3AYWA 1TAFA 3WTPA 1B6WA 4XZQB 3MGQC 1M18C 3O62A 3KUYD 1P3MD 1HTAA 3KWQD 1ZLAA 4CSRA 3H0LC 1ZLAB 5B2IC 3AN2C 5B1MA 3WTPE 5B40C 5CHLB 4KGCA 4LD9D 3B6GC 3REHC 5BO0A 3X1TD 4Z66A 4G91C 3WAAA 4KUDB 5FUGA 1HQ3A 5B31A 1P3AB 4J8UA 3UTBA 5E5AC 2G5HC 1BFMA 3W96C 3TU4A 4J8UB 1P3FA 5GT3B 3MGSA 1P3FB 2CV5D 3B6FC 2F8NK 2RVQC 5B1LB 1P3GD 3AZHC 4H9SC 5AV6C 4H9NA 1P3KB 3MVDB 2AROC 1P3LD 3LJAC 3REKD 3LZ0B 3W98A 3B0DC 3X1SA 5GXQC 3AZNC 3MGPD 2W8SA 5AV5C 1ULYA 5GT0A 3AZJA 2BYKB 3MGQB 1M18B 3MGRC 2HIOC 4UUZA 3RELD 1P3BD 5B2IB 3AN2B 3B0CT 4R8PC 1EQZC 1B67A 5B40B 5AV8A 5CPJA 2Y2IA 1P3PC 3B6GB 3REHB 2ZY2A 1KX5A 2XD1A 1AOID 1P3OD 3LELA 2F8NA 5B2JC 5E5AB 3W96B 3LELB 3AZGC 4JJNC 3W97D 3WA9D 5DNNA 5G49A 1M19D 3B6FB 1WWIA 3AYWD 4CAYA 2UWXA 3A6NA 3AZHB 5AV6B 2Y2PA 4KHAA 3X1UA 3O62D 4DRAA 2AROB 3NQJA 4KHAB 3X1UB 1N1JB 3LJAB 3NQJB 1KX3A 4J8VD 3B0DB 3LZ1C 5CPKA 5GXQB 5B1MD 3AZNB 5CPID 5AV5B 1KX3B 1P34D 4KGCD 5DNMC 2Y2LA 4Z66D 4WU9A 3WAAD 4XUJD 3C1CC 1HQ3D 5B31D 3WKJA 3UTBD 2DQNC 3MGRB 2HIOB 1A7WA 3TU4D 5BNVA 3REKC 2FJ7D 5BT1C
chains in the Genus database with same CATH topology
4R8PB 3MGSD 4WU8C 1EQZB 5B32G 1P3IA 2NQBD 3V9RB 1P3PB 5JA4A 1H3OB 2JE5A 3REIC 2HUEC 5BNXA 4H9QB 5B2JB 3AZGB 3C1BA 4QLCA 4JJNB 3W98D 1F66A 3X1SD 3RELC 3REJA 3AZFA 5GT0D 3AZJD 5JRGD 2BG1A 3AFAD 5AVBA 5BS7C 4ZUXA 5AVBB 3UTAA 3VH5A 3KXBD 3W97C 3LZ1B 3WA9C 4Z2MG 3R45A 5AV8D 4YM6C 5DNMB 1M1AA 3UT9B 4EO5B 2XD5A 1KX5D 5B0ZD 1JFIB 3NQUB 4J8WC 3C1CB 1Z2CB 1KX4B 2F8ND 4YS3A 3AZLD 1U35A 3VH5T 4J8XA 3AZMD 3MNNA 1U35B 3AV1C 5DNND 3REKB 5F99C 4UPKA 3MNNB 4J8VC 4WU8B 1ID3C 5CPIC 2F8NH 2ZY3A 1P34C 3A6ND 3VH6A 4ZBJC 4XZQA 3REIB 2HUEB 3AZKC 4XUJC 1TZYC 5CPKD 2FJ7C 3X1VD 3VH6T 3AZID 5AVCC 3W99C 2NQBC 4G92C 2BYMB 4WU9D 1T3UA 4KUDA 2FFFB 5B31G 5AY8A 4WNNB 3WKJD 1P3AA 2Y2NA 5AY8B 2YFWB 3WA9B 5GT3A 4YM6B 2F2AC 5B1LA 5B0YD 4J8WB 5B32D 1P3KA 5JRGC 3MVDA 5B24C 2ZY5A 3AFAC 5GSUC 3LZ0A 2RIQA 3AV1B 1KU5A 5F99B 1F66D 1ID3B 3KXBC 3AZFD 5CPIB 2PYOD 2ZM5A 4Z5TC 4ZBJB 2BYKA 3MGQA 1M18A 5CP6C 5B0ZC 5AV9C 3AZKB 4XUJB 3AZLC 4ZUXD 1TZYB 5B33D 3UTAD 3AZMC 3AV2C 5B2IA 1S32C 2Y2KA 1WWSA 3AN2A 2NZDC 2FJ7B 5B40A 5AVCB 1M1AD 3AZED 3B6GA 4G92B 3REHA 3W99B 2F8NG 3FDDA 1W2EA 1PZRA 3H0MC 4G91B 4YS3D 4X23D 5E5AA 4J8XD 3W96A 3KUYC 1P3MC 4Z2MH 3KWQC 3B6FA 4DQYB 3X1VC 3AZHA 4H9SA 5AV6A 3AZIC 4XZQD 3WTPD 4LD9C 2AROA 5B24B 3X1TC 1N1JA 3LJAA 1R4VA 5GSUB 1ZLAD 1F1EA 3KSYA 5GXQA 3AZNA 4NE5A 5AV5A 2YFVB 2J8PA 2ZY4A 4Z5TB 2CV5C 4DRBA 5CP6B 3KFUG 5B0YC 1BH9B 5AV9B 5B32C 1P3GC 3AZLB 3MGRA 2HIOA 3AV2B 3AZMB 4J8UD 1S32B 2NZDB 5GT3D 4R8PA 1P3FD 1P3LC 4HGAC 1EQZA 3V9RA 1P3PA 5B1LD 1H3OA 2PYOC 3MGPC 1P3KD 4H9QA 5B2JA 3EPLA 3KUYB 3EPJA 3AZGA 4JJNA 1P3MB 3KWQB 3H0RC 5B33C 1P3BC 3AZEC 3MGQD 4LD9B 3B0CW 3X1TB 1AOIC 1P3OC 4X23C 5B2ID 3LZ1A 3AN2D 5B40D 5DNMA 3UT9A 1M19C 3REHD 1BH8B 1JFIA 2CV5B 5CPJD 3NQUA 2Y2HA 5B0YB 3AYWC 3C1CA 1P3GB 1KX4A 3WTPC 3O62C 3LELD 4E44A 3W96D 3REKA 1ZLAC 4WU8A 1P3LB 4HGAB 3B6FD 5KDMB 2IO5C 2RVQD 5AV6D 2G5IC 2Y2QA 3F6TA 5B1MC 3MGPB 3REIA 4KGCC 2AROD 3X1UD 4Z66C 3LJAD 3WAAC 3AL0C 1HQ3C 5B31C 3RELA 4J8UC 3UTBC 3AZND 5AV5D 1KX3D 3RELB 3TU4C 1P3BB 1P3FC 2BYMA 3AZEB 3MGSC 3IP4C 2Y2JA 4WNNA 1AOIB 1P3OB 5BS7A 4X23B 3MGRD 2HIOD 2YFWA 4WJ3C 3W97A 3WA9A 4R8PD 3W97B 4YM6A 3W98C 1P3PD 1M19B 3X1SC 1P3ID 4J8WA 3AYWB 1TAFB 3WTPB 5GT0C 5B2JD 3AZJC 3O62B 3AZGD 4JJND 3AV1A 5F99A 2Y2OA 3C1BD 4QLCD 4J8VA 1ID3A 1Q9CA 4CSRB 5CPIA 2IO5B 4J8VB 1P34A 3REJD 5B1MB 1P34B 2LY8A 5AV8C 4KGCB 5CPJC 3AZKA 4XUJA 5BO0B 4Z66B 1KX5C 3WAAB 1TZYA 5FUGB 5AVBD 3LELC 1HQ3B 5B31B 3LZ1D 3UTBB 2FJ7A 3TU4B 5DNMD 5AVCA 5DNNC 2NQBA 3UT9D 3VH5W 3W99A 3MGSB 2NQBB 3C1CD 2Y2MA 3A6NC 1KX4D 3EPKA 2CWEA 3X1UC 4H9NB 1U35D 5BT1D 3MNND 4WU8D 3W98B 1KX3C 3X1SB 5CPKC 4NFTA 2JSSA 5JRGA 3REID 5GT0B 5B24A 3AFAA 3AZJB 3VH6W 5JRGB 4WU9C 5GSUA 3AFAB 3WKJC 3KXBA 2YFVA 4UUZB 3KXBB 3A1KA 4Z5TA 1P3IC 5CP6A 5B0ZA 5AV8B 4H9RA 1BH9A 5AV9A 5CPJB 1KX5B 2L5AA 5B0ZB 4KUDD 4H9RB 5AY8D 3AZLA 3AV2A 3AZMA 1P3AD 1S32A 2F8NB 2NZDA 3C1BC 4QLCC 4YM6D 5DNNB 5G49B 4WZSB 1F66C 4NE3A 3REJC 3AZFC 4J8WD 4CAYB 3A6NB 3KUYA 3MVDD 1P3MA 3AV1D 5C3IC 3KWQA 5F99D 5AVBC 1ID3D 2VQRA 3LZ0D 4ZUXC 3UTAC 3X1VA 3AZIA 5CPKB 3UT9C 3X1VB 4EO5C 3AZIB 2Y2GA 1M1AC 4LD9A 3AZKD 1M18D 3X1TA 4WU9B 1KX4C 1TZYD 3WKJB 4YS3C 1U35C 4J8XC 3MNNC 4AWLC 5BNVB 5AVCD 3W99D 1BH8A 2CV5A 3EG5B 1P3IB 3B6GD 5B0YA 5JA4B 5B32A 4E45A 1P3GA 4XZQC 5B32B 4WV4B 4NE6A 5BNXB 5E5AD 1P3LA 3C1BB 4QLCB 5KDMA 1F66B 2PYOA 4H9PA 3REJB 3MGPA 3AZFB 3AZHD 2PYOB 4H9PB 5B24D 2JCHA 4KUDC 5GSUD 5AY8C 5C3IB 3EPHA 5B33A 1P3AC 4M6BA 3B0BA 3A1IA 4ZUXB 2DF4C 5B33B 3UTAB 1P3BA 5GXQD 4H9OA 4Z5TD 3AZEA 5GT3C 3R45B 5CP6D 4H9OB 5AV9D 1M1AB 3P5JB 5B1LC 1AOIA 1P3OA 4X23A 1P3KC 3AV2D 3MVDC 1S32D 4YS3B 2NZDD 4J8XB 4AWLB 3LZ0C 1M19A 1EQZD 3AYWA 1TAFA 3WTPA 1B6WA 4XZQB 3MGQC 1M18C 3O62A 3KUYD 1P3MD 1HTAA 3KWQD 1ZLAA 4CSRA 3H0LC 1ZLAB 5B2IC 3AN2C 5B1MA 3WTPE 5B40C 5CHLB 4KGCA 4LD9D 3B6GC 3REHC 5BO0A 3X1TD 4Z66A 4G91C 3WAAA 4KUDB 5FUGA 1HQ3A 5B31A 1P3AB 4J8UA 3UTBA 5E5AC 2G5HC 1BFMA 3W96C 3TU4A 4J8UB 1P3FA 5GT3B 3MGSA 1P3FB 2CV5D 3B6FC 2F8NK 2RVQC 5B1LB 1P3GD 3AZHC 4H9SC 5AV6C 4H9NA 1P3KB 3MVDB 2AROC 1P3LD 3LJAC 3REKD 3LZ0B 3W98A 3B0DC 3X1SA 5GXQC 3AZNC 3MGPD 2W8SA 5AV5C 1ULYA 5GT0A 3AZJA 2BYKB 3MGQB 1M18B 3MGRC 2HIOC 4UUZA 3RELD 1P3BD 5B2IB 3AN2B 3B0CT 4R8PC 1EQZC 1B67A 5B40B 5AV8A 5CPJA 2Y2IA 1P3PC 3B6GB 3REHB 2ZY2A 1KX5A 2XD1A 1AOID 1P3OD 3LELA 2F8NA 5B2JC 5E5AB 3W96B 3LELB 3AZGC 4JJNC 3W97D 3WA9D 5DNNA 5G49A 1M19D 3B6FB 1WWIA 3AYWD 4CAYA 2UWXA 3A6NA 3AZHB 5AV6B 2Y2PA 4KHAA 3X1UA 3O62D 4DRAA 2AROB 3NQJA 4KHAB 3X1UB 1N1JB 3LJAB 3NQJB 1KX3A 4J8VD 3B0DB 3LZ1C 5CPKA 5GXQB 5B1MD 3AZNB 5CPID 5AV5B 1KX3B 1P34D 4KGCD 5DNMC 2Y2LA 4Z66D 4WU9A 3WAAD 4XUJD 3C1CC 1HQ3D 5B31D 3WKJA 3UTBD 2DQNC 3MGRB 2HIOB 1A7WA 3TU4D 5BNVA 3REKC 2FJ7D 5BT1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P B;  3MGS D;  4WU8 C;  1EQZ B;  5B32 G;  1P3I A;  2NQB D;  3V9R B;  1P3P B;  5JA4 A;  1H3O B;  3REI C;  2HUE C;  5BNX A;  4H9Q B;  5B2J B;  3AZG B;  3C1B A;  4QLC A;  4JJN B;  3W98 D;  1F66 A;  3X1S D;  3REL C;  3REJ A;  3AZF A;  5GT0 D;  3AZJ D;  5JRG D;  3AFA D;  5AVB A;  5BS7 C;  4ZUX A;  5AVB B;  3UTA A;  3VH5 A;  3KXB D;  3W97 C;  3LZ1 B;  3WA9 C;  4Z2M G;  3R45 A;  5AV8 D;  4YM6 C;  5DNM B;  1M1A A;  3UT9 B;  4EO5 B;  1KX5 D;  5B0Z D;  1JFI B;  3NQU B;  4J8W C;  3C1C B;  1KX4 B;  2F8N D;  4YS3 A;  3AZL D;  1U35 A;  3VH5 T;  4J8X A;  3AZM D;  3MNN A;  1U35 B;  3AV1 C;  5DNN D;  3REK B;  5F99 C;  4J8V C;  3MNN B;  1ID3 C;  4WU8 B;  5CPI C;  2F8N H;  1P34 C;  3A6N D;  3VH6 A;  4ZBJ C;  4XZQ A;  3REI B;  2HUE B;  3AZK C;  4XUJ C;  1TZY C;  5CPK D;  2FJ7 C;  3X1V D;  3VH6 T;  3AZI D;  5AVC C;  3W99 C;  2NQB C;  4G92 C;  2BYM B;  4WU9 D;  4KUD A;  5B31 G;  5AY8 A;  4WNN B;  3WKJ D;  1P3A A;  5AY8 B;  2YFW B;  3WA9 B;  5GT3 A;  4YM6 B;  5B1L A;  5B0Y D;  4J8W B;  5B32 D;  1P3K A;  5JRG C;  3MVD A;  5B24 C;  3AFA C;  5GSU C;  3LZ0 A;  3AV1 B;  1KU5 A;  5F99 B;  1F66 D;  1ID3 B;  3KXB C;  3AZF D;  5CPI B;  2PYO D;  4Z5T C;  4ZBJ B;  2BYK A;  3MGQ A;  1M18 A;  5CP6 C;  5B0Z C;  5AV9 C;  3AZK B;  4XUJ B;  3AZL C;  4ZUX D;  1TZY B;  5B33 D;  3UTA D;  3AZM C;  3AV2 C;  5B2I A;  1S32 C;  1WWS A;  3AN2 A;  2NZD C;  2FJ7 B;  5B40 A;  5AVC B;  1M1A D;  3AZE D;  3B6G A;  4G92 B;  3REH A;  3W99 B;  2F8N G;  4G91 B;  4YS3 D;  4X23 D;  4J8X D;  5E5A A;  3W96 A;  3KUY C;  1P3M C;  4Z2M H;  3KWQ C;  3B6F A;  3X1V C;  3AZH A;  4H9S A;  5AV6 A;  3AZI C;  4XZQ D;  3WTP D;  4LD9 C;  2ARO A;  5B24 B;  3X1T C;  1N1J A;  3LJA A;  1R4V A;  5GSU B;  1ZLA D;  1F1E A;  3KSY A;  5GXQ A;  3AZN A;  4NE5 A;  5AV5 A;  2YFV B;  4Z5T B;  2CV5 C;  4DRB A;  5CP6 B;  5B0Y C;  1BH9 B;  5AV9 B;  5B32 C;  1P3G C;  3AZL B;  3MGR A;  2HIO A;  3AV2 B;  3AZM B;  4J8U D;  1S32 B;  2NZD B;  5GT3 D;  4R8P A;  1P3F D;  1P3L C;  4HGA C;  1EQZ A;  3V9R A;  1P3P A;  5B1L D;  1H3O A;  2PYO C;  3MGP C;  1P3K D;  4H9Q A;  5B2J A;  3KUY B;  3AZG A;  4JJN A;  1P3M B;  3KWQ B;  5B33 C;  1P3B C;  3AZE C;  3MGQ D;  4LD9 B;  3B0C W;  3X1T B;  1AOI C;  1P3O C;  4X23 C;  5B2I D;  3LZ1 A;  3AN2 D;  5B40 D;  5DNM A;  3UT9 A;  1M19 C;  3REH D;  1BH8 B;  1JFI A;  2CV5 B;  5CPJ D;  3NQU A;  5B0Y B;  3AYW C;  3C1C A;  1P3G B;  1KX4 A;  3WTP C;  3O62 C;  3LEL D;  4E44 A;  3W96 D;  3REK A;  1ZLA C;  4WU8 A;  1P3L B;  4HGA B;  3B6F D;  5KDM B;  2IO5 C;  2RVQ D;  5AV6 D;  5B1M C;  3MGP B;  3REI A;  4KGC C;  2ARO D;  3X1U D;  4Z66 C;  3LJA D;  3WAA C;  1HQ3 C;  5B31 C;  3REL A;  4J8U C;  3UTB C;  3AZN D;  5AV5 D;  1KX3 D;  3REL B;  3TU4 C;  1P3B B;  1P3F C;  2BYM A;  3AZE B;  3MGS C;  4WNN A;  1AOI B;  1P3O B;  5BS7 A;  4X23 B;  3MGR D;  2HIO D;  2YFW A;  3W97 A;  3WA9 A;  4R8P D;  3W97 B;  4YM6 A;  3W98 C;  1P3P D;  1M19 B;  3X1S C;  1P3I D;  4J8W A;  3AYW B;  1TAF B;  3WTP B;  5GT0 C;  5B2J D;  3AZJ C;  3O62 B;  3AZG D;  4JJN D;  3AV1 A;  5F99 A;  4J8V A;  3C1B D;  4QLC D;  1ID3 A;  1Q9C A;  4CSR B;  5CPI A;  2IO5 B;  4J8V B;  1P34 A;  3REJ D;  5B1M B;  1P34 B;  2LY8 A;  5AV8 C;  4KGC B;  5CPJ C;  3AZK A;  4XUJ A;  5BO0 B;  4Z66 B;  1KX5 C;  3WAA B;  1TZY A;  5FUG B;  5AVB D;  3LEL C;  1HQ3 B;  5B31 B;  3LZ1 D;  3UTB B;  2FJ7 A;  3TU4 B;  5DNM D;  5AVC A;  5DNN C;  2NQB A;  3UT9 D;  3VH5 W;  3W99 A;  3MGS B;  2NQB B;  3C1C D;  3A6N C;  1KX4 D;  2CWE A;  3X1U C;  4H9N B;  1U35 D;  5BT1 D;  3MNN D;  4WU8 D;  3W98 B;  1KX3 C;  3X1S B;  5CPK C;  4NFT A;  2JSS A;  5JRG A;  3REI D;  5GT0 B;  5B24 A;  3AFA A;  3AZJ B;  3VH6 W;  5JRG B;  4WU9 C;  5GSU A;  3AFA B;  3WKJ C;  3KXB A;  2YFV A;  4UUZ B;  3KXB B;  4Z5T A;  1P3I C;  5CP6 A;  5B0Z A;  5AV8 B;  4H9R A;  1BH9 A;  5AV9 A;  5CPJ B;  1KX5 B;  2L5A A;  5B0Z B;  4KUD D;  4H9R B;  5AY8 D;  3AZL A;  3AV2 A;  3AZM A;  1P3A D;  1S32 A;  2F8N B;  2NZD A;  3C1B C;  4QLC C;  4YM6 D;  5DNN B;  5G49 B;  4WZS B;  1F66 C;  4NE3 A;  3REJ C;  3AZF C;  4J8W D;  4CAY B;  3A6N B;  3KUY A;  3MVD D;  1P3M A;  3AV1 D;  5C3I C;  3KWQ A;  5F99 D;  5AVB C;  1ID3 D;  3LZ0 D;  4ZUX C;  3UTA C;  3X1V A;  3AZI A;  5CPK B;  3UT9 C;  3X1V B;  4EO5 C;  3AZI B;  1M1A C;  4LD9 A;  3AZK D;  1M18 D;  3X1T A;  4WU9 B;  1KX4 C;  1TZY D;  3WKJ B;  4YS3 C;  1U35 C;  4J8X C;  3MNN C;  4AWL C;  5BNV B;  5AVC D;  3W99 D;  1BH8 A;  2CV5 A;  1P3I B;  3B6G D;  5B0Y A;  5JA4 B;  5B32 A;  4E45 A;  1P3G A;  4XZQ C;  5B32 B;  4WV4 B;  4NE6 A;  5BNX B;  5E5A D;  1P3L A;  3C1B B;  4QLC B;  5KDM A;  1F66 B;  2PYO A;  4H9P A;  3REJ B;  3MGP A;  3AZF B;  3AZH D;  2PYO B;  4H9P B;  5B24 D;  4KUD C;  5GSU D;  5AY8 C;  5C3I B;  5B33 A;  1P3A C;  4M6B A;  3B0B A;  4ZUX B;  5B33 B;  3UTA B;  1P3B A;  5GXQ D;  4H9O A;  4Z5T D;  3AZE A;  5GT3 C;  3R45 B;  5CP6 D;  4H9O B;  5AV9 D;  1M1A B;  5B1L C;  1AOI A;  1P3O A;  4X23 A;  1P3K C;  3AV2 D;  3MVD C;  1S32 D;  4YS3 B;  2NZD D;  4J8X B;  4AWL B;  3LZ0 C;  1M19 A;  1EQZ D;  3AYW A;  1TAF A;  3WTP A;  1B6W A;  4XZQ B;  3MGQ C;  1M18 C;  3O62 A;  3KUY D;  1P3M D;  1HTA A;  3KWQ D;  1ZLA A;  4CSR A;  1ZLA B;  5B2I C;  3AN2 C;  5B1M A;  3WTP E;  5B40 C;  5CHL B;  4KGC A;  4LD9 D;  3B6G C;  3REH C;  5BO0 A;  3X1T D;  4Z66 A;  4G91 C;  3WAA A;  4KUD B;  5FUG A;  1HQ3 A;  5B31 A;  1P3A B;  4J8U A;  3UTB A;  5E5A C;  1BFM A;  3W96 C;  3TU4 A;  4J8U B;  1P3F A;  5GT3 B;  3MGS A;  1P3F B;  2CV5 D;  3B6F C;  2F8N K;  2RVQ C;  5B1L B;  1P3G D;  3AZH C;  4H9S C;  5AV6 C;  4H9N A;  1P3K B;  3MVD B;  2ARO C;  1P3L D;  3LJA C;  3REK D;  3LZ0 B;  3W98 A;  3B0D C;  3X1S A;  5GXQ C;  3AZN C;  3MGP D;  5AV5 C;  1ULY A;  5GT0 A;  3AZJ A;  2BYK B;  3MGQ B;  1M18 B;  3MGR C;  2HIO C;  4UUZ A;  3REL D;  1P3B D;  5B2I B;  3AN2 B;  3B0C T;  4R8P C;  1EQZ C;  1B67 A;  5B40 B;  5AV8 A;  5CPJ A;  1P3P C;  3B6G B;  3REH B;  1KX5 A;  1AOI D;  1P3O D;  3LEL A;  2F8N A;  5B2J C;  5E5A B;  3W96 B;  3LEL B;  3AZG C;  4JJN C;  3W97 D;  3WA9 D;  5DNN A;  5G49 A;  1M19 D;  3B6F B;  1WWI A;  3AYW D;  4CAY A;  3A6N A;  3AZH B;  5AV6 B;  4KHA A;  3X1U A;  3O62 D;  4DRA A;  2ARO B;  3NQJ A;  4KHA B;  3X1U B;  1N1J B;  3LJA B;  3NQJ B;  1KX3 A;  4J8V D;  3B0D B;  3LZ1 C;  5CPK A;  5GXQ B;  5B1M D;  3AZN B;  5CPI D;  5AV5 B;  1KX3 B;  1P34 D;  4KGC D;  5DNM C;  4Z66 D;  4WU9 A;  3WAA D;  4XUJ D;  3C1C C;  1HQ3 D;  5B31 D;  3WKJ A;  3UTB D;  3MGR B;  2HIO B;  1A7W A;  3TU4 D;  5BNV A;  3REK C;  2FJ7 D;  5BT1 C; 
#chains in the Genus database with same CATH topology
 4R8P B;  3MGS D;  4WU8 C;  1EQZ B;  5B32 G;  1P3I A;  2NQB D;  3V9R B;  1P3P B;  5JA4 A;  1H3O B;  2JE5 A;  3REI C;  2HUE C;  5BNX A;  4H9Q B;  5B2J B;  3AZG B;  3C1B A;  4QLC A;  4JJN B;  3W98 D;  1F66 A;  3X1S D;  3REL C;  3REJ A;  3AZF A;  5GT0 D;  3AZJ D;  5JRG D;  2BG1 A;  3AFA D;  5AVB A;  5BS7 C;  4ZUX A;  5AVB B;  3UTA A;  3VH5 A;  3KXB D;  3W97 C;  3LZ1 B;  3WA9 C;  4Z2M G;  3R45 A;  5AV8 D;  4YM6 C;  5DNM B;  1M1A A;  3UT9 B;  4EO5 B;  2XD5 A;  1KX5 D;  5B0Z D;  1JFI B;  3NQU B;  4J8W C;  3C1C B;  1Z2C B;  1KX4 B;  2F8N D;  4YS3 A;  3AZL D;  1U35 A;  3VH5 T;  4J8X A;  3AZM D;  3MNN A;  1U35 B;  3AV1 C;  5DNN D;  3REK B;  5F99 C;  4UPK A;  3MNN B;  4J8V C;  4WU8 B;  1ID3 C;  5CPI C;  2F8N H;  2ZY3 A;  1P34 C;  3A6N D;  3VH6 A;  4ZBJ C;  4XZQ A;  3REI B;  2HUE B;  3AZK C;  4XUJ C;  1TZY C;  5CPK D;  2FJ7 C;  3X1V D;  3VH6 T;  3AZI D;  5AVC C;  3W99 C;  2NQB C;  4G92 C;  2BYM B;  4WU9 D;  1T3U A;  4KUD A;  2FFF B;  5B31 G;  5AY8 A;  4WNN B;  3WKJ D;  1P3A A;  2Y2N A;  5AY8 B;  2YFW B;  3WA9 B;  5GT3 A;  4YM6 B;  2F2A C;  5B1L A;  5B0Y D;  4J8W B;  5B32 D;  1P3K A;  5JRG C;  3MVD A;  5B24 C;  2ZY5 A;  3AFA C;  5GSU C;  3LZ0 A;  2RIQ A;  3AV1 B;  1KU5 A;  5F99 B;  1F66 D;  1ID3 B;  3KXB C;  3AZF D;  5CPI B;  2PYO D;  2ZM5 A;  4Z5T C;  4ZBJ B;  2BYK A;  3MGQ A;  1M18 A;  5CP6 C;  5B0Z C;  5AV9 C;  3AZK B;  4XUJ B;  3AZL C;  4ZUX D;  1TZY B;  5B33 D;  3UTA D;  3AZM C;  3AV2 C;  5B2I A;  1S32 C;  2Y2K A;  1WWS A;  3AN2 A;  2NZD C;  2FJ7 B;  5B40 A;  5AVC B;  1M1A D;  3AZE D;  3B6G A;  4G92 B;  3REH A;  3W99 B;  2F8N G;  3FDD A;  1W2E A;  1PZR A;  3H0M C;  4G91 B;  4YS3 D;  4X23 D;  5E5A A;  4J8X D;  3W96 A;  3KUY C;  1P3M C;  4Z2M H;  3KWQ C;  3B6F A;  4DQY B;  3X1V C;  3AZH A;  4H9S A;  5AV6 A;  3AZI C;  4XZQ D;  3WTP D;  4LD9 C;  2ARO A;  5B24 B;  3X1T C;  1N1J A;  3LJA A;  1R4V A;  5GSU B;  1ZLA D;  1F1E A;  3KSY A;  5GXQ A;  3AZN A;  4NE5 A;  5AV5 A;  2YFV B;  2J8P A;  2ZY4 A;  4Z5T B;  2CV5 C;  4DRB A;  5CP6 B;  3KFU G;  5B0Y C;  1BH9 B;  5AV9 B;  5B32 C;  1P3G C;  3AZL B;  3MGR A;  2HIO A;  3AV2 B;  3AZM B;  4J8U D;  1S32 B;  2NZD B;  5GT3 D;  4R8P A;  1P3F D;  1P3L C;  4HGA C;  1EQZ A;  3V9R A;  1P3P A;  5B1L D;  1H3O A;  2PYO C;  3MGP C;  1P3K D;  4H9Q A;  5B2J A;  3EPL A;  3KUY B;  3EPJ A;  3AZG A;  4JJN A;  1P3M B;  3KWQ B;  3H0R C;  5B33 C;  1P3B C;  3AZE C;  3MGQ D;  4LD9 B;  3B0C W;  3X1T B;  1AOI C;  1P3O C;  4X23 C;  5B2I D;  3LZ1 A;  3AN2 D;  5B40 D;  5DNM A;  3UT9 A;  1M19 C;  3REH D;  1BH8 B;  1JFI A;  2CV5 B;  5CPJ D;  3NQU A;  2Y2H A;  5B0Y B;  3AYW C;  3C1C A;  1P3G B;  1KX4 A;  3WTP C;  3O62 C;  3LEL D;  4E44 A;  3W96 D;  3REK A;  1ZLA C;  4WU8 A;  1P3L B;  4HGA B;  3B6F D;  5KDM B;  2IO5 C;  2RVQ D;  5AV6 D;  2G5I C;  2Y2Q A;  3F6T A;  5B1M C;  3MGP B;  3REI A;  4KGC C;  2ARO D;  3X1U D;  4Z66 C;  3LJA D;  3WAA C;  3AL0 C;  1HQ3 C;  5B31 C;  3REL A;  4J8U C;  3UTB C;  3AZN D;  5AV5 D;  1KX3 D;  3REL B;  3TU4 C;  1P3B B;  1P3F C;  2BYM A;  3AZE B;  3MGS C;  3IP4 C;  2Y2J A;  4WNN A;  1AOI B;  1P3O B;  5BS7 A;  4X23 B;  3MGR D;  2HIO D;  2YFW A;  4WJ3 C;  3W97 A;  3WA9 A;  4R8P D;  3W97 B;  4YM6 A;  3W98 C;  1P3P D;  1M19 B;  3X1S C;  1P3I D;  4J8W A;  3AYW B;  1TAF B;  3WTP B;  5GT0 C;  5B2J D;  3AZJ C;  3O62 B;  3AZG D;  4JJN D;  3AV1 A;  5F99 A;  2Y2O A;  3C1B D;  4QLC D;  4J8V A;  1ID3 A;  1Q9C A;  4CSR B;  5CPI A;  2IO5 B;  4J8V B;  1P34 A;  3REJ D;  5B1M B;  1P34 B;  2LY8 A;  5AV8 C;  4KGC B;  5CPJ C;  3AZK A;  4XUJ A;  5BO0 B;  4Z66 B;  1KX5 C;  3WAA B;  1TZY A;  5FUG B;  5AVB D;  3LEL C;  1HQ3 B;  5B31 B;  3LZ1 D;  3UTB B;  2FJ7 A;  3TU4 B;  5DNM D;  5AVC A;  5DNN C;  2NQB A;  3UT9 D;  3VH5 W;  3W99 A;  3MGS B;  2NQB B;  3C1C D;  2Y2M A;  3A6N C;  1KX4 D;  3EPK A;  2CWE A;  3X1U C;  4H9N B;  1U35 D;  5BT1 D;  3MNN D;  4WU8 D;  3W98 B;  1KX3 C;  3X1S B;  5CPK C;  4NFT A;  2JSS A;  5JRG A;  3REI D;  5GT0 B;  5B24 A;  3AFA A;  3AZJ B;  3VH6 W;  5JRG B;  4WU9 C;  5GSU A;  3AFA B;  3WKJ C;  3KXB A;  2YFV A;  4UUZ B;  3KXB B;  3A1K A;  4Z5T A;  1P3I C;  5CP6 A;  5B0Z A;  5AV8 B;  4H9R A;  1BH9 A;  5AV9 A;  5CPJ B;  1KX5 B;  2L5A A;  5B0Z B;  4KUD D;  4H9R B;  5AY8 D;  3AZL A;  3AV2 A;  3AZM A;  1P3A D;  1S32 A;  2F8N B;  2NZD A;  3C1B C;  4QLC C;  4YM6 D;  5DNN B;  5G49 B;  4WZS B;  1F66 C;  4NE3 A;  3REJ C;  3AZF C;  4J8W D;  4CAY B;  3A6N B;  3KUY A;  3MVD D;  1P3M A;  3AV1 D;  5C3I C;  3KWQ A;  5F99 D;  5AVB C;  1ID3 D;  2VQR A;  3LZ0 D;  4ZUX C;  3UTA C;  3X1V A;  3AZI A;  5CPK B;  3UT9 C;  3X1V B;  4EO5 C;  3AZI B;  2Y2G A;  1M1A C;  4LD9 A;  3AZK D;  1M18 D;  3X1T A;  4WU9 B;  1KX4 C;  1TZY D;  3WKJ B;  4YS3 C;  1U35 C;  4J8X C;  3MNN C;  4AWL C;  5BNV B;  5AVC D;  3W99 D;  1BH8 A;  2CV5 A;  3EG5 B;  1P3I B;  3B6G D;  5B0Y A;  5JA4 B;  5B32 A;  4E45 A;  1P3G A;  4XZQ C;  5B32 B;  4WV4 B;  4NE6 A;  5BNX B;  5E5A D;  1P3L A;  3C1B B;  4QLC B;  5KDM A;  1F66 B;  2PYO A;  4H9P A;  3REJ B;  3MGP A;  3AZF B;  3AZH D;  2PYO B;  4H9P B;  5B24 D;  2JCH A;  4KUD C;  5GSU D;  5AY8 C;  5C3I B;  3EPH A;  5B33 A;  1P3A C;  4M6B A;  3B0B A;  3A1I A;  4ZUX B;  2DF4 C;  5B33 B;  3UTA B;  1P3B A;  5GXQ D;  4H9O A;  4Z5T D;  3AZE A;  5GT3 C;  3R45 B;  5CP6 D;  4H9O B;  5AV9 D;  1M1A B;  3P5J B;  5B1L C;  1AOI A;  1P3O A;  4X23 A;  1P3K C;  3AV2 D;  3MVD C;  1S32 D;  4YS3 B;  2NZD D;  4J8X B;  4AWL B;  3LZ0 C;  1M19 A;  1EQZ D;  3AYW A;  1TAF A;  3WTP A;  1B6W A;  4XZQ B;  3MGQ C;  1M18 C;  3O62 A;  3KUY D;  1P3M D;  1HTA A;  3KWQ D;  1ZLA A;  4CSR A;  3H0L C;  1ZLA B;  5B2I C;  3AN2 C;  5B1M A;  3WTP E;  5B40 C;  5CHL B;  4KGC A;  4LD9 D;  3B6G C;  3REH C;  5BO0 A;  3X1T D;  4Z66 A;  4G91 C;  3WAA A;  4KUD B;  5FUG A;  1HQ3 A;  5B31 A;  1P3A B;  4J8U A;  3UTB A;  5E5A C;  2G5H C;  1BFM A;  3W96 C;  3TU4 A;  4J8U B;  1P3F A;  5GT3 B;  3MGS A;  1P3F B;  2CV5 D;  3B6F C;  2F8N K;  2RVQ C;  5B1L B;  1P3G D;  3AZH C;  4H9S C;  5AV6 C;  4H9N A;  1P3K B;  3MVD B;  2ARO C;  1P3L D;  3LJA C;  3REK D;  3LZ0 B;  3W98 A;  3B0D C;  3X1S A;  5GXQ C;  3AZN C;  3MGP D;  2W8S A;  5AV5 C;  1ULY A;  5GT0 A;  3AZJ A;  2BYK B;  3MGQ B;  1M18 B;  3MGR C;  2HIO C;  4UUZ A;  3REL D;  1P3B D;  5B2I B;  3AN2 B;  3B0C T;  4R8P C;  1EQZ C;  1B67 A;  5B40 B;  5AV8 A;  5CPJ A;  2Y2I A;  1P3P C;  3B6G B;  3REH B;  2ZY2 A;  1KX5 A;  2XD1 A;  1AOI D;  1P3O D;  3LEL A;  2F8N A;  5B2J C;  5E5A B;  3W96 B;  3LEL B;  3AZG C;  4JJN C;  3W97 D;  3WA9 D;  5DNN A;  5G49 A;  1M19 D;  3B6F B;  1WWI A;  3AYW D;  4CAY A;  2UWX A;  3A6N A;  3AZH B;  5AV6 B;  2Y2P A;  4KHA A;  3X1U A;  3O62 D;  4DRA A;  2ARO B;  3NQJ A;  4KHA B;  3X1U B;  1N1J B;  3LJA B;  3NQJ B;  1KX3 A;  4J8V D;  3B0D B;  3LZ1 C;  5CPK A;  5GXQ B;  5B1M D;  3AZN B;  5CPI D;  5AV5 B;  1KX3 B;  1P34 D;  4KGC D;  5DNM C;  2Y2L A;  4Z66 D;  4WU9 A;  3WAA D;  4XUJ D;  3C1C C;  1HQ3 D;  5B31 D;  3WKJ A;  3UTB D;  2DQN C;  3MGR B;  2HIO B;  1A7W A;  3TU4 D;  5BNV A;  3REK C;  2FJ7 D;  5BT1 C; 
#chains in the Genus database with same CATH homology
 4R8P B;  3MGS D;  4WU8 C;  1EQZ B;  5B32 G;  1P3I A;  2NQB D;  3V9R B;  1P3P B;  5JA4 A;  1H3O B;  2JE5 A;  3REI C;  2HUE C;  5BNX A;  4H9Q B;  5B2J B;  3AZG B;  3C1B A;  4QLC A;  4JJN B;  3W98 D;  1F66 A;  3X1S D;  3REL C;  3REJ A;  3AZF A;  5GT0 D;  3AZJ D;  5JRG D;  2BG1 A;  3AFA D;  5AVB A;  5BS7 C;  4ZUX A;  5AVB B;  3UTA A;  3VH5 A;  3KXB D;  3W97 C;  3LZ1 B;  3WA9 C;  4Z2M G;  3R45 A;  5AV8 D;  4YM6 C;  5DNM B;  1M1A A;  3UT9 B;  4EO5 B;  2XD5 A;  1KX5 D;  5B0Z D;  1JFI B;  3NQU B;  4J8W C;  3C1C B;  1Z2C B;  1KX4 B;  2F8N D;  4YS3 A;  3AZL D;  1U35 A;  3VH5 T;  4J8X A;  3AZM D;  3MNN A;  1U35 B;  3AV1 C;  5DNN D;  3REK B;  5F99 C;  4UPK A;  3MNN B;  4J8V C;  4WU8 B;  1ID3 C;  5CPI C;  2F8N H;  2ZY3 A;  1P34 C;  3A6N D;  3VH6 A;  4ZBJ C;  4XZQ A;  3REI B;  2HUE B;  3AZK C;  4XUJ C;  1TZY C;  5CPK D;  2FJ7 C;  3X1V D;  3VH6 T;  3AZI D;  5AVC C;  3W99 C;  2NQB C;  4G92 C;  2BYM B;  4WU9 D;  1T3U A;  4KUD A;  2FFF B;  5B31 G;  5AY8 A;  4WNN B;  3WKJ D;  1P3A A;  2Y2N A;  5AY8 B;  2YFW B;  3WA9 B;  5GT3 A;  4YM6 B;  2F2A C;  5B1L A;  5B0Y D;  4J8W B;  5B32 D;  1P3K A;  5JRG C;  3MVD A;  5B24 C;  2ZY5 A;  3AFA C;  5GSU C;  3LZ0 A;  2RIQ A;  3AV1 B;  1KU5 A;  5F99 B;  1F66 D;  1ID3 B;  3KXB C;  3AZF D;  5CPI B;  2PYO D;  2ZM5 A;  4Z5T C;  4ZBJ B;  2BYK A;  3MGQ A;  1M18 A;  5CP6 C;  5B0Z C;  5AV9 C;  3AZK B;  4XUJ B;  3AZL C;  4ZUX D;  1TZY B;  5B33 D;  3UTA D;  3AZM C;  3AV2 C;  5B2I A;  1S32 C;  2Y2K A;  1WWS A;  3AN2 A;  2NZD C;  2FJ7 B;  5B40 A;  5AVC B;  1M1A D;  3AZE D;  3B6G A;  4G92 B;  3REH A;  3W99 B;  2F8N G;  3FDD A;  1W2E A;  1PZR A;  3H0M C;  4G91 B;  4YS3 D;  4X23 D;  5E5A A;  4J8X D;  3W96 A;  3KUY C;  1P3M C;  4Z2M H;  3KWQ C;  3B6F A;  4DQY B;  3X1V C;  3AZH A;  4H9S A;  5AV6 A;  3AZI C;  4XZQ D;  3WTP D;  4LD9 C;  2ARO A;  5B24 B;  3X1T C;  1N1J A;  3LJA A;  1R4V A;  5GSU B;  1ZLA D;  1F1E A;  3KSY A;  5GXQ A;  3AZN A;  4NE5 A;  5AV5 A;  2YFV B;  2J8P A;  2ZY4 A;  4Z5T B;  2CV5 C;  4DRB A;  5CP6 B;  3KFU G;  5B0Y C;  1BH9 B;  5AV9 B;  5B32 C;  1P3G C;  3AZL B;  3MGR A;  2HIO A;  3AV2 B;  3AZM B;  4J8U D;  1S32 B;  2NZD B;  5GT3 D;  4R8P A;  1P3F D;  1P3L C;  4HGA C;  1EQZ A;  3V9R A;  1P3P A;  5B1L D;  1H3O A;  2PYO C;  3MGP C;  1P3K D;  4H9Q A;  5B2J A;  3EPL A;  3KUY B;  3EPJ A;  3AZG A;  4JJN A;  1P3M B;  3KWQ B;  3H0R C;  5B33 C;  1P3B C;  3AZE C;  3MGQ D;  4LD9 B;  3B0C W;  3X1T B;  1AOI C;  1P3O C;  4X23 C;  5B2I D;  3LZ1 A;  3AN2 D;  5B40 D;  5DNM A;  3UT9 A;  1M19 C;  3REH D;  1BH8 B;  1JFI A;  2CV5 B;  5CPJ D;  3NQU A;  2Y2H A;  5B0Y B;  3AYW C;  3C1C A;  1P3G B;  1KX4 A;  3WTP C;  3O62 C;  3LEL D;  4E44 A;  3W96 D;  3REK A;  1ZLA C;  4WU8 A;  1P3L B;  4HGA B;  3B6F D;  5KDM B;  2IO5 C;  2RVQ D;  5AV6 D;  2G5I C;  2Y2Q A;  3F6T A;  5B1M C;  3MGP B;  3REI A;  4KGC C;  2ARO D;  3X1U D;  4Z66 C;  3LJA D;  3WAA C;  3AL0 C;  1HQ3 C;  5B31 C;  3REL A;  4J8U C;  3UTB C;  3AZN D;  5AV5 D;  1KX3 D;  3REL B;  3TU4 C;  1P3B B;  1P3F C;  2BYM A;  3AZE B;  3MGS C;  3IP4 C;  2Y2J A;  4WNN A;  1AOI B;  1P3O B;  5BS7 A;  4X23 B;  3MGR D;  2HIO D;  2YFW A;  4WJ3 C;  3W97 A;  3WA9 A;  4R8P D;  3W97 B;  4YM6 A;  3W98 C;  1P3P D;  1M19 B;  3X1S C;  1P3I D;  4J8W A;  3AYW B;  1TAF B;  3WTP B;  5GT0 C;  5B2J D;  3AZJ C;  3O62 B;  3AZG D;  4JJN D;  3AV1 A;  5F99 A;  2Y2O A;  3C1B D;  4QLC D;  4J8V A;  1ID3 A;  1Q9C A;  4CSR B;  5CPI A;  2IO5 B;  4J8V B;  1P34 A;  3REJ D;  5B1M B;  1P34 B;  2LY8 A;  5AV8 C;  4KGC B;  5CPJ C;  3AZK A;  4XUJ A;  5BO0 B;  4Z66 B;  1KX5 C;  3WAA B;  1TZY A;  5FUG B;  5AVB D;  3LEL C;  1HQ3 B;  5B31 B;  3LZ1 D;  3UTB B;  2FJ7 A;  3TU4 B;  5DNM D;  5AVC A;  5DNN C;  2NQB A;  3UT9 D;  3VH5 W;  3W99 A;  3MGS B;  2NQB B;  3C1C D;  2Y2M A;  3A6N C;  1KX4 D;  3EPK A;  2CWE A;  3X1U C;  4H9N B;  1U35 D;  5BT1 D;  3MNN D;  4WU8 D;  3W98 B;  1KX3 C;  3X1S B;  5CPK C;  4NFT A;  2JSS A;  5JRG A;  3REI D;  5GT0 B;  5B24 A;  3AFA A;  3AZJ B;  3VH6 W;  5JRG B;  4WU9 C;  5GSU A;  3AFA B;  3WKJ C;  3KXB A;  2YFV A;  4UUZ B;  3KXB B;  3A1K A;  4Z5T A;  1P3I C;  5CP6 A;  5B0Z A;  5AV8 B;  4H9R A;  1BH9 A;  5AV9 A;  5CPJ B;  1KX5 B;  2L5A A;  5B0Z B;  4KUD D;  4H9R B;  5AY8 D;  3AZL A;  3AV2 A;  3AZM A;  1P3A D;  1S32 A;  2F8N B;  2NZD A;  3C1B C;  4QLC C;  4YM6 D;  5DNN B;  5G49 B;  4WZS B;  1F66 C;  4NE3 A;  3REJ C;  3AZF C;  4J8W D;  4CAY B;  3A6N B;  3KUY A;  3MVD D;  1P3M A;  3AV1 D;  5C3I C;  3KWQ A;  5F99 D;  5AVB C;  1ID3 D;  2VQR A;  3LZ0 D;  4ZUX C;  3UTA C;  3X1V A;  3AZI A;  5CPK B;  3UT9 C;  3X1V B;  4EO5 C;  3AZI B;  2Y2G A;  1M1A C;  4LD9 A;  3AZK D;  1M18 D;  3X1T A;  4WU9 B;  1KX4 C;  1TZY D;  3WKJ B;  4YS3 C;  1U35 C;  4J8X C;  3MNN C;  4AWL C;  5BNV B;  5AVC D;  3W99 D;  1BH8 A;  2CV5 A;  3EG5 B;  1P3I B;  3B6G D;  5B0Y A;  5JA4 B;  5B32 A;  4E45 A;  1P3G A;  4XZQ C;  5B32 B;  4WV4 B;  4NE6 A;  5BNX B;  5E5A D;  1P3L A;  3C1B B;  4QLC B;  5KDM A;  1F66 B;  2PYO A;  4H9P A;  3REJ B;  3MGP A;  3AZF B;  3AZH D;  2PYO B;  4H9P B;  5B24 D;  2JCH A;  4KUD C;  5GSU D;  5AY8 C;  5C3I B;  3EPH A;  5B33 A;  1P3A C;  4M6B A;  3B0B A;  3A1I A;  4ZUX B;  2DF4 C;  5B33 B;  3UTA B;  1P3B A;  5GXQ D;  4H9O A;  4Z5T D;  3AZE A;  5GT3 C;  3R45 B;  5CP6 D;  4H9O B;  5AV9 D;  1M1A B;  3P5J B;  5B1L C;  1AOI A;  1P3O A;  4X23 A;  1P3K C;  3AV2 D;  3MVD C;  1S32 D;  4YS3 B;  2NZD D;  4J8X B;  4AWL B;  3LZ0 C;  1M19 A;  1EQZ D;  3AYW A;  1TAF A;  3WTP A;  1B6W A;  4XZQ B;  3MGQ C;  1M18 C;  3O62 A;  3KUY D;  1P3M D;  1HTA A;  3KWQ D;  1ZLA A;  4CSR A;  3H0L C;  1ZLA B;  5B2I C;  3AN2 C;  5B1M A;  3WTP E;  5B40 C;  5CHL B;  4KGC A;  4LD9 D;  3B6G C;  3REH C;  5BO0 A;  3X1T D;  4Z66 A;  4G91 C;  3WAA A;  4KUD B;  5FUG A;  1HQ3 A;  5B31 A;  1P3A B;  4J8U A;  3UTB A;  5E5A C;  2G5H C;  1BFM A;  3W96 C;  3TU4 A;  4J8U B;  1P3F A;  5GT3 B;  3MGS A;  1P3F B;  2CV5 D;  3B6F C;  2F8N K;  2RVQ C;  5B1L B;  1P3G D;  3AZH C;  4H9S C;  5AV6 C;  4H9N A;  1P3K B;  3MVD B;  2ARO C;  1P3L D;  3LJA C;  3REK D;  3LZ0 B;  3W98 A;  3B0D C;  3X1S A;  5GXQ C;  3AZN C;  3MGP D;  2W8S A;  5AV5 C;  1ULY A;  5GT0 A;  3AZJ A;  2BYK B;  3MGQ B;  1M18 B;  3MGR C;  2HIO C;  4UUZ A;  3REL D;  1P3B D;  5B2I B;  3AN2 B;  3B0C T;  4R8P C;  1EQZ C;  1B67 A;  5B40 B;  5AV8 A;  5CPJ A;  2Y2I A;  1P3P C;  3B6G B;  3REH B;  2ZY2 A;  1KX5 A;  2XD1 A;  1AOI D;  1P3O D;  3LEL A;  2F8N A;  5B2J C;  5E5A B;  3W96 B;  3LEL B;  3AZG C;  4JJN C;  3W97 D;  3WA9 D;  5DNN A;  5G49 A;  1M19 D;  3B6F B;  1WWI A;  3AYW D;  4CAY A;  2UWX A;  3A6N A;  3AZH B;  5AV6 B;  2Y2P A;  4KHA A;  3X1U A;  3O62 D;  4DRA A;  2ARO B;  3NQJ A;  4KHA B;  3X1U B;  1N1J B;  3LJA B;  3NQJ B;  1KX3 A;  4J8V D;  3B0D B;  3LZ1 C;  5CPK A;  5GXQ B;  5B1M D;  3AZN B;  5CPI D;  5AV5 B;  1KX3 B;  1P34 D;  4KGC D;  5DNM C;  2Y2L A;  4Z66 D;  4WU9 A;  3WAA D;  4XUJ D;  3C1C C;  1HQ3 D;  5B31 D;  3WKJ A;  3UTB D;  2DQN C;  3MGR B;  2HIO B;  1A7W A;  3TU4 D;  5BNV A;  3REK C;  2FJ7 D;  5BT1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...