1P3MB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mB00
1KX4A 5BT1D 1P3KB 5BNXA 1F66D 3C1CA 3UTBD 5B2JD 3AZMD 3W96C 3REJC 3R45A 3AZJA 3C1BB 3B0DB 4WU8D 1U35B 5AVCB 2NQBA 3WA9A 4ZUXA 4Z5TC 1M18A 4KUDB 4XZQD 3MGRB 4H9SC 1ULYA 5B2IA 3LJAD 2FJ7C 3AZIC 5BNVA 1M1AC 5DNMC 1P3IC 5AV6A 3AZEC 1R4VA 5AV5C 2HIOC 1P3FA 3NQJA 4Z66C 5FUGA 3WAAD 3AZLB 4ZBJB 5CPIB 4YM6D 1P3BD 5GT0C 1N1JB 3C1BC 1AOID 4H9RA 5CPKB 4X23B 3AV1D 1U35C 5AVCC 5B0ZA 5GSUB 3AZND 3X1UD 5AVBB 3AFAA 3WKJB 4UUZB 5B2JA 3B6GC 3MVDB 3O62C 5B24B 1WWSA 3AZGD 5BS7C 4XZQA 4WU9D 5GT3A 4M6BA 3LJAA 3AZLC 4ZBJC 4DRAA 5KDMB 2RVQC 5B1LB 3AZKB 4NFTA 4X23C 3UT9D 5GSUC 3WKJC 3A6NC 5AV9A 2F8NB 4J8XB 1P3GA 3W97B 1P3ID 4YM6A 1TZYD 3MVDC 5B24C 3TU4A 1KX4C 3AYWB 4WV4B 4EO5C 5AV8B 4H9NA 1P3KD 3MNNA 2CV5D 1S32B 1P34A 2YFWB 5B1LC 4WU9A 1HQ3A 3AZKC 4KUDD 3MGRD 3B6FC 3X1TD 4AWLB 3UTAA 4J8XC 3W97C 4H9OB 1ZLAB 4CSRB 4G92C 3REIB 1EQZB 3AYWC 1P3OA 1B6WA 5AV8C 3AV2A 1P3PB 4CAYB 5DNNB 3REKA 1ID3C 2HUEB 3LZ1B 3AZLD 5CPID 4J8VA 3WTPE 5JA4A 5B0YB 3X1VB 5CPKD 4G91C 4X23D 5CP6B 1A7WA 2AROB 5GSUD 3REJB 3AZFA 3W96B 1KX5A 5AVBD 3WKJD 3MVDD 1HTAA 5B24D 2CV5A 5JRGA 5GT3C 1P3MA 2LY8A 5F99A 2FJ7B 1EQZC 3REIC 4KUDA 1M1AB 3MGRA 4JJNB 3AZEB 3X1TA 5AV5B 4YS3A 1P3PC 5DNNC 4Z2MH 2HIOB 3LZ1C 3B0BA 4R8PA 3RELB 3WTPA 4Z66B 1KX3A 3MGPB 3AZKD 5B33A 5B1MA 3X1VC 1P3GC 5CP6C 2AROC 4HGAC 5GT0B 2NZDA 4E45A 2F8ND 3W97D 4LD9C 3W98A 4WNNA 4E44A 5B32B 3VH5A 1P3AB 5BO0A 5CPKA 2BYKB 4QLCB 4NE6A 3AYWD 5E5AA 3B6GB 3X1SA 3KXBA 3KWQC 5AY8B 5B40B 3O62B 3MNNC 4JJNC 1P3LA 3MGQB 3KUYB 1M19B 1S32D 3RELC 3LZ0B 3MGPC 1BFMA 3UTAC 5GXQA 2PYOB 1JFIA 5G49B 3LELA 3MGSA 4KGCB 1ZLAD 5B31A 3W99A 5CPJB 1H3OB 1P3OC 5B32C 1P3AC 1EQZD 3A6NB 3REID 3REKC 4QLCC 3AN2D 1F66A 3UTBA 3REHD 3AZMA 5AY8C 5B40C 1P3PD 4XUJC 5DNND 3W99B 4WU8A 1KX4B 5B31G 4EO5B 5BNXB 3C1CB 3MGQC 3AZFC 3AZJB 5B0YD 3KUYC 1M19C 3VH6W 3LZ0C 5CP6D 4J8UC 3WA9B 3REJD 3W96D 4J8WC 1M18B 3B0CW 2PYOC 5B2IB 4Z5TD 4KGCC 5BNVB 4H9QA 5CPJC 5AV6B 3B6FB 2FJ7D 3AZID 3WAAA 1M1AD 5DNMD 1P3FB 3NQJB 1P3BA 4JJND 3AZED 1BH8A 5AV5D 2BYMA 1AOIA 4G92B 3W99C 2HIOD 2YFVA 1BH9B 3AZHC 1ZLAA 1Q9CA 5B33C 3AV1A 3RELD 4Z66D 3C1CC 3AZNA 4KHAA 3X1UA 3MGPD 3AZJC 2NZDC 3AN2A 1ID3B 3REHA 4H9RB 3WA9C 2NQBC 4ZUXC 5B0ZB 4CAYA 5GT0D 3C1BD 3AFAB 1M18C 4G91B 4Z2MG 5E5AC 5AVCD 5B2IC 5B32D 3AZGA 1U35D 1P3AD 1TAFA 3VH6T 3B6GD 5AV6C 3REJA 2IO5C 5AY8D 5B40D 3O62D 4XZQB 1P3FC 3V9RA 3B0CT 5GT3B 4Z5TA 3MGQD 3LJAB 4H9SA 3UT9A 2F8NH 1F1EA 2FJ7A 3AZIA 5DNMA 3MGSC 1P3IA 1TZYA 2PYOD 5AV5A 5B0ZC 2RVQD 4KGCD 3AFAC 5AV9B 1P3GB 5CPJD 4Z66A 5B2JC 4HGAB 3A6ND 3TU4B 1P3KA 4LD9B 4WU8C 3C1BA 3W99D 4XZQC 1KX4D 1U35A 5AVCA 3C1CD 3KWQB 3LJAC 3AZJD 3MNNB 1P34B 3O62A 4WU9B 1HQ3B 1M18D 5B2ID 5BS7A 5B1LD 3UTAB 5AV9C 4YM6C 1P3BC 5AV6D 3B6FD 3TU4C 4J8XD 3AZLA 5CPIA 1P3FD 5CHLB 1P3OB 3AV2B 1N1JA 4H9PB 3REKB 4X23A 4J8VB 5AV8D 5GSUA 5JA4B 5AVBA 3A6NA 4XUJB 3WKJA 1ID3D 4UUZA 3MVDA 1P34C 5B0ZD 5B24A 3AZFB 1KX5B 4WU9C 1HQ3C 3AFAD 4J8UB 2JSSA 4J8WB 2CV5B 5JRGB 1P3MB 5F99B 3UT9C 5GT3D 3AV2C 5KDMA 5B1LA 3X1TB 4YS3B 3AZKA 1TZYC 4J8VC 4R8PB 1KX3B 3B6FA 3WTPB 3NQUB 2F8NA 4J8XA 3W97A 3AZHB 3LZ1D 5B33B 5B1MB 3R45B 1KX5C 1BH9A 2NZDB 5AV9D 3AYWA 3X1VD 1P3GD 1P3KC 3W98B 4WNNB 5AV8A 2AROD 2NQBB 4ZUXB 2F8NG 5BO0B 3TU4D 1ID3A 4LD9D 3B0DC 2CV5C 5JRGC 5E5AB 1P3MC 5F99C 3X1SB 3KXBB 4KUDC 3MGRC 1S32A 2YFWA 3KWQD 2IO5B 3X1TC 5C3IB 4YS3C 1P3LB 1B67A 3MNND 4R8PC 1KX3C 1P34D 3WTPC 3VH5W 5FUGB 4H9OA 1HQ3D 5B1MC 4CSRA 5GXQB 1EQZA 3REIA 1JFIB 3LELB 3UTAD 3MGSB 5CPIC 3W98C 1KU5A 5B31B 1P3PA 5DNNA 3LZ1A 5CPKC 1F66B 3UTBB 1P3OD 5B2JB 3AZMB 3X1SC 3KXBC 3AV2D 2CWEA 5B0YA 5AVBC 3REKD 3X1VA 4QLCD 4WU8B 5CP6A 2AROA 4J8VD 3W96A 1P3LC 5C3IC 4XUJD 4LD9A 3AZFD 1KX5D 2L5AA 3KUYD 1M19D 5GXQC 3LZ0D 3KWQA 4J8UD 1M1AA 3LELC 4J8WD 5JRGD 5B31C 4H9QB 4JJNA 3AZEA 4NE3A 1P3MD 5F99D 3VH5T 2HIOA 2F8NK 3WAAB 5BT1C 1F66C 3RELA 3UTBC 4YM6B 3AZMC 1P3BB 3MGPA 1BH8B 4YS3D 2BYMB 1AOIB 2YFVB 3AV1B 4R8PD 1KX3D 3WTPD 5GT0A 4H9NB 3AZNB 4KHAB 3X1UB 3AZHD 5B33D 3AN2B 5B1MD 3REHB 5B32A 1P3AA 4H9PA 2NZDD 2BYKA 4QLCA 3B6GA 4WZSB 3W98D 5AY8A 3AZGB 2NQBD 3WA9D 5B40A 4ZUXD 4XUJA 1TAFB 1S32C 5B32G 4NE5A 5E5AD 3MGQA 3X1SD 3KXBD 3KSYA 3WAAC 3KUYA 4DRBA 1M19A 3V9RB 3LZ0A 1WWIA 4J8UA 4AWLC 1P3LD 4Z5TB 1AOIC 4J8WA 1ZLAC 2PYOA 3AV1C 3UT9B 5G49A 3AZNC 4KGCA 3X1UC 3AZIB 5DNMB 3AN2C 1P3IB 5CPJA 1H3OA 3VH6A 1TZYB 5GXQD 3REHC 3LELD 2HUEC 3MGSD 5B31D 3AZGC 3NQUA 3AZHA 5B0YC
chains in the Genus database with same CATH superfamily
1KX4A 5BT1D 1P3KB 5BNXA 1F66D 3C1CA 3UTBD 5B2JD 3AZMD 3W96C 3REJC 3R45A 3AZJA 2Y2OA 3C1BB 2XD5A 3B0DB 4WU8D 1U35B 5AVCB 2NQBA 3WA9A 4ZUXA 4Z5TC 1M18A 4KUDB 4XZQD 3MGRB 4H9SC 1ULYA 5B2IA 3LJAD 2FJ7C 3AZIC 5BNVA 1M1AC 2JCHA 5DNMC 1P3IC 5AV6A 3AZEC 1R4VA 5AV5C 2VQRA 2HIOC 1P3FA 3NQJA 4Z66C 5FUGA 3WAAD 4UPKA 3AZLB 4ZBJB 5CPIB 4YM6D 1P3BD 5GT0C 1N1JB 3C1BC 1AOID 4H9RA 5CPKB 4X23B 3AV1D 1U35C 5AVCC 5B0ZA 5GSUB 3AZND 3X1UD 5AVBB 3AFAA 3WKJB 4UUZB 5B2JA 3B6GC 3MVDB 3O62C 5B24B 1WWSA 3IP4C 3AZGD 5BS7C 4XZQA 4WU9D 5GT3A 4M6BA 3LJAA 3AZLC 4ZBJC 4DRAA 5KDMB 2RVQC 5B1LB 3AZKB 4NFTA 4X23C 3UT9D 3FDDA 5GSUC 3WKJC 3A6NC 5AV9A 2F8NB 4J8XB 1P3GA 3W97B 1P3ID 4YM6A 1TZYD 3MVDC 5B24C 3TU4A 1KX4C 3AYWB 4WV4B 1PZRA 4EO5C 5AV8B 3EPKA 4H9NA 1P3KD 2DQNC 3AL0C 3MNNA 2CV5D 2Y2QA 1S32B 1P34A 2YFWB 5B1LC 4WU9A 1HQ3A 3AZKC 4KUDD 3EPHA 3MGRD 3B6FC 3X1TD 4AWLB 3UTAA 4J8XC 3W97C 4DQYB 4H9OB 1ZLAB 4CSRB 4G92C 3REIB 1EQZB 3AYWC 1P3OA 1B6WA 5AV8C 3AV2A 1P3PB 3A1IA 4CAYB 5DNNB 3REKA 1ID3C 2HUEB 3LZ1B 3AZLD 5CPID 4J8VA 3WTPE 5JA4A 5B0YB 3X1VB 5CPKD 4G91C 4X23D 5CP6B 1A7WA 2AROB 5GSUD 3REJB 3AZFA 3W96B 1KX5A 5AVBD 3WKJD 3MVDD 1HTAA 5B24D 2CV5A 5JRGA 5GT3C 1P3MA 2LY8A 5F99A 2FJ7B 1EQZC 3REIC 4KUDA 1M1AB 3MGRA 4JJNB 3AZEB 3X1TA 5AV5B 4YS3A 1P3PC 5DNNC 4Z2MH 2HIOB 3LZ1C 3B0BA 4R8PA 3RELB 3WTPA 4Z66B 1KX3A 3MGPB 3P5JB 3AZKD 5B33A 5B1MA 3X1VC 1P3GC 2W8SA 5CP6C 2AROC 4HGAC 5GT0B 2NZDA 4E45A 2F8ND 3W97D 4LD9C 3W98A 4WNNA 2Y2JA 4E44A 5B32B 3VH5A 1P3AB 5BO0A 5CPKA 2BYKB 4QLCB 4NE6A 3AYWD 5E5AA 3B6GB 3X1SA 3KXBA 3KWQC 5AY8B 5B40B 3O62B 3MNNC 4JJNC 1P3LA 3MGQB 2Y2MA 2JE5A 3F6TA 3KUYB 1S32D 1M19B 3RELC 3LZ0B 3MGPC 1BFMA 3UTAC 5GXQA 2PYOB 1JFIA 5G49B 3LELA 3MGSA 4KGCB 1ZLAD 5B31A 3W99A 5CPJB 1H3OB 1P3OC 5B32C 1P3AC 1EQZD 3A6NB 3REID 3REKC 4QLCC 3AN2D 1F66A 3UTBA 3REHD 3AZMA 2Y2HA 5AY8C 5B40C 1P3PD 4XUJC 5DNND 3W99B 4WU8A 1KX4B 5B31G 4EO5B 5BNXB 3C1CB 3MGQC 2FFFB 3AZFC 3AZJB 5B0YD 3KUYC 1M19C 3VH6W 3LZ0C 5CP6D 4J8UC 3WA9B 3REJD 3W96D 4J8WC 1M18B 3B0CW 2PYOC 5B2IB 4Z5TD 4KGCC 5BNVB 4H9QA 5CPJC 5AV6B 3B6FB 2FJ7D 3AZID 3EPLA 3WAAA 1M1AD 5DNMD 1P3FB 3NQJB 2Y2IA 1P3BA 4JJND 3AZED 1BH8A 5AV5D 2BYMA 2Y2GA 4G92B 3W99C 2HIOD 2YFVA 1BH9B 3AZHC 1AOIA 1Q9CA 5B33C 3AV1A 1ZLAA 3RELD 3H0MC 4Z66D 3C1CC 3AZNA 4KHAA 3X1UA 3MGPD 3AZJC 2NZDC 3AN2A 1ID3B 3REHA 4H9RB 2ZY2A 3WA9C 2NQBC 3A1KA 4ZUXC 5B0ZB 4CAYA 5GT0D 3C1BD 3AFAB 1M18C 4G91B 4Z2MG 2Y2LA 5E5AC 5B2IC 2ZY5A 5B32D 5AVCD 3AZGA 1U35D 1P3AD 1TAFA 3VH6T 3B6GD 5AV6C 3REJA 2IO5C 5AY8D 5B40D 3O62D 4XZQB 1P3FC 3V9RA 3B0CT 5GT3B 2G5IC 4Z5TA 3MGQD 3LJAB 4H9SA 3UT9A 2F8NH 1F1EA 2FJ7A 3AZIA 5DNMA 3MGSC 1P3IA 1TZYA 2PYOD 5AV5A 5B0ZC 2RVQD 4KGCD 3AFAC 5AV9B 1P3GB 5CPJD 4Z66A 5B2JC 4HGAB 3A6ND 3TU4B 1P3KA 4LD9B 4WU8C 3C1BA 3W99D 4XZQC 1KX4D 1U35A 5AVCA 3C1CD 3KWQB 3LJAC 3AZJD 3MNNB 1P34B 3O62A 2BG1A 4WU9B 1HQ3B 1M18D 5B2ID 5BS7A 5B1LD 3UTAB 5AV9C 4YM6C 1P3BC 5AV6D 3B6FD 3TU4C 4J8XD 3AZLA 5CPIA 1P3FD 5CHLB 2G5HC 1P3OB 3AV2B 1N1JA 4H9PB 3REKB 4X23A 4J8VB 5AV8D 2F2AC 5GSUA 5JA4B 5AVBA 3A6NA 4XUJB 3WKJA 1ID3D 4UUZA 3MVDA 1P34C 5B0ZD 5B24A 3AZFB 1KX5B 1Z2CB 1HQ3C 3AFAD 4WU9C 4J8UB 2JSSA 4J8WB 2CV5B 5JRGB 1P3MB 5F99B 3UT9C 5GT3D 3AV2C 5KDMA 5B1LA 3X1TB 4YS3B 3AZKA 1TZYC 4J8VC 4R8PB 1KX3B 3B6FA 3WTPB 2Y2NA 3NQUB 2F8NA 4J8XA 3W97A 3AZHB 2ZY4A 3LZ1D 5B33B 2DF4C 5B1MB 3R45B 1KX5C 1BH9A 2NZDB 5AV9D 3AYWA 3X1VD 1P3GD 1P3KC 3W98B 4WNNB 5AV8A 2AROD 2NQBB 4ZUXB 2F8NG 5BO0B 3TU4D 1ID3A 4LD9D 3B0DC 2CV5C 5JRGC 5E5AB 1P3MC 5F99C 3X1SB 3KXBB 4KUDC 3H0LC 2RIQA 3MGRC 2YFWA 1S32A 3KWQD 2IO5B 3X1TC 5C3IB 4YS3C 1P3LB 1B67A 3MNND 3H0RC 4R8PC 1KX3C 1P34D 3WTPC 3EG5B 3VH5W 5FUGB 4H9OA 1HQ3D 5B1MC 4CSRA 1T3UA 5GXQB 1EQZA 3REIA 1JFIB 3LELB 3UTAD 3MGSB 5CPIC 3W98C 1KU5A 5B31B 1P3PA 5DNNA 3LZ1A 5CPKC 1F66B 3UTBB 1P3OD 5B2JB 3AZMB 3X1SC 3KXBC 3AV2D 2CWEA 2Y2PA 5B0YA 5AVBC 2J8PA 3REKD 3X1VA 4QLCD 4WU8B 5CP6A 2AROA 4J8VD 3W96A 1P3LC 5C3IC 4XUJD 2UWXA 4LD9A 3AZFD 1KX5D 2L5AA 3KUYD 2ZM5A 1M19D 5GXQC 3LZ0D 3KWQA 4J8UD 1M1AA 3LELC 4J8WD 5JRGD 5B31C 4H9QB 4JJNA 3AZEA 4NE3A 1P3MD 5F99D 3VH5T 2HIOA 2F8NK 3WAAB 5BT1C 1F66C 3RELA 3UTBC 4YM6B 3AZMC 1P3BB 3MGPA 4WJ3C 1BH8B 2Y2KA 4YS3D 2BYMB 1AOIB 2YFVB 1W2EA 3AV1B 4R8PD 1KX3D 3WTPD 5GT0A 4H9NB 3AZNB 4KHAB 3X1UB 3AZHD 5B33D 3AN2B 5B1MD 3REHB 5B32A 1P3AA 2XD1A 4H9PA 2NZDD 2BYKA 4QLCA 3B6GA 4WZSB 3W98D 5AY8A 3AZGB 2NQBD 3WA9D 5B40A 4ZUXD 4XUJA 1TAFB 1S32C 5B32G 4NE5A 5E5AD 3MGQA 3X1SD 3KXBD 3KSYA 3WAAC 3KUYA 4DRBA 1M19A 3V9RB 3LZ0A 1WWIA 4J8UA 4AWLC 1P3LD 4Z5TB 1AOIC 4J8WA 2ZY3A 1ZLAC 2PYOA 3AV1C 3UT9B 5G49A 3AZNC 4KGCA 3X1UC 3AZIB 5DNMB 3AN2C 1P3IB 5CPJA 1H3OA 3VH6A 5GXQD 1TZYB 3EPJA 3REHC 3LELD 2HUEC 3MGSD 5B31D 3AZGC 3KFUG 3NQUA 3AZHA 5B0YC
chains in the Genus database with same CATH topology
1KX4A 5BT1D 1P3KB 5BNXA 1F66D 3C1CA 3UTBD 5B2JD 3AZMD 3W96C 3REJC 3R45A 3AZJA 2Y2OA 3C1BB 2XD5A 3B0DB 4WU8D 1U35B 5AVCB 2NQBA 3WA9A 4ZUXA 4Z5TC 1M18A 4KUDB 4XZQD 3MGRB 4H9SC 1ULYA 5B2IA 3LJAD 2FJ7C 3AZIC 5BNVA 1M1AC 2JCHA 5DNMC 1P3IC 5AV6A 3AZEC 1R4VA 5AV5C 2VQRA 2HIOC 1P3FA 3NQJA 4Z66C 5FUGA 3WAAD 4UPKA 3AZLB 4ZBJB 5CPIB 4YM6D 1P3BD 5GT0C 1N1JB 3C1BC 1AOID 4H9RA 5CPKB 4X23B 3AV1D 1U35C 5AVCC 5B0ZA 5GSUB 3AZND 3X1UD 5AVBB 3AFAA 3WKJB 4UUZB 5B2JA 3B6GC 3MVDB 3O62C 5B24B 1WWSA 3IP4C 3AZGD 5BS7C 4XZQA 4WU9D 5GT3A 4M6BA 3LJAA 3AZLC 4ZBJC 4DRAA 5KDMB 2RVQC 5B1LB 3AZKB 4NFTA 4X23C 3UT9D 3FDDA 5GSUC 3WKJC 3A6NC 5AV9A 2F8NB 4J8XB 1P3GA 3W97B 1P3ID 4YM6A 1TZYD 3MVDC 5B24C 3TU4A 1KX4C 3AYWB 4WV4B 1PZRA 4EO5C 5AV8B 3EPKA 4H9NA 1P3KD 2DQNC 3AL0C 3MNNA 2CV5D 2Y2QA 1S32B 1P34A 2YFWB 5B1LC 4WU9A 1HQ3A 3AZKC 4KUDD 3EPHA 3MGRD 3B6FC 3X1TD 4AWLB 3UTAA 4J8XC 3W97C 4DQYB 4H9OB 1ZLAB 4CSRB 4G92C 3REIB 1EQZB 3AYWC 1P3OA 1B6WA 5AV8C 3AV2A 1P3PB 3A1IA 4CAYB 5DNNB 3REKA 1ID3C 2HUEB 3LZ1B 3AZLD 5CPID 4J8VA 3WTPE 5JA4A 5B0YB 3X1VB 5CPKD 4G91C 4X23D 5CP6B 1A7WA 2AROB 5GSUD 3REJB 3AZFA 3W96B 1KX5A 5AVBD 3WKJD 3MVDD 1HTAA 5B24D 2CV5A 5JRGA 5GT3C 1P3MA 2LY8A 5F99A 2FJ7B 1EQZC 3REIC 4KUDA 1M1AB 3MGRA 4JJNB 3AZEB 3X1TA 5AV5B 4YS3A 1P3PC 5DNNC 4Z2MH 2HIOB 3LZ1C 3B0BA 4R8PA 3RELB 3WTPA 4Z66B 1KX3A 3MGPB 3P5JB 3AZKD 5B33A 5B1MA 3X1VC 1P3GC 2W8SA 5CP6C 2AROC 4HGAC 5GT0B 2NZDA 4E45A 2F8ND 3W97D 4LD9C 3W98A 4WNNA 2Y2JA 4E44A 5B32B 3VH5A 1P3AB 5BO0A 5CPKA 2BYKB 4QLCB 4NE6A 3AYWD 5E5AA 3B6GB 3X1SA 3KXBA 3KWQC 5AY8B 5B40B 3O62B 3MNNC 4JJNC 1P3LA 3MGQB 2Y2MA 2JE5A 3F6TA 3KUYB 1S32D 1M19B 3RELC 3LZ0B 3MGPC 1BFMA 3UTAC 5GXQA 2PYOB 1JFIA 5G49B 3LELA 3MGSA 4KGCB 1ZLAD 5B31A 3W99A 5CPJB 1H3OB 1P3OC 5B32C 1P3AC 1EQZD 3A6NB 3REID 3REKC 4QLCC 3AN2D 1F66A 3UTBA 3REHD 3AZMA 2Y2HA 5AY8C 5B40C 1P3PD 4XUJC 5DNND 3W99B 4WU8A 1KX4B 5B31G 4EO5B 5BNXB 3C1CB 3MGQC 2FFFB 3AZFC 3AZJB 5B0YD 3KUYC 1M19C 3VH6W 3LZ0C 5CP6D 4J8UC 3WA9B 3REJD 3W96D 4J8WC 1M18B 3B0CW 2PYOC 5B2IB 4Z5TD 4KGCC 5BNVB 4H9QA 5CPJC 5AV6B 3B6FB 2FJ7D 3AZID 3EPLA 3WAAA 1M1AD 5DNMD 1P3FB 3NQJB 2Y2IA 1P3BA 4JJND 3AZED 1BH8A 5AV5D 2BYMA 2Y2GA 4G92B 3W99C 2HIOD 2YFVA 1BH9B 3AZHC 1AOIA 1Q9CA 5B33C 3AV1A 1ZLAA 3RELD 3H0MC 4Z66D 3C1CC 3AZNA 4KHAA 3X1UA 3MGPD 3AZJC 2NZDC 3AN2A 1ID3B 3REHA 4H9RB 2ZY2A 3WA9C 2NQBC 3A1KA 4ZUXC 5B0ZB 4CAYA 5GT0D 3C1BD 3AFAB 1M18C 4G91B 4Z2MG 2Y2LA 5E5AC 5B2IC 2ZY5A 5B32D 5AVCD 3AZGA 1U35D 1P3AD 1TAFA 3VH6T 3B6GD 5AV6C 3REJA 2IO5C 5AY8D 5B40D 3O62D 4XZQB 1P3FC 3V9RA 3B0CT 5GT3B 2G5IC 4Z5TA 3MGQD 3LJAB 4H9SA 3UT9A 2F8NH 1F1EA 2FJ7A 3AZIA 5DNMA 3MGSC 1P3IA 1TZYA 2PYOD 5AV5A 5B0ZC 2RVQD 4KGCD 3AFAC 5AV9B 1P3GB 5CPJD 4Z66A 5B2JC 4HGAB 3A6ND 3TU4B 1P3KA 4LD9B 4WU8C 3C1BA 3W99D 4XZQC 1KX4D 1U35A 5AVCA 3C1CD 3KWQB 3LJAC 3AZJD 3MNNB 1P34B 3O62A 2BG1A 4WU9B 1HQ3B 1M18D 5B2ID 5BS7A 5B1LD 3UTAB 5AV9C 4YM6C 1P3BC 5AV6D 3B6FD 3TU4C 4J8XD 3AZLA 5CPIA 1P3FD 5CHLB 2G5HC 1P3OB 3AV2B 1N1JA 4H9PB 3REKB 4X23A 4J8VB 5AV8D 2F2AC 5GSUA 5JA4B 5AVBA 3A6NA 4XUJB 3WKJA 1ID3D 4UUZA 3MVDA 1P34C 5B0ZD 5B24A 3AZFB 1KX5B 1Z2CB 1HQ3C 3AFAD 4WU9C 4J8UB 2JSSA 4J8WB 2CV5B 5JRGB 1P3MB 5F99B 3UT9C 5GT3D 3AV2C 5KDMA 5B1LA 3X1TB 4YS3B 3AZKA 1TZYC 4J8VC 4R8PB 1KX3B 3B6FA 3WTPB 2Y2NA 3NQUB 2F8NA 4J8XA 3W97A 3AZHB 2ZY4A 3LZ1D 5B33B 2DF4C 5B1MB 3R45B 1KX5C 1BH9A 2NZDB 5AV9D 3AYWA 3X1VD 1P3GD 1P3KC 3W98B 4WNNB 5AV8A 2AROD 2NQBB 4ZUXB 2F8NG 5BO0B 3TU4D 1ID3A 4LD9D 3B0DC 2CV5C 5JRGC 5E5AB 1P3MC 5F99C 3X1SB 3KXBB 4KUDC 3H0LC 2RIQA 3MGRC 2YFWA 1S32A 3KWQD 2IO5B 3X1TC 5C3IB 4YS3C 1P3LB 1B67A 3MNND 3H0RC 4R8PC 1KX3C 1P34D 3WTPC 3EG5B 3VH5W 5FUGB 4H9OA 1HQ3D 5B1MC 4CSRA 1T3UA 5GXQB 1EQZA 3REIA 1JFIB 3LELB 3UTAD 3MGSB 5CPIC 3W98C 1KU5A 5B31B 1P3PA 5DNNA 3LZ1A 5CPKC 1F66B 3UTBB 1P3OD 5B2JB 3AZMB 3X1SC 3KXBC 3AV2D 2CWEA 2Y2PA 5B0YA 5AVBC 2J8PA 3REKD 3X1VA 4QLCD 4WU8B 5CP6A 2AROA 4J8VD 3W96A 1P3LC 5C3IC 4XUJD 2UWXA 4LD9A 3AZFD 1KX5D 2L5AA 3KUYD 2ZM5A 1M19D 5GXQC 3LZ0D 3KWQA 4J8UD 1M1AA 3LELC 4J8WD 5JRGD 5B31C 4H9QB 4JJNA 3AZEA 4NE3A 1P3MD 5F99D 3VH5T 2HIOA 2F8NK 3WAAB 5BT1C 1F66C 3RELA 3UTBC 4YM6B 3AZMC 1P3BB 3MGPA 4WJ3C 1BH8B 2Y2KA 4YS3D 2BYMB 1AOIB 2YFVB 1W2EA 3AV1B 4R8PD 1KX3D 3WTPD 5GT0A 4H9NB 3AZNB 4KHAB 3X1UB 3AZHD 5B33D 3AN2B 5B1MD 3REHB 5B32A 1P3AA 2XD1A 4H9PA 2NZDD 2BYKA 4QLCA 3B6GA 4WZSB 3W98D 5AY8A 3AZGB 2NQBD 3WA9D 5B40A 4ZUXD 4XUJA 1TAFB 1S32C 5B32G 4NE5A 5E5AD 3MGQA 3X1SD 3KXBD 3KSYA 3WAAC 3KUYA 4DRBA 1M19A 3V9RB 3LZ0A 1WWIA 4J8UA 4AWLC 1P3LD 4Z5TB 1AOIC 4J8WA 2ZY3A 1ZLAC 2PYOA 3AV1C 3UT9B 5G49A 3AZNC 4KGCA 3X1UC 3AZIB 5DNMB 3AN2C 1P3IB 5CPJA 1H3OA 3VH6A 5GXQD 1TZYB 3EPJA 3REHC 3LELD 2HUEC 3MGSD 5B31D 3AZGC 3KFUG 3NQUA 3AZHA 5B0YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX4 A;  5BT1 D;  1P3K B;  5BNX A;  1F66 D;  3C1C A;  3UTB D;  5B2J D;  3AZM D;  3W96 C;  3REJ C;  3R45 A;  3AZJ A;  3C1B B;  3B0D B;  4WU8 D;  1U35 B;  5AVC B;  2NQB A;  3WA9 A;  4ZUX A;  4Z5T C;  1M18 A;  4KUD B;  4XZQ D;  3MGR B;  4H9S C;  1ULY A;  5B2I A;  3LJA D;  2FJ7 C;  3AZI C;  5BNV A;  1M1A C;  5DNM C;  1P3I C;  5AV6 A;  3AZE C;  1R4V A;  5AV5 C;  2HIO C;  1P3F A;  3NQJ A;  4Z66 C;  5FUG A;  3WAA D;  3AZL B;  4ZBJ B;  5CPI B;  4YM6 D;  1P3B D;  5GT0 C;  1N1J B;  3C1B C;  1AOI D;  4H9R A;  5CPK B;  4X23 B;  3AV1 D;  1U35 C;  5AVC C;  5B0Z A;  5GSU B;  3AZN D;  3X1U D;  5AVB B;  3AFA A;  3WKJ B;  4UUZ B;  5B2J A;  3B6G C;  3MVD B;  3O62 C;  5B24 B;  1WWS A;  3AZG D;  5BS7 C;  4XZQ A;  4WU9 D;  5GT3 A;  4M6B A;  3LJA A;  3AZL C;  4ZBJ C;  4DRA A;  5KDM B;  2RVQ C;  5B1L B;  3AZK B;  4NFT A;  4X23 C;  3UT9 D;  5GSU C;  3WKJ C;  3A6N C;  5AV9 A;  2F8N B;  4J8X B;  1P3G A;  3W97 B;  1P3I D;  4YM6 A;  1TZY D;  3MVD C;  5B24 C;  3TU4 A;  1KX4 C;  3AYW B;  4WV4 B;  4EO5 C;  5AV8 B;  4H9N A;  1P3K D;  3MNN A;  2CV5 D;  1S32 B;  1P34 A;  2YFW B;  5B1L C;  4WU9 A;  1HQ3 A;  3AZK C;  4KUD D;  3MGR D;  3B6F C;  3X1T D;  4AWL B;  3UTA A;  4J8X C;  3W97 C;  4H9O B;  1ZLA B;  4CSR B;  4G92 C;  3REI B;  1EQZ B;  3AYW C;  1P3O A;  1B6W A;  5AV8 C;  3AV2 A;  1P3P B;  4CAY B;  5DNN B;  3REK A;  1ID3 C;  2HUE B;  3LZ1 B;  3AZL D;  5CPI D;  4J8V A;  3WTP E;  5JA4 A;  5B0Y B;  3X1V B;  5CPK D;  4G91 C;  4X23 D;  5CP6 B;  1A7W A;  2ARO B;  5GSU D;  3REJ B;  3AZF A;  3W96 B;  1KX5 A;  5AVB D;  3WKJ D;  3MVD D;  1HTA A;  5B24 D;  2CV5 A;  5JRG A;  5GT3 C;  1P3M A;  2LY8 A;  5F99 A;  2FJ7 B;  1EQZ C;  3REI C;  4KUD A;  1M1A B;  3MGR A;  4JJN B;  3AZE B;  3X1T A;  5AV5 B;  4YS3 A;  1P3P C;  5DNN C;  4Z2M H;  2HIO B;  3LZ1 C;  3B0B A;  4R8P A;  3REL B;  3WTP A;  4Z66 B;  1KX3 A;  3MGP B;  3AZK D;  5B33 A;  5B1M A;  3X1V C;  1P3G C;  5CP6 C;  2ARO C;  4HGA C;  5GT0 B;  2NZD A;  4E45 A;  2F8N D;  3W97 D;  4LD9 C;  3W98 A;  4WNN A;  4E44 A;  5B32 B;  3VH5 A;  1P3A B;  5BO0 A;  5CPK A;  2BYK B;  4QLC B;  4NE6 A;  3AYW D;  5E5A A;  3B6G B;  3X1S A;  3KXB A;  3KWQ C;  5AY8 B;  5B40 B;  3O62 B;  3MNN C;  4JJN C;  1P3L A;  3MGQ B;  3KUY B;  1M19 B;  1S32 D;  3REL C;  3LZ0 B;  3MGP C;  1BFM A;  3UTA C;  5GXQ A;  2PYO B;  1JFI A;  5G49 B;  3LEL A;  3MGS A;  4KGC B;  1ZLA D;  5B31 A;  3W99 A;  5CPJ B;  1H3O B;  1P3O C;  5B32 C;  1P3A C;  1EQZ D;  3A6N B;  3REI D;  3REK C;  4QLC C;  3AN2 D;  1F66 A;  3UTB A;  3REH D;  3AZM A;  5AY8 C;  5B40 C;  1P3P D;  4XUJ C;  5DNN D;  3W99 B;  4WU8 A;  1KX4 B;  5B31 G;  4EO5 B;  5BNX B;  3C1C B;  3MGQ C;  3AZF C;  3AZJ B;  5B0Y D;  3KUY C;  1M19 C;  3VH6 W;  3LZ0 C;  5CP6 D;  4J8U C;  3WA9 B;  3REJ D;  3W96 D;  4J8W C;  1M18 B;  3B0C W;  2PYO C;  5B2I B;  4Z5T D;  4KGC C;  5BNV B;  4H9Q A;  5CPJ C;  5AV6 B;  3B6F B;  2FJ7 D;  3AZI D;  3WAA A;  1M1A D;  5DNM D;  1P3F B;  3NQJ B;  1P3B A;  4JJN D;  3AZE D;  1BH8 A;  5AV5 D;  2BYM A;  1AOI A;  4G92 B;  3W99 C;  2HIO D;  2YFV A;  1BH9 B;  3AZH C;  1ZLA A;  1Q9C A;  5B33 C;  3AV1 A;  3REL D;  4Z66 D;  3C1C C;  3AZN A;  4KHA A;  3X1U A;  3MGP D;  3AZJ C;  2NZD C;  3AN2 A;  1ID3 B;  3REH A;  4H9R B;  3WA9 C;  2NQB C;  4ZUX C;  5B0Z B;  4CAY A;  5GT0 D;  3C1B D;  3AFA B;  1M18 C;  4G91 B;  4Z2M G;  5E5A C;  5AVC D;  5B2I C;  5B32 D;  3AZG A;  1U35 D;  1P3A D;  1TAF A;  3VH6 T;  3B6G D;  5AV6 C;  3REJ A;  2IO5 C;  5AY8 D;  5B40 D;  3O62 D;  4XZQ B;  1P3F C;  3V9R A;  3B0C T;  5GT3 B;  4Z5T A;  3MGQ D;  3LJA B;  4H9S A;  3UT9 A;  2F8N H;  1F1E A;  2FJ7 A;  3AZI A;  5DNM A;  3MGS C;  1P3I A;  1TZY A;  2PYO D;  5AV5 A;  5B0Z C;  2RVQ D;  4KGC D;  3AFA C;  5AV9 B;  1P3G B;  5CPJ D;  4Z66 A;  5B2J C;  4HGA B;  3A6N D;  3TU4 B;  1P3K A;  4LD9 B;  4WU8 C;  3C1B A;  3W99 D;  4XZQ C;  1KX4 D;  1U35 A;  5AVC A;  3C1C D;  3KWQ B;  3LJA C;  3AZJ D;  3MNN B;  1P34 B;  3O62 A;  4WU9 B;  1HQ3 B;  1M18 D;  5B2I D;  5BS7 A;  5B1L D;  3UTA B;  5AV9 C;  4YM6 C;  1P3B C;  5AV6 D;  3B6F D;  3TU4 C;  4J8X D;  3AZL A;  5CPI A;  1P3F D;  5CHL B;  1P3O B;  3AV2 B;  1N1J A;  4H9P B;  3REK B;  4X23 A;  4J8V B;  5AV8 D;  5GSU A;  5JA4 B;  5AVB A;  3A6N A;  4XUJ B;  3WKJ A;  1ID3 D;  4UUZ A;  3MVD A;  1P34 C;  5B0Z D;  5B24 A;  3AZF B;  1KX5 B;  4WU9 C;  1HQ3 C;  3AFA D;  4J8U B;  2JSS A;  4J8W B;  2CV5 B;  5JRG B;  1P3M B;  5F99 B;  3UT9 C;  5GT3 D;  3AV2 C;  5KDM A;  5B1L A;  3X1T B;  4YS3 B;  3AZK A;  1TZY C;  4J8V C;  4R8P B;  1KX3 B;  3B6F A;  3WTP B;  3NQU B;  2F8N A;  4J8X A;  3W97 A;  3AZH B;  3LZ1 D;  5B33 B;  5B1M B;  3R45 B;  1KX5 C;  1BH9 A;  2NZD B;  5AV9 D;  3AYW A;  3X1V D;  1P3G D;  1P3K C;  3W98 B;  4WNN B;  5AV8 A;  2ARO D;  2NQB B;  4ZUX B;  2F8N G;  5BO0 B;  3TU4 D;  1ID3 A;  4LD9 D;  3B0D C;  2CV5 C;  5JRG C;  5E5A B;  1P3M C;  5F99 C;  3X1S B;  3KXB B;  4KUD C;  3MGR C;  1S32 A;  2YFW A;  3KWQ D;  2IO5 B;  3X1T C;  5C3I B;  4YS3 C;  1P3L B;  1B67 A;  3MNN D;  4R8P C;  1KX3 C;  1P34 D;  3WTP C;  3VH5 W;  5FUG B;  4H9O A;  1HQ3 D;  5B1M C;  4CSR A;  5GXQ B;  1EQZ A;  3REI A;  1JFI B;  3LEL B;  3UTA D;  3MGS B;  5CPI C;  3W98 C;  1KU5 A;  5B31 B;  1P3P A;  5DNN A;  3LZ1 A;  5CPK C;  1F66 B;  3UTB B;  1P3O D;  5B2J B;  3AZM B;  3X1S C;  3KXB C;  3AV2 D;  2CWE A;  5B0Y A;  5AVB C;  3REK D;  3X1V A;  4QLC D;  4WU8 B;  5CP6 A;  2ARO A;  4J8V D;  3W96 A;  1P3L C;  5C3I C;  4XUJ D;  4LD9 A;  3AZF D;  1KX5 D;  2L5A A;  3KUY D;  1M19 D;  5GXQ C;  3LZ0 D;  3KWQ A;  4J8U D;  1M1A A;  3LEL C;  4J8W D;  5JRG D;  5B31 C;  4H9Q B;  4JJN A;  3AZE A;  4NE3 A;  1P3M D;  5F99 D;  3VH5 T;  2HIO A;  2F8N K;  3WAA B;  5BT1 C;  1F66 C;  3REL A;  3UTB C;  4YM6 B;  3AZM C;  1P3B B;  3MGP A;  1BH8 B;  4YS3 D;  2BYM B;  1AOI B;  2YFV B;  3AV1 B;  4R8P D;  1KX3 D;  3WTP D;  5GT0 A;  4H9N B;  3AZN B;  4KHA B;  3X1U B;  3AZH D;  5B33 D;  3AN2 B;  5B1M D;  3REH B;  5B32 A;  1P3A A;  4H9P A;  2NZD D;  2BYK A;  4QLC A;  3B6G A;  4WZS B;  3W98 D;  5AY8 A;  3AZG B;  2NQB D;  3WA9 D;  5B40 A;  4ZUX D;  4XUJ A;  1TAF B;  1S32 C;  5B32 G;  4NE5 A;  5E5A D;  3MGQ A;  3X1S D;  3KXB D;  3KSY A;  3WAA C;  3KUY A;  4DRB A;  1M19 A;  3V9R B;  3LZ0 A;  1WWI A;  4J8U A;  4AWL C;  1P3L D;  4Z5T B;  1AOI C;  4J8W A;  1ZLA C;  2PYO A;  3AV1 C;  3UT9 B;  5G49 A;  3AZN C;  4KGC A;  3X1U C;  3AZI B;  5DNM B;  3AN2 C;  1P3I B;  5CPJ A;  1H3O A;  3VH6 A;  1TZY B;  5GXQ D;  3REH C;  3LEL D;  2HUE C;  3MGS D;  5B31 D;  3AZG C;  3NQU A;  3AZH A;  5B0Y C; 
#chains in the Genus database with same CATH topology
 1KX4 A;  5BT1 D;  1P3K B;  5BNX A;  1F66 D;  3C1C A;  3UTB D;  5B2J D;  3AZM D;  3W96 C;  3REJ C;  3R45 A;  3AZJ A;  2Y2O A;  3C1B B;  2XD5 A;  3B0D B;  4WU8 D;  1U35 B;  5AVC B;  2NQB A;  3WA9 A;  4ZUX A;  4Z5T C;  1M18 A;  4KUD B;  4XZQ D;  3MGR B;  4H9S C;  1ULY A;  5B2I A;  3LJA D;  2FJ7 C;  3AZI C;  5BNV A;  1M1A C;  2JCH A;  5DNM C;  1P3I C;  5AV6 A;  3AZE C;  1R4V A;  5AV5 C;  2VQR A;  2HIO C;  1P3F A;  3NQJ A;  4Z66 C;  5FUG A;  3WAA D;  4UPK A;  3AZL B;  4ZBJ B;  5CPI B;  4YM6 D;  1P3B D;  5GT0 C;  1N1J B;  3C1B C;  1AOI D;  4H9R A;  5CPK B;  4X23 B;  3AV1 D;  1U35 C;  5AVC C;  5B0Z A;  5GSU B;  3AZN D;  3X1U D;  5AVB B;  3AFA A;  3WKJ B;  4UUZ B;  5B2J A;  3B6G C;  3MVD B;  3O62 C;  5B24 B;  1WWS A;  3IP4 C;  3AZG D;  5BS7 C;  4XZQ A;  4WU9 D;  5GT3 A;  4M6B A;  3LJA A;  3AZL C;  4ZBJ C;  4DRA A;  5KDM B;  2RVQ C;  5B1L B;  3AZK B;  4NFT A;  4X23 C;  3UT9 D;  3FDD A;  5GSU C;  3WKJ C;  3A6N C;  5AV9 A;  2F8N B;  4J8X B;  1P3G A;  3W97 B;  1P3I D;  4YM6 A;  1TZY D;  3MVD C;  5B24 C;  3TU4 A;  1KX4 C;  3AYW B;  4WV4 B;  1PZR A;  4EO5 C;  5AV8 B;  3EPK A;  4H9N A;  1P3K D;  2DQN C;  3AL0 C;  3MNN A;  2CV5 D;  2Y2Q A;  1S32 B;  1P34 A;  2YFW B;  5B1L C;  4WU9 A;  1HQ3 A;  3AZK C;  4KUD D;  3EPH A;  3MGR D;  3B6F C;  3X1T D;  4AWL B;  3UTA A;  4J8X C;  3W97 C;  4DQY B;  4H9O B;  1ZLA B;  4CSR B;  4G92 C;  3REI B;  1EQZ B;  3AYW C;  1P3O A;  1B6W A;  5AV8 C;  3AV2 A;  1P3P B;  3A1I A;  4CAY B;  5DNN B;  3REK A;  1ID3 C;  2HUE B;  3LZ1 B;  3AZL D;  5CPI D;  4J8V A;  3WTP E;  5JA4 A;  5B0Y B;  3X1V B;  5CPK D;  4G91 C;  4X23 D;  5CP6 B;  1A7W A;  2ARO B;  5GSU D;  3REJ B;  3AZF A;  3W96 B;  1KX5 A;  5AVB D;  3WKJ D;  3MVD D;  1HTA A;  5B24 D;  2CV5 A;  5JRG A;  5GT3 C;  1P3M A;  2LY8 A;  5F99 A;  2FJ7 B;  1EQZ C;  3REI C;  4KUD A;  1M1A B;  3MGR A;  4JJN B;  3AZE B;  3X1T A;  5AV5 B;  4YS3 A;  1P3P C;  5DNN C;  4Z2M H;  2HIO B;  3LZ1 C;  3B0B A;  4R8P A;  3REL B;  3WTP A;  4Z66 B;  1KX3 A;  3MGP B;  3P5J B;  3AZK D;  5B33 A;  5B1M A;  3X1V C;  1P3G C;  2W8S A;  5CP6 C;  2ARO C;  4HGA C;  5GT0 B;  2NZD A;  4E45 A;  2F8N D;  3W97 D;  4LD9 C;  3W98 A;  4WNN A;  2Y2J A;  4E44 A;  5B32 B;  3VH5 A;  1P3A B;  5BO0 A;  5CPK A;  2BYK B;  4QLC B;  4NE6 A;  3AYW D;  5E5A A;  3B6G B;  3X1S A;  3KXB A;  3KWQ C;  5AY8 B;  5B40 B;  3O62 B;  3MNN C;  4JJN C;  1P3L A;  3MGQ B;  2Y2M A;  2JE5 A;  3F6T A;  3KUY B;  1S32 D;  1M19 B;  3REL C;  3LZ0 B;  3MGP C;  1BFM A;  3UTA C;  5GXQ A;  2PYO B;  1JFI A;  5G49 B;  3LEL A;  3MGS A;  4KGC B;  1ZLA D;  5B31 A;  3W99 A;  5CPJ B;  1H3O B;  1P3O C;  5B32 C;  1P3A C;  1EQZ D;  3A6N B;  3REI D;  3REK C;  4QLC C;  3AN2 D;  1F66 A;  3UTB A;  3REH D;  3AZM A;  2Y2H A;  5AY8 C;  5B40 C;  1P3P D;  4XUJ C;  5DNN D;  3W99 B;  4WU8 A;  1KX4 B;  5B31 G;  4EO5 B;  5BNX B;  3C1C B;  3MGQ C;  2FFF B;  3AZF C;  3AZJ B;  5B0Y D;  3KUY C;  1M19 C;  3VH6 W;  3LZ0 C;  5CP6 D;  4J8U C;  3WA9 B;  3REJ D;  3W96 D;  4J8W C;  1M18 B;  3B0C W;  2PYO C;  5B2I B;  4Z5T D;  4KGC C;  5BNV B;  4H9Q A;  5CPJ C;  5AV6 B;  3B6F B;  2FJ7 D;  3AZI D;  3EPL A;  3WAA A;  1M1A D;  5DNM D;  1P3F B;  3NQJ B;  2Y2I A;  1P3B A;  4JJN D;  3AZE D;  1BH8 A;  5AV5 D;  2BYM A;  2Y2G A;  4G92 B;  3W99 C;  2HIO D;  2YFV A;  1BH9 B;  3AZH C;  1AOI A;  1Q9C A;  5B33 C;  3AV1 A;  1ZLA A;  3REL D;  3H0M C;  4Z66 D;  3C1C C;  3AZN A;  4KHA A;  3X1U A;  3MGP D;  3AZJ C;  2NZD C;  3AN2 A;  1ID3 B;  3REH A;  4H9R B;  2ZY2 A;  3WA9 C;  2NQB C;  3A1K A;  4ZUX C;  5B0Z B;  4CAY A;  5GT0 D;  3C1B D;  3AFA B;  1M18 C;  4G91 B;  4Z2M G;  2Y2L A;  5E5A C;  5B2I C;  2ZY5 A;  5B32 D;  5AVC D;  3AZG A;  1U35 D;  1P3A D;  1TAF A;  3VH6 T;  3B6G D;  5AV6 C;  3REJ A;  2IO5 C;  5AY8 D;  5B40 D;  3O62 D;  4XZQ B;  1P3F C;  3V9R A;  3B0C T;  5GT3 B;  2G5I C;  4Z5T A;  3MGQ D;  3LJA B;  4H9S A;  3UT9 A;  2F8N H;  1F1E A;  2FJ7 A;  3AZI A;  5DNM A;  3MGS C;  1P3I A;  1TZY A;  2PYO D;  5AV5 A;  5B0Z C;  2RVQ D;  4KGC D;  3AFA C;  5AV9 B;  1P3G B;  5CPJ D;  4Z66 A;  5B2J C;  4HGA B;  3A6N D;  3TU4 B;  1P3K A;  4LD9 B;  4WU8 C;  3C1B A;  3W99 D;  4XZQ C;  1KX4 D;  1U35 A;  5AVC A;  3C1C D;  3KWQ B;  3LJA C;  3AZJ D;  3MNN B;  1P34 B;  3O62 A;  2BG1 A;  4WU9 B;  1HQ3 B;  1M18 D;  5B2I D;  5BS7 A;  5B1L D;  3UTA B;  5AV9 C;  4YM6 C;  1P3B C;  5AV6 D;  3B6F D;  3TU4 C;  4J8X D;  3AZL A;  5CPI A;  1P3F D;  5CHL B;  2G5H C;  1P3O B;  3AV2 B;  1N1J A;  4H9P B;  3REK B;  4X23 A;  4J8V B;  5AV8 D;  2F2A C;  5GSU A;  5JA4 B;  5AVB A;  3A6N A;  4XUJ B;  3WKJ A;  1ID3 D;  4UUZ A;  3MVD A;  1P34 C;  5B0Z D;  5B24 A;  3AZF B;  1KX5 B;  1Z2C B;  1HQ3 C;  3AFA D;  4WU9 C;  4J8U B;  2JSS A;  4J8W B;  2CV5 B;  5JRG B;  1P3M B;  5F99 B;  3UT9 C;  5GT3 D;  3AV2 C;  5KDM A;  5B1L A;  3X1T B;  4YS3 B;  3AZK A;  1TZY C;  4J8V C;  4R8P B;  1KX3 B;  3B6F A;  3WTP B;  2Y2N A;  3NQU B;  2F8N A;  4J8X A;  3W97 A;  3AZH B;  2ZY4 A;  3LZ1 D;  5B33 B;  2DF4 C;  5B1M B;  3R45 B;  1KX5 C;  1BH9 A;  2NZD B;  5AV9 D;  3AYW A;  3X1V D;  1P3G D;  1P3K C;  3W98 B;  4WNN B;  5AV8 A;  2ARO D;  2NQB B;  4ZUX B;  2F8N G;  5BO0 B;  3TU4 D;  1ID3 A;  4LD9 D;  3B0D C;  2CV5 C;  5JRG C;  5E5A B;  1P3M C;  5F99 C;  3X1S B;  3KXB B;  4KUD C;  3H0L C;  2RIQ A;  3MGR C;  2YFW A;  1S32 A;  3KWQ D;  2IO5 B;  3X1T C;  5C3I B;  4YS3 C;  1P3L B;  1B67 A;  3MNN D;  3H0R C;  4R8P C;  1KX3 C;  1P34 D;  3WTP C;  3EG5 B;  3VH5 W;  5FUG B;  4H9O A;  1HQ3 D;  5B1M C;  4CSR A;  1T3U A;  5GXQ B;  1EQZ A;  3REI A;  1JFI B;  3LEL B;  3UTA D;  3MGS B;  5CPI C;  3W98 C;  1KU5 A;  5B31 B;  1P3P A;  5DNN A;  3LZ1 A;  5CPK C;  1F66 B;  3UTB B;  1P3O D;  5B2J B;  3AZM B;  3X1S C;  3KXB C;  3AV2 D;  2CWE A;  2Y2P A;  5B0Y A;  5AVB C;  2J8P A;  3REK D;  3X1V A;  4QLC D;  4WU8 B;  5CP6 A;  2ARO A;  4J8V D;  3W96 A;  1P3L C;  5C3I C;  4XUJ D;  2UWX A;  4LD9 A;  3AZF D;  1KX5 D;  2L5A A;  3KUY D;  2ZM5 A;  1M19 D;  5GXQ C;  3LZ0 D;  3KWQ A;  4J8U D;  1M1A A;  3LEL C;  4J8W D;  5JRG D;  5B31 C;  4H9Q B;  4JJN A;  3AZE A;  4NE3 A;  1P3M D;  5F99 D;  3VH5 T;  2HIO A;  2F8N K;  3WAA B;  5BT1 C;  1F66 C;  3REL A;  3UTB C;  4YM6 B;  3AZM C;  1P3B B;  3MGP A;  4WJ3 C;  1BH8 B;  2Y2K A;  4YS3 D;  2BYM B;  1AOI B;  2YFV B;  1W2E A;  3AV1 B;  4R8P D;  1KX3 D;  3WTP D;  5GT0 A;  4H9N B;  3AZN B;  4KHA B;  3X1U B;  3AZH D;  5B33 D;  3AN2 B;  5B1M D;  3REH B;  5B32 A;  1P3A A;  2XD1 A;  4H9P A;  2NZD D;  2BYK A;  4QLC A;  3B6G A;  4WZS B;  3W98 D;  5AY8 A;  3AZG B;  2NQB D;  3WA9 D;  5B40 A;  4ZUX D;  4XUJ A;  1TAF B;  1S32 C;  5B32 G;  4NE5 A;  5E5A D;  3MGQ A;  3X1S D;  3KXB D;  3KSY A;  3WAA C;  3KUY A;  4DRB A;  1M19 A;  3V9R B;  3LZ0 A;  1WWI A;  4J8U A;  4AWL C;  1P3L D;  4Z5T B;  1AOI C;  4J8W A;  2ZY3 A;  1ZLA C;  2PYO A;  3AV1 C;  3UT9 B;  5G49 A;  3AZN C;  4KGC A;  3X1U C;  3AZI B;  5DNM B;  3AN2 C;  1P3I B;  5CPJ A;  1H3O A;  3VH6 A;  5GXQ D;  1TZY B;  3EPJ A;  3REH C;  3LEL D;  2HUE C;  3MGS D;  5B31 D;  3AZG C;  3KFU G;  3NQU A;  3AZH A;  5B0Y C; 
#chains in the Genus database with same CATH homology
 1KX4 A;  5BT1 D;  1P3K B;  5BNX A;  1F66 D;  3C1C A;  3UTB D;  5B2J D;  3AZM D;  3W96 C;  3REJ C;  3R45 A;  3AZJ A;  2Y2O A;  3C1B B;  2XD5 A;  3B0D B;  4WU8 D;  1U35 B;  5AVC B;  2NQB A;  3WA9 A;  4ZUX A;  4Z5T C;  1M18 A;  4KUD B;  4XZQ D;  3MGR B;  4H9S C;  1ULY A;  5B2I A;  3LJA D;  2FJ7 C;  3AZI C;  5BNV A;  1M1A C;  2JCH A;  5DNM C;  1P3I C;  5AV6 A;  3AZE C;  1R4V A;  5AV5 C;  2VQR A;  2HIO C;  1P3F A;  3NQJ A;  4Z66 C;  5FUG A;  3WAA D;  4UPK A;  3AZL B;  4ZBJ B;  5CPI B;  4YM6 D;  1P3B D;  5GT0 C;  1N1J B;  3C1B C;  1AOI D;  4H9R A;  5CPK B;  4X23 B;  3AV1 D;  1U35 C;  5AVC C;  5B0Z A;  5GSU B;  3AZN D;  3X1U D;  5AVB B;  3AFA A;  3WKJ B;  4UUZ B;  5B2J A;  3B6G C;  3MVD B;  3O62 C;  5B24 B;  1WWS A;  3IP4 C;  3AZG D;  5BS7 C;  4XZQ A;  4WU9 D;  5GT3 A;  4M6B A;  3LJA A;  3AZL C;  4ZBJ C;  4DRA A;  5KDM B;  2RVQ C;  5B1L B;  3AZK B;  4NFT A;  4X23 C;  3UT9 D;  3FDD A;  5GSU C;  3WKJ C;  3A6N C;  5AV9 A;  2F8N B;  4J8X B;  1P3G A;  3W97 B;  1P3I D;  4YM6 A;  1TZY D;  3MVD C;  5B24 C;  3TU4 A;  1KX4 C;  3AYW B;  4WV4 B;  1PZR A;  4EO5 C;  5AV8 B;  3EPK A;  4H9N A;  1P3K D;  2DQN C;  3AL0 C;  3MNN A;  2CV5 D;  2Y2Q A;  1S32 B;  1P34 A;  2YFW B;  5B1L C;  4WU9 A;  1HQ3 A;  3AZK C;  4KUD D;  3EPH A;  3MGR D;  3B6F C;  3X1T D;  4AWL B;  3UTA A;  4J8X C;  3W97 C;  4DQY B;  4H9O B;  1ZLA B;  4CSR B;  4G92 C;  3REI B;  1EQZ B;  3AYW C;  1P3O A;  1B6W A;  5AV8 C;  3AV2 A;  1P3P B;  3A1I A;  4CAY B;  5DNN B;  3REK A;  1ID3 C;  2HUE B;  3LZ1 B;  3AZL D;  5CPI D;  4J8V A;  3WTP E;  5JA4 A;  5B0Y B;  3X1V B;  5CPK D;  4G91 C;  4X23 D;  5CP6 B;  1A7W A;  2ARO B;  5GSU D;  3REJ B;  3AZF A;  3W96 B;  1KX5 A;  5AVB D;  3WKJ D;  3MVD D;  1HTA A;  5B24 D;  2CV5 A;  5JRG A;  5GT3 C;  1P3M A;  2LY8 A;  5F99 A;  2FJ7 B;  1EQZ C;  3REI C;  4KUD A;  1M1A B;  3MGR A;  4JJN B;  3AZE B;  3X1T A;  5AV5 B;  4YS3 A;  1P3P C;  5DNN C;  4Z2M H;  2HIO B;  3LZ1 C;  3B0B A;  4R8P A;  3REL B;  3WTP A;  4Z66 B;  1KX3 A;  3MGP B;  3P5J B;  3AZK D;  5B33 A;  5B1M A;  3X1V C;  1P3G C;  2W8S A;  5CP6 C;  2ARO C;  4HGA C;  5GT0 B;  2NZD A;  4E45 A;  2F8N D;  3W97 D;  4LD9 C;  3W98 A;  4WNN A;  2Y2J A;  4E44 A;  5B32 B;  3VH5 A;  1P3A B;  5BO0 A;  5CPK A;  2BYK B;  4QLC B;  4NE6 A;  3AYW D;  5E5A A;  3B6G B;  3X1S A;  3KXB A;  3KWQ C;  5AY8 B;  5B40 B;  3O62 B;  3MNN C;  4JJN C;  1P3L A;  3MGQ B;  2Y2M A;  2JE5 A;  3F6T A;  3KUY B;  1S32 D;  1M19 B;  3REL C;  3LZ0 B;  3MGP C;  1BFM A;  3UTA C;  5GXQ A;  2PYO B;  1JFI A;  5G49 B;  3LEL A;  3MGS A;  4KGC B;  1ZLA D;  5B31 A;  3W99 A;  5CPJ B;  1H3O B;  1P3O C;  5B32 C;  1P3A C;  1EQZ D;  3A6N B;  3REI D;  3REK C;  4QLC C;  3AN2 D;  1F66 A;  3UTB A;  3REH D;  3AZM A;  2Y2H A;  5AY8 C;  5B40 C;  1P3P D;  4XUJ C;  5DNN D;  3W99 B;  4WU8 A;  1KX4 B;  5B31 G;  4EO5 B;  5BNX B;  3C1C B;  3MGQ C;  2FFF B;  3AZF C;  3AZJ B;  5B0Y D;  3KUY C;  1M19 C;  3VH6 W;  3LZ0 C;  5CP6 D;  4J8U C;  3WA9 B;  3REJ D;  3W96 D;  4J8W C;  1M18 B;  3B0C W;  2PYO C;  5B2I B;  4Z5T D;  4KGC C;  5BNV B;  4H9Q A;  5CPJ C;  5AV6 B;  3B6F B;  2FJ7 D;  3AZI D;  3EPL A;  3WAA A;  1M1A D;  5DNM D;  1P3F B;  3NQJ B;  2Y2I A;  1P3B A;  4JJN D;  3AZE D;  1BH8 A;  5AV5 D;  2BYM A;  2Y2G A;  4G92 B;  3W99 C;  2HIO D;  2YFV A;  1BH9 B;  3AZH C;  1AOI A;  1Q9C A;  5B33 C;  3AV1 A;  1ZLA A;  3REL D;  3H0M C;  4Z66 D;  3C1C C;  3AZN A;  4KHA A;  3X1U A;  3MGP D;  3AZJ C;  2NZD C;  3AN2 A;  1ID3 B;  3REH A;  4H9R B;  2ZY2 A;  3WA9 C;  2NQB C;  3A1K A;  4ZUX C;  5B0Z B;  4CAY A;  5GT0 D;  3C1B D;  3AFA B;  1M18 C;  4G91 B;  4Z2M G;  2Y2L A;  5E5A C;  5B2I C;  2ZY5 A;  5B32 D;  5AVC D;  3AZG A;  1U35 D;  1P3A D;  1TAF A;  3VH6 T;  3B6G D;  5AV6 C;  3REJ A;  2IO5 C;  5AY8 D;  5B40 D;  3O62 D;  4XZQ B;  1P3F C;  3V9R A;  3B0C T;  5GT3 B;  2G5I C;  4Z5T A;  3MGQ D;  3LJA B;  4H9S A;  3UT9 A;  2F8N H;  1F1E A;  2FJ7 A;  3AZI A;  5DNM A;  3MGS C;  1P3I A;  1TZY A;  2PYO D;  5AV5 A;  5B0Z C;  2RVQ D;  4KGC D;  3AFA C;  5AV9 B;  1P3G B;  5CPJ D;  4Z66 A;  5B2J C;  4HGA B;  3A6N D;  3TU4 B;  1P3K A;  4LD9 B;  4WU8 C;  3C1B A;  3W99 D;  4XZQ C;  1KX4 D;  1U35 A;  5AVC A;  3C1C D;  3KWQ B;  3LJA C;  3AZJ D;  3MNN B;  1P34 B;  3O62 A;  2BG1 A;  4WU9 B;  1HQ3 B;  1M18 D;  5B2I D;  5BS7 A;  5B1L D;  3UTA B;  5AV9 C;  4YM6 C;  1P3B C;  5AV6 D;  3B6F D;  3TU4 C;  4J8X D;  3AZL A;  5CPI A;  1P3F D;  5CHL B;  2G5H C;  1P3O B;  3AV2 B;  1N1J A;  4H9P B;  3REK B;  4X23 A;  4J8V B;  5AV8 D;  2F2A C;  5GSU A;  5JA4 B;  5AVB A;  3A6N A;  4XUJ B;  3WKJ A;  1ID3 D;  4UUZ A;  3MVD A;  1P34 C;  5B0Z D;  5B24 A;  3AZF B;  1KX5 B;  1Z2C B;  1HQ3 C;  3AFA D;  4WU9 C;  4J8U B;  2JSS A;  4J8W B;  2CV5 B;  5JRG B;  1P3M B;  5F99 B;  3UT9 C;  5GT3 D;  3AV2 C;  5KDM A;  5B1L A;  3X1T B;  4YS3 B;  3AZK A;  1TZY C;  4J8V C;  4R8P B;  1KX3 B;  3B6F A;  3WTP B;  2Y2N A;  3NQU B;  2F8N A;  4J8X A;  3W97 A;  3AZH B;  2ZY4 A;  3LZ1 D;  5B33 B;  2DF4 C;  5B1M B;  3R45 B;  1KX5 C;  1BH9 A;  2NZD B;  5AV9 D;  3AYW A;  3X1V D;  1P3G D;  1P3K C;  3W98 B;  4WNN B;  5AV8 A;  2ARO D;  2NQB B;  4ZUX B;  2F8N G;  5BO0 B;  3TU4 D;  1ID3 A;  4LD9 D;  3B0D C;  2CV5 C;  5JRG C;  5E5A B;  1P3M C;  5F99 C;  3X1S B;  3KXB B;  4KUD C;  3H0L C;  2RIQ A;  3MGR C;  2YFW A;  1S32 A;  3KWQ D;  2IO5 B;  3X1T C;  5C3I B;  4YS3 C;  1P3L B;  1B67 A;  3MNN D;  3H0R C;  4R8P C;  1KX3 C;  1P34 D;  3WTP C;  3EG5 B;  3VH5 W;  5FUG B;  4H9O A;  1HQ3 D;  5B1M C;  4CSR A;  1T3U A;  5GXQ B;  1EQZ A;  3REI A;  1JFI B;  3LEL B;  3UTA D;  3MGS B;  5CPI C;  3W98 C;  1KU5 A;  5B31 B;  1P3P A;  5DNN A;  3LZ1 A;  5CPK C;  1F66 B;  3UTB B;  1P3O D;  5B2J B;  3AZM B;  3X1S C;  3KXB C;  3AV2 D;  2CWE A;  2Y2P A;  5B0Y A;  5AVB C;  2J8P A;  3REK D;  3X1V A;  4QLC D;  4WU8 B;  5CP6 A;  2ARO A;  4J8V D;  3W96 A;  1P3L C;  5C3I C;  4XUJ D;  2UWX A;  4LD9 A;  3AZF D;  1KX5 D;  2L5A A;  3KUY D;  2ZM5 A;  1M19 D;  5GXQ C;  3LZ0 D;  3KWQ A;  4J8U D;  1M1A A;  3LEL C;  4J8W D;  5JRG D;  5B31 C;  4H9Q B;  4JJN A;  3AZE A;  4NE3 A;  1P3M D;  5F99 D;  3VH5 T;  2HIO A;  2F8N K;  3WAA B;  5BT1 C;  1F66 C;  3REL A;  3UTB C;  4YM6 B;  3AZM C;  1P3B B;  3MGP A;  4WJ3 C;  1BH8 B;  2Y2K A;  4YS3 D;  2BYM B;  1AOI B;  2YFV B;  1W2E A;  3AV1 B;  4R8P D;  1KX3 D;  3WTP D;  5GT0 A;  4H9N B;  3AZN B;  4KHA B;  3X1U B;  3AZH D;  5B33 D;  3AN2 B;  5B1M D;  3REH B;  5B32 A;  1P3A A;  2XD1 A;  4H9P A;  2NZD D;  2BYK A;  4QLC A;  3B6G A;  4WZS B;  3W98 D;  5AY8 A;  3AZG B;  2NQB D;  3WA9 D;  5B40 A;  4ZUX D;  4XUJ A;  1TAF B;  1S32 C;  5B32 G;  4NE5 A;  5E5A D;  3MGQ A;  3X1S D;  3KXB D;  3KSY A;  3WAA C;  3KUY A;  4DRB A;  1M19 A;  3V9R B;  3LZ0 A;  1WWI A;  4J8U A;  4AWL C;  1P3L D;  4Z5T B;  1AOI C;  4J8W A;  2ZY3 A;  1ZLA C;  2PYO A;  3AV1 C;  3UT9 B;  5G49 A;  3AZN C;  4KGC A;  3X1U C;  3AZI B;  5DNM B;  3AN2 C;  1P3I B;  5CPJ A;  1H3O A;  3VH6 A;  5GXQ D;  1TZY B;  3EPJ A;  3REH C;  3LEL D;  2HUE C;  3MGS D;  5B31 D;  3AZG C;  3KFU G;  3NQU A;  3AZH A;  5B0Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...