1P3MB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3mB00
1WWSA 5BO0A 3AV2C 2FJ7D 5CP6D 4XZQA 5B40C 3KXBD 3WA9C 5B33A 3B6GD 3X1SB 3MGRD 4XUJA 1HQ3A 1M1AD 5B24A 4X23B 3B6FD 3NQUA 5AVCC 4Z5TD 4NE3A 1P3FB 1ULYA 3W98D 3O62C 1P3OC 5AV9A 3LZ1C 3AZED 2NQBA 3W99A 4KUDD 4J8VA 2F8NK 3UT9C 1S32B 1AOIC 1U35C 5GT3A 5DNMB 1M19B 5CPIA 4QLCA 3AV2D 5B40D 2AROB 5GXQC 3MGPA 1KX4A 5F99A 3AZJC 3AFAC 1JFIA 3UTBA 2CV5C 5GSUB 3V9RA 3WAAC 4J8WB 4KHAA 1EQZA 1ZLAA 4KGCB 3REJD 3O62D 1P3OD 3WTPE 3LZ1D 3C1CB 3UTAB 4J8XA 3REHB 3X1TA 3UT9D 3NQJB 4YM6C 1AOID 1P3BC 3LJAA 1U35D 1P3IC 5B31B 5CPJA 5AY8C 3C1BC 3X1VB 4WU9A 3AZNA 3AZLB 3REKA 1BH9A 2LY8A 3WTPA 2YFVB 3AYWA 5CP6B 2FJ7B 3KXBB 4YS3C 3AV1A 5B32C 3AZJD 5B0ZC 5B2IC 3LELA 3B0CW 4H9QB 3B0DB 4DRBA 3MGRB 1P34C 3WAAD 3AZKC 3AZMA 4LD9C 1M1AB 3B6FB 4Z5TB 3W98B 4YM6D 3KUYC 1P3BD 3AN2C 1P3ID 3AZEB 4KUDB 3AZIA 5AY8D 3C1BD 1TZYC 5AV8C 4HGAC 3MNNC 2IO5B 5JRGC 3AZGA 1H3OA 2RVQD 3VH5T 3AV2B 5B40B 4YS3D 4XZQC 5B32D 5G49B 1P3KA 2JSSA 5B0ZD 5B2ID 2NZDA 5B33C 1KU5A 1P34D 3AZKD 5DNND 1HQ3C 3W96A 4XUJC 4LD9D 3KWQB 4CAYA 5B24C 3REJB 3O62B 3KUYD 3VH6T 4NE6A 1P3PA 3AN2D 3LZ1B 1P3OB 1ID3A 5AV9C 4G91B 3W99C 3UT9B 2NQBC 1TZYD 4J8VC 3MNND 5JRGD 1AOIB 1KX5D 1U35B 5AV5A 4WZSB 5GT3C 5AV6A 5CPIC 4QLCC 4ZUXD 4XZQD 1M18A 2HIOD 3X1SA 5B33D 1F66A 3MGPC 3WKJA 1KX4C 2BYMA 2YFWB 3LZ0D 3TU4D 3AZJB 4X23A 5F99C 5BNVB 5AVBA 4XUJD 1HQ3D 1P3FA 3REIB 3UTBC 4H9RA 2CWEA 4H9PA 5BNXB 3X1UA 3WAAB 3AZHA 1ZLAC 1EQZC 4WU8A 5CPKA 5GT0A 5AV9D 3W99D 2NQBD 4J8XC 4J8VD 3X1TC 2BYKB 4YM6B 4H9NB 1P3BB 1P3IB 3LJAC 5GT3D 5AY8B 3C1BB 1P3LA 5CPJC 4QLCD 4WU9C 3AZNC 3REKC 1B6WA 3AZFA 3WTPC 3MGPD 3AYWC 4YS3B 1KX4D 5B32B 4H9SA 5B32G 3AV1C 5GSUA 4CSRA 5B0ZB 5B2IB 4G92C 4J8WA 3LELC 4KGCA 4JJNA 3UTBD 4Z66A 1P34B 3C1CA 3AZKB 3UTAA 1ZLAD 5DNNB 1EQZD 4LD9B 3MGSA 3AZMC 4DRAA 4WNNB 4J8XD 1F1EA 3X1TD 3KUYB 3AN2B 5KDMA 3WA9D 1N1JB 3LJAD 1P3AC 2HUEB 3MVDA 1TZYB 3AZIC 5CPJD 4HGAB 3MNNB 5JRGB 1KX5B 1BH8A 2FJ7A 5CP6A 5BS7A 3REKD 3AZGC 5AVCD 3WTPD 5B1LA 5BO0B 4ZUXB 3AYWD 4R8PA 3AV1D 2HIOB 3MGRA 4WV4B 1P3KC 3LELD 5B33B 2NZDC 3LZ0B 3TU4B 5B31G 3B0CT 4XUJB 1HQ3B 3AZMD 3W96C 3AZEA 5FUGA 5GXQD 4E45A 1P3PC 1ID3C 5AV9B 1A7WA 1P3AD 4EO5C 1P3MA 3W99B 2NQBB 4J8VB 3W97A 3AZID 3AFAD 3B6GB 2CV5D 5B1MA 5AV5C 3AZGD 5G49A 2L5AA 5AV6C 4QLCB 1KX3A 4J8UA 1P3KD 1M18C 3X1SC 2NZDD 3MGPB 3A6NA 1KX4B 3RELA 3KWQA 1F66C 3WKJC 4M6BA 4X23C 5AVBC 1TAFA 1JFIB 3MGQA 5B0YA 3REJA 3UTBB 1P3FC 3V9RB 3X1UC 1ZLAB 1EQZB 2F8NA 3AZHC 1WWIA 5E5AA 1P3PD 4WU8C 5CPKC 5GT0C 4J8XB 5C3IC 4UUZA 3X1TB 1B67A 5B2JA 3WA9B 1P3GA 3LJAB 5AV5D 5CPJB 1P3LC 5AV6D 2PYOA 3REKB 4E44A 1M18D 5AVCB 3AZFC 3WTPB 5BNVA 3AYWB 1F66D 3AV1B 3WKJD 3REIA 4H9SC 5JA4A 5GSUC 5AVBD 3LELB 3R45A 5AV8D 4J8WC 4KGCC 4NFTA 4JJNC 4Z66C 5BT1C 3X1UD 3C1CC 3UTAC 3AZHD 3AZMB 3MGSC 4WU8D 5CPKD 5GT0D 5GXQB 4H9OB 1P3AB 3AZIB 3AFAB 3MVDC 1P3LD 2CV5B 1Q9CA 5B24D 5CP6C 3AZGB 2FJ7C 5BS7C 1H3OB 3AZFD 1BFMA 5B1LC 1S32A 1P3KB 4R8PC 5DNMA 3MGRC 1M19A 2NZDB 5DNNA 4JJND 4Z66D 1R4VA 4AWLC 5BT1D 2AROA 3MGSD 5CPID 4CAYB 3AZEC 1P3PB 1KX5A 4EO5B 5CHLB 1P3MC 3MVDD 5F99D 3W97C 4ZUXA 5AV5B 5B1MC 3KSYA 2HIOA 5AV6B 3REHA 5B1LD 3NQJA 1KX3C 4R8PD 3LZ0A 3TU4A 1M18B 4J8UC 5B31A 2F8NH 3X1VA 1F66B 3A6NC 3WKJB 2BYMB 3RELC 3KWQC 3AZLA 5AVBB 4Z2MH 4ZBJC 5AV8B 3MGQC 5B0YC 2YFVA 3REJC 4WU9D 4H9RB 3AZND 4H9PB 3X1UB 3KXBA 3AZHB 4G91C 4WU8B 4H9QA 5E5AC 4XZQB 5GT0B 5CPKB 5C3IB 4NE5A 1P3MD 3B6GA 3W97D 5B2JC 1P3GC 1M1AA 5B1MD 1P3LB 3B6FA 4Z5TA 2PYOC 3W98A 5B24B 1KX3D 4J8UD 3NQUB 3AZFB 4KUDA 3A6ND 3RELD 3KWQD 4CSRB 3REIC 3MGQD 5B0YD 4JJNB 3AV2A 4Z66B 5GT3B 5B40A 2F8ND 3MGSB 5CPIB 3VH5A 3WA9A 5E5AD 5B2JD 5KDMB 1P3GD 3MVDB 5F99B 2RVQC 5AVCA 1BH8B 2PYOD 3W96D 3O62A 1P3OA 3LZ1A 4KHAB 3UT9A 5B1LB 3VH6A 3B0BA 1ID3D 1AOIA 4R8PB 1U35A 3REID 1S32C 5DNMC 1M19C 5DNNC 4AWLB 2AROC 5GXQA 4H9OA 4WU9B 3AZNB 1P3AA 5FUGB 2YFWA 1BH9B 2HUEC 3AZJA 3AFAA 3X1SD 1KX5C 2CV5A 1P3MB 3W97B 5BNXA 4G92B 4X23D 3WAAA 1P3FD 5B1MB 4ZUXC 2HIOC 3REHC 2BYKA 4YM6A 4H9NA 1P3BA 1KX3B 1P3IA 1S32D 4J8UB 3LZ0C 5DNMD 3TU4C 5AY8A 5B31C 3C1BA 1M19D 3A6NB 3RELB 3X1VC 3VH5W 2AROD 4ZBJB 3AZLC 1TAFB 3MGQB 5B0YB 4YS3A 1HTAA 5B32A 3KXBC 2F8NB 5B0ZA 2F8NG 5B2IA 5E5AB 3B6GC 3B0DC 4Z2MG 4UUZB 5GSUD 5B2JB 1P34A 3AZKA 4J8WD 4LD9A 1P3GB 4KGCD 1M1AC 3VH6W 4WNNA 3C1CD 3B6FC 3UTAD 3REHD 2PYOB 3W96B 3KUYA 4Z5TC 3AN2A 3W98C 1N1JA 4KUDC 5B31D 1TZYA 5AV8A 3MNNA 5JRGA 1ID3B 3X1VD 2IO5C 5JA4B 3AZLD 3R45B
chains in the Genus database with same CATH superfamily
2Y2IA 1WWSA 5BO0A 3AV2C 2FJ7D 5CP6D 4XZQA 5B40C 3KXBD 3WA9C 5B33A 3B6GD 3X1SB 3MGRD 3P5JB 4XUJA 1HQ3A 2UWXA 1M1AD 5B24A 2G5IC 4X23B 3B6FD 2ZY3A 3NQUA 5AVCC 4Z5TD 4NE3A 1P3FB 1ULYA 3W98D 3O62C 1P3OC 5AV9A 3LZ1C 3AZED 2NQBA 3W99A 4KUDD 4J8VA 2F8NK 3UT9C 2W8SA 1S32B 1AOIC 1U35C 5GT3A 5DNMB 1M19B 2Y2HA 5CPIA 4QLCA 3AV2D 2JE5A 5B40D 2AROB 5GXQC 3MGPA 1KX4A 5F99A 3AZJC 3AFAC 1JFIA 4WJ3C 3UTBA 2CV5C 5GSUB 3V9RA 2Y2LA 3WAAC 4J8WB 4KHAA 1EQZA 1ZLAA 4KGCB 3REJD 3O62D 1P3OD 3WTPE 3LZ1D 3C1CB 3UTAB 4J8XA 2JCHA 3REHB 3X1TA 3UT9D 3NQJB 4YM6C 1AOID 1P3BC 3LJAA 1U35D 1P3IC 5B31B 5CPJA 5AY8C 3C1BC 3X1VB 4WU9A 3AZNA 3AZLB 1Z2CB 3REKA 1BH9A 2LY8A 3WTPA 2YFVB 3AYWA 5CP6B 2FJ7B 3KXBB 4YS3C 3AV1A 5B32C 3AZJD 5B0ZC 5B2IC 3LELA 3B0CW 4H9QB 3B0DB 4DRBA 3MGRB 3EPJA 1P34C 3WAAD 2ZY5A 3AZKC 3AZMA 4LD9C 1M1AB 3B6FB 4Z5TB 3W98B 4YM6D 3KUYC 1P3BD 3AN2C 1P3ID 3AZEB 4KUDB 3AZIA 5AY8D 3C1BD 1TZYC 5AV8C 4HGAC 3MNNC 2IO5B 5JRGC 3AZGA 1H3OA 2RVQD 3VH5T 3AV2B 2Y2GA 5B40B 4YS3D 4XZQC 5B32D 5G49B 1P3KA 2JSSA 5B0ZD 5B2ID 2NZDA 5B33C 1KU5A 1P34D 3AZKD 3H0MC 1HQ3C 3W96A 5DNND 4XUJC 3KWQB 4LD9D 4CAYA 5B24C 3EPLA 3REJB 3O62B 3KUYD 3VH6T 4NE6A 1P3PA 3AN2D 3LZ1B 1P3OB 1ID3A 5AV9C 4G91B 3W99C 3UT9B 2NQBC 1TZYD 4J8VC 3MNND 5JRGD 1AOIB 1KX5D 1U35B 5AV5A 4WZSB 5GT3C 5AV6A 2BG1A 5CPIC 4QLCC 4ZUXD 4XZQD 1M18A 2HIOD 3X1SA 3H0LC 5B33D 1F66A 3MGPC 3WKJA 1KX4C 2BYMA 2YFWB 3LZ0D 3TU4D 3AZJB 3EPHA 3KFUG 4X23A 5F99C 5BNVB 5AVBA 3EG5B 4XUJD 1HQ3D 1P3FA 3REIB 3UTBC 2CWEA 4H9RA 4H9PA 5BNXB 3X1UA 3WAAB 3AZHA 1ZLAC 1EQZC 4WU8A 5CPKA 5GT0A 5AV9D 3W99D 2NQBD 4J8XC 4J8VD 3X1TC 2BYKB 4YM6B 4H9NB 1P3BB 1P3IB 3LJAC 5GT3D 5AY8B 3C1BB 1P3LA 5CPJC 4QLCD 4WU9C 3AZNC 3REKC 1B6WA 2Y2JA 3AZFA 3WTPC 3MGPD 3AYWC 4YS3B 1KX4D 5B32B 4H9SA 5B32G 3AV1C 5GSUA 4CSRA 5B0ZB 5B2IB 4G92C 4J8WA 3LELC 4KGCA 3EPKA 4JJNA 2ZY2A 3UTBD 4Z66A 4UPKA 1P34B 2ZM5A 3C1CA 3UTAA 3AZKB 1ZLAD 5DNNB 1EQZD 4LD9B 2XD1A 3MGSA 3F6TA 3AZMC 4DRAA 1PZRA 4WNNB 4J8XD 1F1EA 3X1TD 3KUYB 3AN2B 5KDMA 3WA9D 1N1JB 3LJAD 1P3AC 2HUEB 3MVDA 1TZYB 3AZIC 5CPJD 4HGAB 3MNNB 5JRGB 1KX5B 1BH8A 2FJ7A 5CP6A 5BS7A 3REKD 3AZGC 5AVCD 3WTPD 5B1LA 5BO0B 4ZUXB 3AYWD 4R8PA 3AV1D 2HIOB 3MGRA 4WV4B 1P3KC 3LELD 5B33B 2NZDC 3LZ0B 3TU4B 1W2EA 5B31G 3B0CT 2VQRA 4XUJB 1HQ3B 3AZMD 3W96C 2Y2KA 3AZEA 5FUGA 5GXQD 4E45A 3H0RC 1P3PC 5AV9B 1A7WA 1P3AD 4EO5C 1P3MA 1ID3C 3W99B 4J8VB 3W97A 3AZID 2NQBB 3AFAD 2Y2MA 3B6GB 4DQYB 2CV5D 5B1MA 5AV5C 3AZGD 5G49A 2L5AA 5AV6C 4QLCB 1KX3A 3A1KA 4J8UA 1P3KD 1M18C 3X1SC 2NZDD 3MGPB 3A6NA 1KX4B 3RELA 3KWQA 1F66C 3WKJC 4M6BA 4X23C 5AVBC 1TAFA 2Y2PA 1JFIB 3MGQA 5B0YA 3REJA 3UTBB 1P3FC 3V9RB 3X1UC 1ZLAB 1EQZB 2F8NA 3AZHC 1WWIA 5E5AA 1P3PD 4WU8C 5CPKC 5GT0C 4J8XB 5C3IC 4UUZA 3X1TB 1B67A 5B2JA 3WA9B 1P3GA 3LJAB 5AV5D 5CPJB 1P3LC 5AV6D 2PYOA 3REKB 4E44A 1M18D 5AVCB 3AZFC 3WTPB 5BNVA 3AYWB 1F66D 3AV1B 3WKJD 3REIA 4H9SC 5JA4A 5GSUC 5AVBD 3LELB 3R45A 5AV8D 4J8WC 4KGCC 4NFTA 4JJNC 4Z66C 5BT1C 3X1UD 3C1CC 3UTAC 3AZHD 3AZMB 3MGSC 4WU8D 5CPKD 5GT0D 5GXQB 4H9OB 1P3AB 3FDDA 3AZIB 3AFAB 3MVDC 1P3LD 2CV5B 1Q9CA 5B24D 5CP6C 3AZGB 2FJ7C 5BS7C 1H3OB 3AZFD 1BFMA 5B1LC 1S32A 2DQNC 4R8PC 5DNMA 1P3KB 3MGRC 1M19A 2NZDB 3A1IA 5DNNA 4JJND 4Z66D 1R4VA 4AWLC 5BT1D 2AROA 3MGSD 5CPID 4CAYB 3AZEC 1T3UA 1P3PB 1KX5A 4EO5B 5CHLB 1P3MC 3MVDD 5F99D 3W97C 2G5HC 4ZUXA 5AV5B 5B1MC 3KSYA 2HIOA 5AV6B 3REHA 5B1LD 3NQJA 1KX3C 4R8PD 3LZ0A 3TU4A 1M18B 4J8UC 5B31A 2F8NH 3X1VA 1F66B 3A6NC 3WKJB 2BYMB 3RELC 3KWQC 3AZLA 5AVBB 4Z2MH 4ZBJC 5AV8B 2ZY4A 3MGQC 5B0YC 2YFVA 3REJC 4WU9D 4H9RB 3AZND 4H9PB 3X1UB 3KXBA 3AZHB 4G91C 4WU8B 4H9QA 5E5AC 4XZQB 5GT0B 5CPKB 5C3IB 4NE5A 1P3MD 3B6GA 3W97D 5B2JC 1P3GC 1M1AA 5B1MD 1P3LB 3B6FA 2DF4C 4Z5TA 2PYOC 3W98A 5B24B 1KX3D 4J8UD 3NQUB 3AZFB 4KUDA 3A6ND 3RELD 3KWQD 4CSRB 3REIC 2FFFB 3MGQD 5B0YD 4JJNB 3AV2A 4Z66B 5GT3B 5B40A 2F8ND 3IP4C 3MGSB 5CPIB 3VH5A 2J8PA 3WA9A 5E5AD 5B2JD 5KDMB 1P3GD 3MVDB 5F99B 2RVQC 5AVCA 1BH8B 2PYOD 3W96D 3O62A 1P3OA 2Y2OA 3LZ1A 4KHAB 3UT9A 5B1LB 3VH6A 3B0BA 1ID3D 1AOIA 4R8PB 1U35A 3REID 1S32C 5DNMC 1M19C 5DNNC 2RIQA 4AWLB 2AROC 5GXQA 4H9OA 4WU9B 3AZNB 1P3AA 2XD5A 5FUGB 2YFWA 1BH9B 2HUEC 3AZJA 3AFAA 3X1SD 1KX5C 2CV5A 2Y2NA 1P3MB 3W97B 5BNXA 2Y2QA 4G92B 4X23D 3WAAA 1P3FD 5B1MB 4ZUXC 2HIOC 3REHC 2BYKA 4YM6A 4H9NA 1P3BA 1KX3B 1P3IA 1S32D 4J8UB 3LZ0C 5DNMD 3TU4C 5AY8A 5B31C 3C1BA 1M19D 3A6NB 3RELB 3X1VC 3VH5W 2AROD 4ZBJB 3AZLC 1TAFB 3MGQB 5B0YB 4YS3A 1HTAA 5B32A 3KXBC 2F8NB 5B0ZA 2F8NG 5B2IA 5E5AB 3B6GC 3B0DC 4Z2MG 4UUZB 5GSUD 5B2JB 1P34A 3AZKA 4J8WD 4LD9A 1P3GB 4KGCD 1M1AC 3VH6W 4WNNA 3C1CD 3B6FC 3UTAD 3REHD 2PYOB 3W96B 3AL0C 3KUYA 4Z5TC 3AN2A 3W98C 1N1JA 4KUDC 5B31D 1TZYA 5AV8A 3MNNA 5JRGA 1ID3B 3X1VD 2F2AC 2IO5C 5JA4B 3AZLD 3R45B
chains in the Genus database with same CATH topology
2Y2IA 1WWSA 5BO0A 3AV2C 2FJ7D 5CP6D 4XZQA 5B40C 3KXBD 3WA9C 5B33A 3B6GD 3X1SB 3MGRD 3P5JB 4XUJA 1HQ3A 2UWXA 1M1AD 5B24A 2G5IC 4X23B 3B6FD 2ZY3A 3NQUA 5AVCC 4Z5TD 4NE3A 1P3FB 1ULYA 3W98D 3O62C 1P3OC 5AV9A 3LZ1C 3AZED 2NQBA 3W99A 4KUDD 4J8VA 2F8NK 3UT9C 2W8SA 1S32B 1AOIC 1U35C 5GT3A 5DNMB 1M19B 2Y2HA 5CPIA 4QLCA 3AV2D 2JE5A 5B40D 2AROB 5GXQC 3MGPA 1KX4A 5F99A 3AZJC 3AFAC 1JFIA 4WJ3C 3UTBA 2CV5C 5GSUB 3V9RA 2Y2LA 3WAAC 4J8WB 4KHAA 1EQZA 1ZLAA 4KGCB 3REJD 3O62D 1P3OD 3WTPE 3LZ1D 3C1CB 3UTAB 4J8XA 2JCHA 3REHB 3X1TA 3UT9D 3NQJB 4YM6C 1AOID 1P3BC 3LJAA 1U35D 1P3IC 5B31B 5CPJA 5AY8C 3C1BC 3X1VB 4WU9A 3AZNA 3AZLB 1Z2CB 3REKA 1BH9A 2LY8A 3WTPA 2YFVB 3AYWA 5CP6B 2FJ7B 3KXBB 4YS3C 3AV1A 5B32C 3AZJD 5B0ZC 5B2IC 3LELA 3B0CW 4H9QB 3B0DB 4DRBA 3MGRB 3EPJA 1P34C 3WAAD 2ZY5A 3AZKC 3AZMA 4LD9C 1M1AB 3B6FB 4Z5TB 3W98B 4YM6D 3KUYC 1P3BD 3AN2C 1P3ID 3AZEB 4KUDB 3AZIA 5AY8D 3C1BD 1TZYC 5AV8C 4HGAC 3MNNC 2IO5B 5JRGC 3AZGA 1H3OA 2RVQD 3VH5T 3AV2B 2Y2GA 5B40B 4YS3D 4XZQC 5B32D 5G49B 1P3KA 2JSSA 5B0ZD 5B2ID 2NZDA 5B33C 1KU5A 1P34D 3AZKD 3H0MC 1HQ3C 3W96A 5DNND 4XUJC 3KWQB 4LD9D 4CAYA 5B24C 3EPLA 3REJB 3O62B 3KUYD 3VH6T 4NE6A 1P3PA 3AN2D 3LZ1B 1P3OB 1ID3A 5AV9C 4G91B 3W99C 3UT9B 2NQBC 1TZYD 4J8VC 3MNND 5JRGD 1AOIB 1KX5D 1U35B 5AV5A 4WZSB 5GT3C 5AV6A 2BG1A 5CPIC 4QLCC 4ZUXD 4XZQD 1M18A 2HIOD 3X1SA 3H0LC 5B33D 1F66A 3MGPC 3WKJA 1KX4C 2BYMA 2YFWB 3LZ0D 3TU4D 3AZJB 3EPHA 3KFUG 4X23A 5F99C 5BNVB 5AVBA 3EG5B 4XUJD 1HQ3D 1P3FA 3REIB 3UTBC 2CWEA 4H9RA 4H9PA 5BNXB 3X1UA 3WAAB 3AZHA 1ZLAC 1EQZC 4WU8A 5CPKA 5GT0A 5AV9D 3W99D 2NQBD 4J8XC 4J8VD 3X1TC 2BYKB 4YM6B 4H9NB 1P3BB 1P3IB 3LJAC 5GT3D 5AY8B 3C1BB 1P3LA 5CPJC 4QLCD 4WU9C 3AZNC 3REKC 1B6WA 2Y2JA 3AZFA 3WTPC 3MGPD 3AYWC 4YS3B 1KX4D 5B32B 4H9SA 5B32G 3AV1C 5GSUA 4CSRA 5B0ZB 5B2IB 4G92C 4J8WA 3LELC 4KGCA 3EPKA 4JJNA 2ZY2A 3UTBD 4Z66A 4UPKA 1P34B 2ZM5A 3C1CA 3UTAA 3AZKB 1ZLAD 5DNNB 1EQZD 4LD9B 2XD1A 3MGSA 3F6TA 3AZMC 4DRAA 1PZRA 4WNNB 4J8XD 1F1EA 3X1TD 3KUYB 3AN2B 5KDMA 3WA9D 1N1JB 3LJAD 1P3AC 2HUEB 3MVDA 1TZYB 3AZIC 5CPJD 4HGAB 3MNNB 5JRGB 1KX5B 1BH8A 2FJ7A 5CP6A 5BS7A 3REKD 3AZGC 5AVCD 3WTPD 5B1LA 5BO0B 4ZUXB 3AYWD 4R8PA 3AV1D 2HIOB 3MGRA 4WV4B 1P3KC 3LELD 5B33B 2NZDC 3LZ0B 3TU4B 1W2EA 5B31G 3B0CT 2VQRA 4XUJB 1HQ3B 3AZMD 3W96C 2Y2KA 3AZEA 5FUGA 5GXQD 4E45A 3H0RC 1P3PC 5AV9B 1A7WA 1P3AD 4EO5C 1P3MA 1ID3C 3W99B 4J8VB 3W97A 3AZID 2NQBB 3AFAD 2Y2MA 3B6GB 4DQYB 2CV5D 5B1MA 5AV5C 3AZGD 5G49A 2L5AA 5AV6C 4QLCB 1KX3A 3A1KA 4J8UA 1P3KD 1M18C 3X1SC 2NZDD 3MGPB 3A6NA 1KX4B 3RELA 3KWQA 1F66C 3WKJC 4M6BA 4X23C 5AVBC 1TAFA 2Y2PA 1JFIB 3MGQA 5B0YA 3REJA 3UTBB 1P3FC 3V9RB 3X1UC 1ZLAB 1EQZB 2F8NA 3AZHC 1WWIA 5E5AA 1P3PD 4WU8C 5CPKC 5GT0C 4J8XB 5C3IC 4UUZA 3X1TB 1B67A 5B2JA 3WA9B 1P3GA 3LJAB 5AV5D 5CPJB 1P3LC 5AV6D 2PYOA 3REKB 4E44A 1M18D 5AVCB 3AZFC 3WTPB 5BNVA 3AYWB 1F66D 3AV1B 3WKJD 3REIA 4H9SC 5JA4A 5GSUC 5AVBD 3LELB 3R45A 5AV8D 4J8WC 4KGCC 4NFTA 4JJNC 4Z66C 5BT1C 3X1UD 3C1CC 3UTAC 3AZHD 3AZMB 3MGSC 4WU8D 5CPKD 5GT0D 5GXQB 4H9OB 1P3AB 3FDDA 3AZIB 3AFAB 3MVDC 1P3LD 2CV5B 1Q9CA 5B24D 5CP6C 3AZGB 2FJ7C 5BS7C 1H3OB 3AZFD 1BFMA 5B1LC 1S32A 2DQNC 4R8PC 5DNMA 1P3KB 3MGRC 1M19A 2NZDB 3A1IA 5DNNA 4JJND 4Z66D 1R4VA 4AWLC 5BT1D 2AROA 3MGSD 5CPID 4CAYB 3AZEC 1T3UA 1P3PB 1KX5A 4EO5B 5CHLB 1P3MC 3MVDD 5F99D 3W97C 2G5HC 4ZUXA 5AV5B 5B1MC 3KSYA 2HIOA 5AV6B 3REHA 5B1LD 3NQJA 1KX3C 4R8PD 3LZ0A 3TU4A 1M18B 4J8UC 5B31A 2F8NH 3X1VA 1F66B 3A6NC 3WKJB 2BYMB 3RELC 3KWQC 3AZLA 5AVBB 4Z2MH 4ZBJC 5AV8B 2ZY4A 3MGQC 5B0YC 2YFVA 3REJC 4WU9D 4H9RB 3AZND 4H9PB 3X1UB 3KXBA 3AZHB 4G91C 4WU8B 4H9QA 5E5AC 4XZQB 5GT0B 5CPKB 5C3IB 4NE5A 1P3MD 3B6GA 3W97D 5B2JC 1P3GC 1M1AA 5B1MD 1P3LB 3B6FA 2DF4C 4Z5TA 2PYOC 3W98A 5B24B 1KX3D 4J8UD 3NQUB 3AZFB 4KUDA 3A6ND 3RELD 3KWQD 4CSRB 3REIC 2FFFB 3MGQD 5B0YD 4JJNB 3AV2A 4Z66B 5GT3B 5B40A 2F8ND 3IP4C 3MGSB 5CPIB 3VH5A 2J8PA 3WA9A 5E5AD 5B2JD 5KDMB 1P3GD 3MVDB 5F99B 2RVQC 5AVCA 1BH8B 2PYOD 3W96D 3O62A 1P3OA 2Y2OA 3LZ1A 4KHAB 3UT9A 5B1LB 3VH6A 3B0BA 1ID3D 1AOIA 4R8PB 1U35A 3REID 1S32C 5DNMC 1M19C 5DNNC 2RIQA 4AWLB 2AROC 5GXQA 4H9OA 4WU9B 3AZNB 1P3AA 2XD5A 5FUGB 2YFWA 1BH9B 2HUEC 3AZJA 3AFAA 3X1SD 1KX5C 2CV5A 2Y2NA 1P3MB 3W97B 5BNXA 2Y2QA 4G92B 4X23D 3WAAA 1P3FD 5B1MB 4ZUXC 2HIOC 3REHC 2BYKA 4YM6A 4H9NA 1P3BA 1KX3B 1P3IA 1S32D 4J8UB 3LZ0C 5DNMD 3TU4C 5AY8A 5B31C 3C1BA 1M19D 3A6NB 3RELB 3X1VC 3VH5W 2AROD 4ZBJB 3AZLC 1TAFB 3MGQB 5B0YB 4YS3A 1HTAA 5B32A 3KXBC 2F8NB 5B0ZA 2F8NG 5B2IA 5E5AB 3B6GC 3B0DC 4Z2MG 4UUZB 5GSUD 5B2JB 1P34A 3AZKA 4J8WD 4LD9A 1P3GB 4KGCD 1M1AC 3VH6W 4WNNA 3C1CD 3B6FC 3UTAD 3REHD 2PYOB 3W96B 3AL0C 3KUYA 4Z5TC 3AN2A 3W98C 1N1JA 4KUDC 5B31D 1TZYA 5AV8A 3MNNA 5JRGA 1ID3B 3X1VD 2F2AC 2IO5C 5JA4B 3AZLD 3R45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWS A;  5BO0 A;  3AV2 C;  2FJ7 D;  5CP6 D;  4XZQ A;  5B40 C;  3KXB D;  3WA9 C;  5B33 A;  3B6G D;  3X1S B;  3MGR D;  4XUJ A;  1HQ3 A;  1M1A D;  5B24 A;  4X23 B;  3B6F D;  3NQU A;  5AVC C;  4Z5T D;  4NE3 A;  1P3F B;  1ULY A;  3W98 D;  3O62 C;  1P3O C;  5AV9 A;  3LZ1 C;  3AZE D;  2NQB A;  3W99 A;  4KUD D;  4J8V A;  2F8N K;  3UT9 C;  1S32 B;  1AOI C;  1U35 C;  5GT3 A;  5DNM B;  1M19 B;  5CPI A;  4QLC A;  3AV2 D;  5B40 D;  2ARO B;  5GXQ C;  3MGP A;  1KX4 A;  5F99 A;  3AZJ C;  3AFA C;  1JFI A;  3UTB A;  2CV5 C;  5GSU B;  3V9R A;  3WAA C;  4J8W B;  4KHA A;  1EQZ A;  1ZLA A;  4KGC B;  3REJ D;  3O62 D;  1P3O D;  3WTP E;  3LZ1 D;  3C1C B;  3UTA B;  4J8X A;  3REH B;  3X1T A;  3UT9 D;  3NQJ B;  4YM6 C;  1AOI D;  1P3B C;  3LJA A;  1U35 D;  1P3I C;  5B31 B;  5CPJ A;  5AY8 C;  3C1B C;  3X1V B;  4WU9 A;  3AZN A;  3AZL B;  3REK A;  1BH9 A;  2LY8 A;  3WTP A;  2YFV B;  3AYW A;  5CP6 B;  2FJ7 B;  3KXB B;  4YS3 C;  3AV1 A;  5B32 C;  3AZJ D;  5B0Z C;  5B2I C;  3LEL A;  3B0C W;  4H9Q B;  3B0D B;  4DRB A;  3MGR B;  1P34 C;  3WAA D;  3AZK C;  3AZM A;  4LD9 C;  1M1A B;  3B6F B;  4Z5T B;  3W98 B;  4YM6 D;  3KUY C;  1P3B D;  3AN2 C;  1P3I D;  3AZE B;  4KUD B;  3AZI A;  5AY8 D;  3C1B D;  1TZY C;  5AV8 C;  4HGA C;  3MNN C;  2IO5 B;  5JRG C;  3AZG A;  1H3O A;  2RVQ D;  3VH5 T;  3AV2 B;  5B40 B;  4YS3 D;  4XZQ C;  5B32 D;  5G49 B;  1P3K A;  2JSS A;  5B0Z D;  5B2I D;  2NZD A;  5B33 C;  1KU5 A;  1P34 D;  3AZK D;  5DNN D;  1HQ3 C;  3W96 A;  4XUJ C;  4LD9 D;  3KWQ B;  4CAY A;  5B24 C;  3REJ B;  3O62 B;  3KUY D;  3VH6 T;  4NE6 A;  1P3P A;  3AN2 D;  3LZ1 B;  1P3O B;  1ID3 A;  5AV9 C;  4G91 B;  3W99 C;  3UT9 B;  2NQB C;  1TZY D;  4J8V C;  3MNN D;  5JRG D;  1AOI B;  1KX5 D;  1U35 B;  5AV5 A;  4WZS B;  5GT3 C;  5AV6 A;  5CPI C;  4QLC C;  4ZUX D;  4XZQ D;  1M18 A;  2HIO D;  3X1S A;  5B33 D;  1F66 A;  3MGP C;  3WKJ A;  1KX4 C;  2BYM A;  2YFW B;  3LZ0 D;  3TU4 D;  3AZJ B;  4X23 A;  5F99 C;  5BNV B;  5AVB A;  4XUJ D;  1HQ3 D;  1P3F A;  3REI B;  3UTB C;  4H9R A;  2CWE A;  4H9P A;  5BNX B;  3X1U A;  3WAA B;  3AZH A;  1ZLA C;  1EQZ C;  4WU8 A;  5CPK A;  5GT0 A;  5AV9 D;  3W99 D;  2NQB D;  4J8X C;  4J8V D;  3X1T C;  2BYK B;  4YM6 B;  4H9N B;  1P3B B;  1P3I B;  3LJA C;  5GT3 D;  5AY8 B;  3C1B B;  1P3L A;  5CPJ C;  4QLC D;  4WU9 C;  3AZN C;  3REK C;  1B6W A;  3AZF A;  3WTP C;  3MGP D;  3AYW C;  4YS3 B;  1KX4 D;  5B32 B;  4H9S A;  5B32 G;  3AV1 C;  5GSU A;  4CSR A;  5B0Z B;  5B2I B;  4G92 C;  4J8W A;  3LEL C;  4KGC A;  4JJN A;  3UTB D;  4Z66 A;  1P34 B;  3C1C A;  3AZK B;  3UTA A;  1ZLA D;  5DNN B;  1EQZ D;  4LD9 B;  3MGS A;  3AZM C;  4DRA A;  4WNN B;  4J8X D;  1F1E A;  3X1T D;  3KUY B;  3AN2 B;  5KDM A;  3WA9 D;  1N1J B;  3LJA D;  1P3A C;  2HUE B;  3MVD A;  1TZY B;  3AZI C;  5CPJ D;  4HGA B;  3MNN B;  5JRG B;  1KX5 B;  1BH8 A;  2FJ7 A;  5CP6 A;  5BS7 A;  3REK D;  3AZG C;  5AVC D;  3WTP D;  5B1L A;  5BO0 B;  4ZUX B;  3AYW D;  4R8P A;  3AV1 D;  2HIO B;  3MGR A;  4WV4 B;  1P3K C;  3LEL D;  5B33 B;  2NZD C;  3LZ0 B;  3TU4 B;  5B31 G;  3B0C T;  4XUJ B;  1HQ3 B;  3AZM D;  3W96 C;  3AZE A;  5FUG A;  5GXQ D;  4E45 A;  1P3P C;  1ID3 C;  5AV9 B;  1A7W A;  1P3A D;  4EO5 C;  1P3M A;  3W99 B;  2NQB B;  4J8V B;  3W97 A;  3AZI D;  3AFA D;  3B6G B;  2CV5 D;  5B1M A;  5AV5 C;  3AZG D;  5G49 A;  2L5A A;  5AV6 C;  4QLC B;  1KX3 A;  4J8U A;  1P3K D;  1M18 C;  3X1S C;  2NZD D;  3MGP B;  3A6N A;  1KX4 B;  3REL A;  3KWQ A;  1F66 C;  3WKJ C;  4M6B A;  4X23 C;  5AVB C;  1TAF A;  1JFI B;  3MGQ A;  5B0Y A;  3REJ A;  3UTB B;  1P3F C;  3V9R B;  3X1U C;  1ZLA B;  1EQZ B;  2F8N A;  3AZH C;  1WWI A;  5E5A A;  1P3P D;  4WU8 C;  5CPK C;  5GT0 C;  4J8X B;  5C3I C;  4UUZ A;  3X1T B;  1B67 A;  5B2J A;  3WA9 B;  1P3G A;  3LJA B;  5AV5 D;  5CPJ B;  1P3L C;  5AV6 D;  2PYO A;  3REK B;  4E44 A;  1M18 D;  5AVC B;  3AZF C;  3WTP B;  5BNV A;  3AYW B;  1F66 D;  3AV1 B;  3WKJ D;  3REI A;  4H9S C;  5JA4 A;  5GSU C;  5AVB D;  3LEL B;  3R45 A;  5AV8 D;  4J8W C;  4KGC C;  4NFT A;  4JJN C;  4Z66 C;  5BT1 C;  3X1U D;  3C1C C;  3UTA C;  3AZH D;  3AZM B;  3MGS C;  4WU8 D;  5CPK D;  5GT0 D;  5GXQ B;  4H9O B;  1P3A B;  3AZI B;  3AFA B;  3MVD C;  1P3L D;  2CV5 B;  1Q9C A;  5B24 D;  5CP6 C;  3AZG B;  2FJ7 C;  5BS7 C;  1H3O B;  3AZF D;  1BFM A;  5B1L C;  1S32 A;  1P3K B;  4R8P C;  5DNM A;  3MGR C;  1M19 A;  2NZD B;  5DNN A;  4JJN D;  4Z66 D;  1R4V A;  4AWL C;  5BT1 D;  2ARO A;  3MGS D;  5CPI D;  4CAY B;  3AZE C;  1P3P B;  1KX5 A;  4EO5 B;  5CHL B;  1P3M C;  3MVD D;  5F99 D;  3W97 C;  4ZUX A;  5AV5 B;  5B1M C;  3KSY A;  2HIO A;  5AV6 B;  3REH A;  5B1L D;  3NQJ A;  1KX3 C;  4R8P D;  3LZ0 A;  3TU4 A;  1M18 B;  4J8U C;  5B31 A;  2F8N H;  3X1V A;  1F66 B;  3A6N C;  3WKJ B;  2BYM B;  3REL C;  3KWQ C;  3AZL A;  5AVB B;  4Z2M H;  4ZBJ C;  5AV8 B;  3MGQ C;  5B0Y C;  2YFV A;  3REJ C;  4WU9 D;  4H9R B;  3AZN D;  4H9P B;  3X1U B;  3KXB A;  3AZH B;  4G91 C;  4WU8 B;  4H9Q A;  5E5A C;  4XZQ B;  5GT0 B;  5CPK B;  5C3I B;  4NE5 A;  1P3M D;  3B6G A;  3W97 D;  5B2J C;  1P3G C;  1M1A A;  5B1M D;  1P3L B;  3B6F A;  4Z5T A;  2PYO C;  3W98 A;  5B24 B;  1KX3 D;  4J8U D;  3NQU B;  3AZF B;  4KUD A;  3A6N D;  3REL D;  3KWQ D;  4CSR B;  3REI C;  3MGQ D;  5B0Y D;  4JJN B;  3AV2 A;  4Z66 B;  5GT3 B;  5B40 A;  2F8N D;  3MGS B;  5CPI B;  3VH5 A;  3WA9 A;  5E5A D;  5B2J D;  5KDM B;  1P3G D;  3MVD B;  5F99 B;  2RVQ C;  5AVC A;  1BH8 B;  2PYO D;  3W96 D;  3O62 A;  1P3O A;  3LZ1 A;  4KHA B;  3UT9 A;  5B1L B;  3VH6 A;  3B0B A;  1ID3 D;  1AOI A;  4R8P B;  1U35 A;  3REI D;  1S32 C;  5DNM C;  1M19 C;  5DNN C;  4AWL B;  2ARO C;  5GXQ A;  4H9O A;  4WU9 B;  3AZN B;  1P3A A;  5FUG B;  2YFW A;  1BH9 B;  2HUE C;  3AZJ A;  3AFA A;  3X1S D;  1KX5 C;  2CV5 A;  1P3M B;  3W97 B;  5BNX A;  4G92 B;  4X23 D;  3WAA A;  1P3F D;  5B1M B;  4ZUX C;  2HIO C;  3REH C;  2BYK A;  4YM6 A;  4H9N A;  1P3B A;  1KX3 B;  1P3I A;  1S32 D;  4J8U B;  3LZ0 C;  5DNM D;  3TU4 C;  5AY8 A;  5B31 C;  3C1B A;  1M19 D;  3A6N B;  3REL B;  3X1V C;  3VH5 W;  2ARO D;  4ZBJ B;  3AZL C;  1TAF B;  3MGQ B;  5B0Y B;  4YS3 A;  1HTA A;  5B32 A;  3KXB C;  2F8N B;  5B0Z A;  2F8N G;  5B2I A;  5E5A B;  3B6G C;  3B0D C;  4Z2M G;  4UUZ B;  5GSU D;  5B2J B;  1P34 A;  3AZK A;  4J8W D;  4LD9 A;  1P3G B;  4KGC D;  1M1A C;  3VH6 W;  4WNN A;  3C1C D;  3B6F C;  3UTA D;  3REH D;  2PYO B;  3W96 B;  3KUY A;  4Z5T C;  3AN2 A;  3W98 C;  1N1J A;  4KUD C;  5B31 D;  1TZY A;  5AV8 A;  3MNN A;  5JRG A;  1ID3 B;  3X1V D;  2IO5 C;  5JA4 B;  3AZL D;  3R45 B; 
#chains in the Genus database with same CATH topology
 2Y2I A;  1WWS A;  5BO0 A;  3AV2 C;  2FJ7 D;  5CP6 D;  4XZQ A;  5B40 C;  3KXB D;  3WA9 C;  5B33 A;  3B6G D;  3X1S B;  3MGR D;  3P5J B;  4XUJ A;  1HQ3 A;  2UWX A;  1M1A D;  5B24 A;  2G5I C;  4X23 B;  3B6F D;  2ZY3 A;  3NQU A;  5AVC C;  4Z5T D;  4NE3 A;  1P3F B;  1ULY A;  3W98 D;  3O62 C;  1P3O C;  5AV9 A;  3LZ1 C;  3AZE D;  2NQB A;  3W99 A;  4KUD D;  4J8V A;  2F8N K;  3UT9 C;  2W8S A;  1S32 B;  1AOI C;  1U35 C;  5GT3 A;  5DNM B;  1M19 B;  2Y2H A;  5CPI A;  4QLC A;  3AV2 D;  2JE5 A;  5B40 D;  2ARO B;  5GXQ C;  3MGP A;  1KX4 A;  5F99 A;  3AZJ C;  3AFA C;  1JFI A;  4WJ3 C;  3UTB A;  2CV5 C;  5GSU B;  3V9R A;  2Y2L A;  3WAA C;  4J8W B;  4KHA A;  1EQZ A;  1ZLA A;  4KGC B;  3REJ D;  3O62 D;  1P3O D;  3WTP E;  3LZ1 D;  3C1C B;  3UTA B;  4J8X A;  2JCH A;  3REH B;  3X1T A;  3UT9 D;  3NQJ B;  4YM6 C;  1AOI D;  1P3B C;  3LJA A;  1U35 D;  1P3I C;  5B31 B;  5CPJ A;  5AY8 C;  3C1B C;  3X1V B;  4WU9 A;  3AZN A;  3AZL B;  1Z2C B;  3REK A;  1BH9 A;  2LY8 A;  3WTP A;  2YFV B;  3AYW A;  5CP6 B;  2FJ7 B;  3KXB B;  4YS3 C;  3AV1 A;  5B32 C;  3AZJ D;  5B0Z C;  5B2I C;  3LEL A;  3B0C W;  4H9Q B;  3B0D B;  4DRB A;  3MGR B;  3EPJ A;  1P34 C;  3WAA D;  2ZY5 A;  3AZK C;  3AZM A;  4LD9 C;  1M1A B;  3B6F B;  4Z5T B;  3W98 B;  4YM6 D;  3KUY C;  1P3B D;  3AN2 C;  1P3I D;  3AZE B;  4KUD B;  3AZI A;  5AY8 D;  3C1B D;  1TZY C;  5AV8 C;  4HGA C;  3MNN C;  2IO5 B;  5JRG C;  3AZG A;  1H3O A;  2RVQ D;  3VH5 T;  3AV2 B;  2Y2G A;  5B40 B;  4YS3 D;  4XZQ C;  5B32 D;  5G49 B;  1P3K A;  2JSS A;  5B0Z D;  5B2I D;  2NZD A;  5B33 C;  1KU5 A;  1P34 D;  3AZK D;  3H0M C;  1HQ3 C;  3W96 A;  5DNN D;  4XUJ C;  3KWQ B;  4LD9 D;  4CAY A;  5B24 C;  3EPL A;  3REJ B;  3O62 B;  3KUY D;  3VH6 T;  4NE6 A;  1P3P A;  3AN2 D;  3LZ1 B;  1P3O B;  1ID3 A;  5AV9 C;  4G91 B;  3W99 C;  3UT9 B;  2NQB C;  1TZY D;  4J8V C;  3MNN D;  5JRG D;  1AOI B;  1KX5 D;  1U35 B;  5AV5 A;  4WZS B;  5GT3 C;  5AV6 A;  2BG1 A;  5CPI C;  4QLC C;  4ZUX D;  4XZQ D;  1M18 A;  2HIO D;  3X1S A;  3H0L C;  5B33 D;  1F66 A;  3MGP C;  3WKJ A;  1KX4 C;  2BYM A;  2YFW B;  3LZ0 D;  3TU4 D;  3AZJ B;  3EPH A;  3KFU G;  4X23 A;  5F99 C;  5BNV B;  5AVB A;  3EG5 B;  4XUJ D;  1HQ3 D;  1P3F A;  3REI B;  3UTB C;  2CWE A;  4H9R A;  4H9P A;  5BNX B;  3X1U A;  3WAA B;  3AZH A;  1ZLA C;  1EQZ C;  4WU8 A;  5CPK A;  5GT0 A;  5AV9 D;  3W99 D;  2NQB D;  4J8X C;  4J8V D;  3X1T C;  2BYK B;  4YM6 B;  4H9N B;  1P3B B;  1P3I B;  3LJA C;  5GT3 D;  5AY8 B;  3C1B B;  1P3L A;  5CPJ C;  4QLC D;  4WU9 C;  3AZN C;  3REK C;  1B6W A;  2Y2J A;  3AZF A;  3WTP C;  3MGP D;  3AYW C;  4YS3 B;  1KX4 D;  5B32 B;  4H9S A;  5B32 G;  3AV1 C;  5GSU A;  4CSR A;  5B0Z B;  5B2I B;  4G92 C;  4J8W A;  3LEL C;  4KGC A;  3EPK A;  4JJN A;  2ZY2 A;  3UTB D;  4Z66 A;  4UPK A;  1P34 B;  2ZM5 A;  3C1C A;  3UTA A;  3AZK B;  1ZLA D;  5DNN B;  1EQZ D;  4LD9 B;  2XD1 A;  3MGS A;  3F6T A;  3AZM C;  4DRA A;  1PZR A;  4WNN B;  4J8X D;  1F1E A;  3X1T D;  3KUY B;  3AN2 B;  5KDM A;  3WA9 D;  1N1J B;  3LJA D;  1P3A C;  2HUE B;  3MVD A;  1TZY B;  3AZI C;  5CPJ D;  4HGA B;  3MNN B;  5JRG B;  1KX5 B;  1BH8 A;  2FJ7 A;  5CP6 A;  5BS7 A;  3REK D;  3AZG C;  5AVC D;  3WTP D;  5B1L A;  5BO0 B;  4ZUX B;  3AYW D;  4R8P A;  3AV1 D;  2HIO B;  3MGR A;  4WV4 B;  1P3K C;  3LEL D;  5B33 B;  2NZD C;  3LZ0 B;  3TU4 B;  1W2E A;  5B31 G;  3B0C T;  2VQR A;  4XUJ B;  1HQ3 B;  3AZM D;  3W96 C;  2Y2K A;  3AZE A;  5FUG A;  5GXQ D;  4E45 A;  3H0R C;  1P3P C;  5AV9 B;  1A7W A;  1P3A D;  4EO5 C;  1P3M A;  1ID3 C;  3W99 B;  4J8V B;  3W97 A;  3AZI D;  2NQB B;  3AFA D;  2Y2M A;  3B6G B;  4DQY B;  2CV5 D;  5B1M A;  5AV5 C;  3AZG D;  5G49 A;  2L5A A;  5AV6 C;  4QLC B;  1KX3 A;  3A1K A;  4J8U A;  1P3K D;  1M18 C;  3X1S C;  2NZD D;  3MGP B;  3A6N A;  1KX4 B;  3REL A;  3KWQ A;  1F66 C;  3WKJ C;  4M6B A;  4X23 C;  5AVB C;  1TAF A;  2Y2P A;  1JFI B;  3MGQ A;  5B0Y A;  3REJ A;  3UTB B;  1P3F C;  3V9R B;  3X1U C;  1ZLA B;  1EQZ B;  2F8N A;  3AZH C;  1WWI A;  5E5A A;  1P3P D;  4WU8 C;  5CPK C;  5GT0 C;  4J8X B;  5C3I C;  4UUZ A;  3X1T B;  1B67 A;  5B2J A;  3WA9 B;  1P3G A;  3LJA B;  5AV5 D;  5CPJ B;  1P3L C;  5AV6 D;  2PYO A;  3REK B;  4E44 A;  1M18 D;  5AVC B;  3AZF C;  3WTP B;  5BNV A;  3AYW B;  1F66 D;  3AV1 B;  3WKJ D;  3REI A;  4H9S C;  5JA4 A;  5GSU C;  5AVB D;  3LEL B;  3R45 A;  5AV8 D;  4J8W C;  4KGC C;  4NFT A;  4JJN C;  4Z66 C;  5BT1 C;  3X1U D;  3C1C C;  3UTA C;  3AZH D;  3AZM B;  3MGS C;  4WU8 D;  5CPK D;  5GT0 D;  5GXQ B;  4H9O B;  1P3A B;  3FDD A;  3AZI B;  3AFA B;  3MVD C;  1P3L D;  2CV5 B;  1Q9C A;  5B24 D;  5CP6 C;  3AZG B;  2FJ7 C;  5BS7 C;  1H3O B;  3AZF D;  1BFM A;  5B1L C;  1S32 A;  2DQN C;  4R8P C;  5DNM A;  1P3K B;  3MGR C;  1M19 A;  2NZD B;  3A1I A;  5DNN A;  4JJN D;  4Z66 D;  1R4V A;  4AWL C;  5BT1 D;  2ARO A;  3MGS D;  5CPI D;  4CAY B;  3AZE C;  1T3U A;  1P3P B;  1KX5 A;  4EO5 B;  5CHL B;  1P3M C;  3MVD D;  5F99 D;  3W97 C;  2G5H C;  4ZUX A;  5AV5 B;  5B1M C;  3KSY A;  2HIO A;  5AV6 B;  3REH A;  5B1L D;  3NQJ A;  1KX3 C;  4R8P D;  3LZ0 A;  3TU4 A;  1M18 B;  4J8U C;  5B31 A;  2F8N H;  3X1V A;  1F66 B;  3A6N C;  3WKJ B;  2BYM B;  3REL C;  3KWQ C;  3AZL A;  5AVB B;  4Z2M H;  4ZBJ C;  5AV8 B;  2ZY4 A;  3MGQ C;  5B0Y C;  2YFV A;  3REJ C;  4WU9 D;  4H9R B;  3AZN D;  4H9P B;  3X1U B;  3KXB A;  3AZH B;  4G91 C;  4WU8 B;  4H9Q A;  5E5A C;  4XZQ B;  5GT0 B;  5CPK B;  5C3I B;  4NE5 A;  1P3M D;  3B6G A;  3W97 D;  5B2J C;  1P3G C;  1M1A A;  5B1M D;  1P3L B;  3B6F A;  2DF4 C;  4Z5T A;  2PYO C;  3W98 A;  5B24 B;  1KX3 D;  4J8U D;  3NQU B;  3AZF B;  4KUD A;  3A6N D;  3REL D;  3KWQ D;  4CSR B;  3REI C;  2FFF B;  3MGQ D;  5B0Y D;  4JJN B;  3AV2 A;  4Z66 B;  5GT3 B;  5B40 A;  2F8N D;  3IP4 C;  3MGS B;  5CPI B;  3VH5 A;  2J8P A;  3WA9 A;  5E5A D;  5B2J D;  5KDM B;  1P3G D;  3MVD B;  5F99 B;  2RVQ C;  5AVC A;  1BH8 B;  2PYO D;  3W96 D;  3O62 A;  1P3O A;  2Y2O A;  3LZ1 A;  4KHA B;  3UT9 A;  5B1L B;  3VH6 A;  3B0B A;  1ID3 D;  1AOI A;  4R8P B;  1U35 A;  3REI D;  1S32 C;  5DNM C;  1M19 C;  5DNN C;  2RIQ A;  4AWL B;  2ARO C;  5GXQ A;  4H9O A;  4WU9 B;  3AZN B;  1P3A A;  2XD5 A;  5FUG B;  2YFW A;  1BH9 B;  2HUE C;  3AZJ A;  3AFA A;  3X1S D;  1KX5 C;  2CV5 A;  2Y2N A;  1P3M B;  3W97 B;  5BNX A;  2Y2Q A;  4G92 B;  4X23 D;  3WAA A;  1P3F D;  5B1M B;  4ZUX C;  2HIO C;  3REH C;  2BYK A;  4YM6 A;  4H9N A;  1P3B A;  1KX3 B;  1P3I A;  1S32 D;  4J8U B;  3LZ0 C;  5DNM D;  3TU4 C;  5AY8 A;  5B31 C;  3C1B A;  1M19 D;  3A6N B;  3REL B;  3X1V C;  3VH5 W;  2ARO D;  4ZBJ B;  3AZL C;  1TAF B;  3MGQ B;  5B0Y B;  4YS3 A;  1HTA A;  5B32 A;  3KXB C;  2F8N B;  5B0Z A;  2F8N G;  5B2I A;  5E5A B;  3B6G C;  3B0D C;  4Z2M G;  4UUZ B;  5GSU D;  5B2J B;  1P34 A;  3AZK A;  4J8W D;  4LD9 A;  1P3G B;  4KGC D;  1M1A C;  3VH6 W;  4WNN A;  3C1C D;  3B6F C;  3UTA D;  3REH D;  2PYO B;  3W96 B;  3AL0 C;  3KUY A;  4Z5T C;  3AN2 A;  3W98 C;  1N1J A;  4KUD C;  5B31 D;  1TZY A;  5AV8 A;  3MNN A;  5JRG A;  1ID3 B;  3X1V D;  2F2A C;  2IO5 C;  5JA4 B;  3AZL D;  3R45 B; 
#chains in the Genus database with same CATH homology
 2Y2I A;  1WWS A;  5BO0 A;  3AV2 C;  2FJ7 D;  5CP6 D;  4XZQ A;  5B40 C;  3KXB D;  3WA9 C;  5B33 A;  3B6G D;  3X1S B;  3MGR D;  3P5J B;  4XUJ A;  1HQ3 A;  2UWX A;  1M1A D;  5B24 A;  2G5I C;  4X23 B;  3B6F D;  2ZY3 A;  3NQU A;  5AVC C;  4Z5T D;  4NE3 A;  1P3F B;  1ULY A;  3W98 D;  3O62 C;  1P3O C;  5AV9 A;  3LZ1 C;  3AZE D;  2NQB A;  3W99 A;  4KUD D;  4J8V A;  2F8N K;  3UT9 C;  2W8S A;  1S32 B;  1AOI C;  1U35 C;  5GT3 A;  5DNM B;  1M19 B;  2Y2H A;  5CPI A;  4QLC A;  3AV2 D;  2JE5 A;  5B40 D;  2ARO B;  5GXQ C;  3MGP A;  1KX4 A;  5F99 A;  3AZJ C;  3AFA C;  1JFI A;  4WJ3 C;  3UTB A;  2CV5 C;  5GSU B;  3V9R A;  2Y2L A;  3WAA C;  4J8W B;  4KHA A;  1EQZ A;  1ZLA A;  4KGC B;  3REJ D;  3O62 D;  1P3O D;  3WTP E;  3LZ1 D;  3C1C B;  3UTA B;  4J8X A;  2JCH A;  3REH B;  3X1T A;  3UT9 D;  3NQJ B;  4YM6 C;  1AOI D;  1P3B C;  3LJA A;  1U35 D;  1P3I C;  5B31 B;  5CPJ A;  5AY8 C;  3C1B C;  3X1V B;  4WU9 A;  3AZN A;  3AZL B;  1Z2C B;  3REK A;  1BH9 A;  2LY8 A;  3WTP A;  2YFV B;  3AYW A;  5CP6 B;  2FJ7 B;  3KXB B;  4YS3 C;  3AV1 A;  5B32 C;  3AZJ D;  5B0Z C;  5B2I C;  3LEL A;  3B0C W;  4H9Q B;  3B0D B;  4DRB A;  3MGR B;  3EPJ A;  1P34 C;  3WAA D;  2ZY5 A;  3AZK C;  3AZM A;  4LD9 C;  1M1A B;  3B6F B;  4Z5T B;  3W98 B;  4YM6 D;  3KUY C;  1P3B D;  3AN2 C;  1P3I D;  3AZE B;  4KUD B;  3AZI A;  5AY8 D;  3C1B D;  1TZY C;  5AV8 C;  4HGA C;  3MNN C;  2IO5 B;  5JRG C;  3AZG A;  1H3O A;  2RVQ D;  3VH5 T;  3AV2 B;  2Y2G A;  5B40 B;  4YS3 D;  4XZQ C;  5B32 D;  5G49 B;  1P3K A;  2JSS A;  5B0Z D;  5B2I D;  2NZD A;  5B33 C;  1KU5 A;  1P34 D;  3AZK D;  3H0M C;  1HQ3 C;  3W96 A;  5DNN D;  4XUJ C;  3KWQ B;  4LD9 D;  4CAY A;  5B24 C;  3EPL A;  3REJ B;  3O62 B;  3KUY D;  3VH6 T;  4NE6 A;  1P3P A;  3AN2 D;  3LZ1 B;  1P3O B;  1ID3 A;  5AV9 C;  4G91 B;  3W99 C;  3UT9 B;  2NQB C;  1TZY D;  4J8V C;  3MNN D;  5JRG D;  1AOI B;  1KX5 D;  1U35 B;  5AV5 A;  4WZS B;  5GT3 C;  5AV6 A;  2BG1 A;  5CPI C;  4QLC C;  4ZUX D;  4XZQ D;  1M18 A;  2HIO D;  3X1S A;  3H0L C;  5B33 D;  1F66 A;  3MGP C;  3WKJ A;  1KX4 C;  2BYM A;  2YFW B;  3LZ0 D;  3TU4 D;  3AZJ B;  3EPH A;  3KFU G;  4X23 A;  5F99 C;  5BNV B;  5AVB A;  3EG5 B;  4XUJ D;  1HQ3 D;  1P3F A;  3REI B;  3UTB C;  2CWE A;  4H9R A;  4H9P A;  5BNX B;  3X1U A;  3WAA B;  3AZH A;  1ZLA C;  1EQZ C;  4WU8 A;  5CPK A;  5GT0 A;  5AV9 D;  3W99 D;  2NQB D;  4J8X C;  4J8V D;  3X1T C;  2BYK B;  4YM6 B;  4H9N B;  1P3B B;  1P3I B;  3LJA C;  5GT3 D;  5AY8 B;  3C1B B;  1P3L A;  5CPJ C;  4QLC D;  4WU9 C;  3AZN C;  3REK C;  1B6W A;  2Y2J A;  3AZF A;  3WTP C;  3MGP D;  3AYW C;  4YS3 B;  1KX4 D;  5B32 B;  4H9S A;  5B32 G;  3AV1 C;  5GSU A;  4CSR A;  5B0Z B;  5B2I B;  4G92 C;  4J8W A;  3LEL C;  4KGC A;  3EPK A;  4JJN A;  2ZY2 A;  3UTB D;  4Z66 A;  4UPK A;  1P34 B;  2ZM5 A;  3C1C A;  3UTA A;  3AZK B;  1ZLA D;  5DNN B;  1EQZ D;  4LD9 B;  2XD1 A;  3MGS A;  3F6T A;  3AZM C;  4DRA A;  1PZR A;  4WNN B;  4J8X D;  1F1E A;  3X1T D;  3KUY B;  3AN2 B;  5KDM A;  3WA9 D;  1N1J B;  3LJA D;  1P3A C;  2HUE B;  3MVD A;  1TZY B;  3AZI C;  5CPJ D;  4HGA B;  3MNN B;  5JRG B;  1KX5 B;  1BH8 A;  2FJ7 A;  5CP6 A;  5BS7 A;  3REK D;  3AZG C;  5AVC D;  3WTP D;  5B1L A;  5BO0 B;  4ZUX B;  3AYW D;  4R8P A;  3AV1 D;  2HIO B;  3MGR A;  4WV4 B;  1P3K C;  3LEL D;  5B33 B;  2NZD C;  3LZ0 B;  3TU4 B;  1W2E A;  5B31 G;  3B0C T;  2VQR A;  4XUJ B;  1HQ3 B;  3AZM D;  3W96 C;  2Y2K A;  3AZE A;  5FUG A;  5GXQ D;  4E45 A;  3H0R C;  1P3P C;  5AV9 B;  1A7W A;  1P3A D;  4EO5 C;  1P3M A;  1ID3 C;  3W99 B;  4J8V B;  3W97 A;  3AZI D;  2NQB B;  3AFA D;  2Y2M A;  3B6G B;  4DQY B;  2CV5 D;  5B1M A;  5AV5 C;  3AZG D;  5G49 A;  2L5A A;  5AV6 C;  4QLC B;  1KX3 A;  3A1K A;  4J8U A;  1P3K D;  1M18 C;  3X1S C;  2NZD D;  3MGP B;  3A6N A;  1KX4 B;  3REL A;  3KWQ A;  1F66 C;  3WKJ C;  4M6B A;  4X23 C;  5AVB C;  1TAF A;  2Y2P A;  1JFI B;  3MGQ A;  5B0Y A;  3REJ A;  3UTB B;  1P3F C;  3V9R B;  3X1U C;  1ZLA B;  1EQZ B;  2F8N A;  3AZH C;  1WWI A;  5E5A A;  1P3P D;  4WU8 C;  5CPK C;  5GT0 C;  4J8X B;  5C3I C;  4UUZ A;  3X1T B;  1B67 A;  5B2J A;  3WA9 B;  1P3G A;  3LJA B;  5AV5 D;  5CPJ B;  1P3L C;  5AV6 D;  2PYO A;  3REK B;  4E44 A;  1M18 D;  5AVC B;  3AZF C;  3WTP B;  5BNV A;  3AYW B;  1F66 D;  3AV1 B;  3WKJ D;  3REI A;  4H9S C;  5JA4 A;  5GSU C;  5AVB D;  3LEL B;  3R45 A;  5AV8 D;  4J8W C;  4KGC C;  4NFT A;  4JJN C;  4Z66 C;  5BT1 C;  3X1U D;  3C1C C;  3UTA C;  3AZH D;  3AZM B;  3MGS C;  4WU8 D;  5CPK D;  5GT0 D;  5GXQ B;  4H9O B;  1P3A B;  3FDD A;  3AZI B;  3AFA B;  3MVD C;  1P3L D;  2CV5 B;  1Q9C A;  5B24 D;  5CP6 C;  3AZG B;  2FJ7 C;  5BS7 C;  1H3O B;  3AZF D;  1BFM A;  5B1L C;  1S32 A;  2DQN C;  4R8P C;  5DNM A;  1P3K B;  3MGR C;  1M19 A;  2NZD B;  3A1I A;  5DNN A;  4JJN D;  4Z66 D;  1R4V A;  4AWL C;  5BT1 D;  2ARO A;  3MGS D;  5CPI D;  4CAY B;  3AZE C;  1T3U A;  1P3P B;  1KX5 A;  4EO5 B;  5CHL B;  1P3M C;  3MVD D;  5F99 D;  3W97 C;  2G5H C;  4ZUX A;  5AV5 B;  5B1M C;  3KSY A;  2HIO A;  5AV6 B;  3REH A;  5B1L D;  3NQJ A;  1KX3 C;  4R8P D;  3LZ0 A;  3TU4 A;  1M18 B;  4J8U C;  5B31 A;  2F8N H;  3X1V A;  1F66 B;  3A6N C;  3WKJ B;  2BYM B;  3REL C;  3KWQ C;  3AZL A;  5AVB B;  4Z2M H;  4ZBJ C;  5AV8 B;  2ZY4 A;  3MGQ C;  5B0Y C;  2YFV A;  3REJ C;  4WU9 D;  4H9R B;  3AZN D;  4H9P B;  3X1U B;  3KXB A;  3AZH B;  4G91 C;  4WU8 B;  4H9Q A;  5E5A C;  4XZQ B;  5GT0 B;  5CPK B;  5C3I B;  4NE5 A;  1P3M D;  3B6G A;  3W97 D;  5B2J C;  1P3G C;  1M1A A;  5B1M D;  1P3L B;  3B6F A;  2DF4 C;  4Z5T A;  2PYO C;  3W98 A;  5B24 B;  1KX3 D;  4J8U D;  3NQU B;  3AZF B;  4KUD A;  3A6N D;  3REL D;  3KWQ D;  4CSR B;  3REI C;  2FFF B;  3MGQ D;  5B0Y D;  4JJN B;  3AV2 A;  4Z66 B;  5GT3 B;  5B40 A;  2F8N D;  3IP4 C;  3MGS B;  5CPI B;  3VH5 A;  2J8P A;  3WA9 A;  5E5A D;  5B2J D;  5KDM B;  1P3G D;  3MVD B;  5F99 B;  2RVQ C;  5AVC A;  1BH8 B;  2PYO D;  3W96 D;  3O62 A;  1P3O A;  2Y2O A;  3LZ1 A;  4KHA B;  3UT9 A;  5B1L B;  3VH6 A;  3B0B A;  1ID3 D;  1AOI A;  4R8P B;  1U35 A;  3REI D;  1S32 C;  5DNM C;  1M19 C;  5DNN C;  2RIQ A;  4AWL B;  2ARO C;  5GXQ A;  4H9O A;  4WU9 B;  3AZN B;  1P3A A;  2XD5 A;  5FUG B;  2YFW A;  1BH9 B;  2HUE C;  3AZJ A;  3AFA A;  3X1S D;  1KX5 C;  2CV5 A;  2Y2N A;  1P3M B;  3W97 B;  5BNX A;  2Y2Q A;  4G92 B;  4X23 D;  3WAA A;  1P3F D;  5B1M B;  4ZUX C;  2HIO C;  3REH C;  2BYK A;  4YM6 A;  4H9N A;  1P3B A;  1KX3 B;  1P3I A;  1S32 D;  4J8U B;  3LZ0 C;  5DNM D;  3TU4 C;  5AY8 A;  5B31 C;  3C1B A;  1M19 D;  3A6N B;  3REL B;  3X1V C;  3VH5 W;  2ARO D;  4ZBJ B;  3AZL C;  1TAF B;  3MGQ B;  5B0Y B;  4YS3 A;  1HTA A;  5B32 A;  3KXB C;  2F8N B;  5B0Z A;  2F8N G;  5B2I A;  5E5A B;  3B6G C;  3B0D C;  4Z2M G;  4UUZ B;  5GSU D;  5B2J B;  1P34 A;  3AZK A;  4J8W D;  4LD9 A;  1P3G B;  4KGC D;  1M1A C;  3VH6 W;  4WNN A;  3C1C D;  3B6F C;  3UTA D;  3REH D;  2PYO B;  3W96 B;  3AL0 C;  3KUY A;  4Z5T C;  3AN2 A;  3W98 C;  1N1J A;  4KUD C;  5B31 D;  1TZY A;  5AV8 A;  3MNN A;  5JRG A;  1ID3 B;  3X1V D;  2F2A C;  2IO5 C;  5JA4 B;  3AZL D;  3R45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...