5B33D

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33D00
1P3LA 3X1TB 1KU5A 5AV6D 2RVQC 1P3MA 2PYOA 2FJ7B 4YM6B 3AZFC 4AWLC 2CWEA 3AZJA 1ID3C 4H9PB 5CHLB 5AY8C 5G49B 1HQ3D 3MGQB 5JRGC 3UT9C 3A6ND 1S32B 4H9OA 5B24C 4J8VC 3AZKD 4Z66D 3KUYD 3B6FC 1P3GD 5AVBA 1KX3A 5JA4B 1P3IC 1P3LD 5BT1D 3AZGA 1P34C 1ULYA 5CPIA 3R45B 1P3MD 5C3IB 1P3AC 4XZQB 4E45A 2PYOD 1KX5A 3X1UA 1TAFB 2NZDC 5B31G 4XUJA 4J8WA 3AZJD 3VH6A 3LZ0B 3MGRB 3AZMC 3REHD 3WAAA 1P3KA 2AROC 4G92B 3UTBB 4WU8B 5BO0B 1N1JB 4G91B 3REJB 1P3PB 4J8XB 5AVBD 3RELC 1M19A 5KDMB 1M1AA 1P3OC 3B6FD 3W99C 3AYWC 3B6GA 3TU4B 4HGAC 5CPID 5GXQC 1P34D 2YFVB 3NQUB 5GSUB 3REKA 4X23C 3AN2A 1KX5D 3X1UD 5B31C 5AVCC 4JJNC 2CV5B 4XUJD 4J8WD 3LELA 1P3KD 3MGSC 3KWQB 3AV1C 3B0DB 2AROD 4Z5TC 1P3BA 1KX4C 3X1VB 3AZLC 1AOIA 3NQJA 5AV8A 3KSYA 5B1LA 3O62B 5DNMC 3AZHB 4WU9A 5B40A 1M19D 1M1AD 1BH8A 2YFWA 5B2JB 4H9QA 3B6GD 3AFAB 5BS7A 3AN2D 3REKD 2BYMB 3AZNC 3AV2C 3MGPA 4JJND 3LELD 5B0ZC 3W97B 3WKJC 5CPJA 4WZSB 3MNNB 5CP6B 3MGSD 1KX3B 3X1TC 1P3BD 5FUGA 3AZGB 1AOID 4Z5TD 2F8NG 3B0CW 5AV8D 4YM6C 4R8PA 3W98B 5F99A 4EO5B 5B2IA 1F66B 4WU9D 4UUZA 5AV5C 5B1MB 3WAAB 4NFTA 3AZIB 3MGQC 5GT0D 1S32C 5CPKA 3C1BA 3KXBC 3MGPD 3WTPA 3WTPE 1TZYB 4ZUXA 4J8UB 5CPJD 3REIA 4H9NB 1U35A 2HIOB 5C3IC 4QLCB 5AV9B 4R8PD 5B2ID 5B33B 3LJAB 4CSRA 3WA9B 5AV5D 2L5AA 3LZ0C 5BNXA 3A6NA 3MGRC 4YS3A 4G92C 3UTBC 1JFIA 3X1SB 3UTAA 4WU8C 3AZKA 5CPKD 4LD9B 4G91C 3C1BD 1WWSA 1M18B 1BH9B 3WTPD 5B1LB 5B32D 3REJC 3KXBD 4ZUXD 3REID 4J8XC 3AZED 5B40B 2IO5C 5E5AB 1P3FB 3TU4C 4H9RB 1U35D 3AZFA 5GSUC 3REHA 1ID3A 1B6WA 5AY8A 4KGCB 5JRGA 4YS3D 3UT9A 4KUDD 3KWQC 3B0DC 2HUEB 1F1EA 3UTAD 3V9RA 3MVDC 5B24A 3X1VC 4J8VA 4Z2MG 3B6FA 3O62C 1P3IA 3C1CB 3AZHC 5F99B 2F8NB 1P34A 2RVQD 3VH5A 5B2JC 1P3AA 3AFAC 3AZFD 2NZDA 3LZ1B 4KHAA 4CAYA 4ZBJB 1ID3D 3AZMA 3W96C 2BYKB 5AY8D 2AROA 5JRGD 3UT9D 5GT3C 3W97C 5AV6B 3MNNC 3B0CT 5CP6C 1KX3C 3AZGC 5B24D 3MVDD 4J8VD 3RELA 3W98C 5DNNC 4EO5C 1P3OA 1P3ID 1F66C 3W99A 3AYWA 1HQ3B 5B1MC 5GXQA 5BNXB 3A6NB 1P3AD 3AZIC 4H9SA 4X23A 4WNNA 5B31A 2NZDD 5AVCA 4JJNA 3AZKB 4Z66B 3KUYB 3AZMD 1P3GB 3MGSA 3AV1A 1P3LB 1TZYC 4J8UC 4Z5TA 1KX4A 2NQBC 5B0YC 5GT3D 3AZLA 1P3MB 1ZLAC 1B67A 2PYOB 5DNMA 2HIOC 4QLCC 3RELD 5AV9C 1BFMA 3AZJB 1P3OD 3W99D 5B33C 3LJAC 5DNND 3REHB 3AYWD 3WA9C 5GT0A 5GXQD 4H9OB 4X23D 1EQZC 3X1SC 5B31D 1WWIA 5AVCD 3AZNA 3AV2A 3V9RB 5B24B 4LD9C 5AVBB 5B0ZA 3WKJA 1M18C 3B6FB 3AV1D 3X1TA 4NE3A 1KX4D 5B40C 5CPIB 3AZLD 1P34B 2FJ7C 2NQBD 5B0YD 5E5AC 1P3FC 1ZLAD 4YM6A 1KX5B 3X1UB 5DNMD 3VH5W 5AV5A 4XUJB 4J8WB 4CAYB 1P3KB 4H9PA 4WV4B 4KGCC 2AROB 3VH6W 3MGQA 1S32A 2HUEC 3AZND 3AV2D 1EQZD 5B32A 3KXBA 3AZEA 5B0ZD 1M19B 1M1AB 3WKJD 5JA4A 3C1CC 3W99B 3X1TD 3B6GB 2F8NH 4XZQC 4DRAA 3AN2B 3REKB 2FJ7D 4YM6D 1TAFA 3LZ1C 4WNNB 4JJNB 4KUDA 4ZBJC 3LZ0A 3LELB 3MGRA 1H3OA 3MGSB 3UTBA 3MGQD 4NE5A 1P3BB 4WU8A 5AV6C 1AOIB 4Z5TB 1S32D 3NQJB 1N1JA 5AV8B 1P3PC 4DRBA 3REJA 4WU9B 4J8XA 5KDMA 1BH8B 2YFWB 1Q9CA 4H9QB 2LY8A 1HQ3C 5BNVA 3TU4A 5GT0B 4M6BA 4XZQD 2YFVA 5GSUA 2CV5C 3MGPB 4Z66C 3KUYC 3LZ0D 3MGRD 5CPJB 1P3GC 3KWQA 1P3LC 5BT1C 3UTBD 5FUGB 4WU8D 3MVDA 3X1VA 1P3MC 2PYOC 4R8PB 5B2IB 3O62A 3REJD 1P3PD 3AZHA 4UUZB 4J8XD 5AV5B 3AZJC 3REHC 5B2JA 3TU4D 3AFAA 1R4VA 5GSUD 3B0BA 5CPKB 2BYMA 3C1BB 3W96A 3WTPB 2CV5D 5B32B 3KXBB 4ZUXB 3REIB 5AVBC 3W97A 5GT3A 3AZEB 3KWQD 3MNNA 5CP6A 1U35B 5CPIC 4Z2MH 3X1VD 3VH5T 3O62D 1KX5C 5DNNA 3X1UC 3W98A 3AZHD 1F66A 4CSRB 3WAAC 3VH6T 4XUJC 4J8WC 5B1MA 4YS3B 5B2JD 1P3KC 4KUDB 3AZIA 1H3OB 3AFAD 1JFIB 3UTAB 3W96D 1TZYA 2JSSA 4J8UA 1M19C 1M1AC 3W97D 2NQBA 3MNND 5B0YA 5CP6D 1KX3D 1ZLAA 3B6GC 2IO5B 4H9NA 3AZGD 3AZFB 5BNVB 2HIOA 4QLCA 4AWLB 3REKC 3AN2C 5AV9A 3W98D 4H9SC 1F66D 1ID3B 5B33A 3LJAA 5AY8B 3WA9A 5JRGB 3LELC 5B1MD 3UT9B 3WAAD 3AZID 1EQZA 3X1SA 1P3BC 1AOIC 3MVDB 4J8VB 5AV8C 4LD9A 5B1LC 1M18A 1BH9A 1P3IB 4WU9C 1TZYD 4J8UD 2FJ7A 1P3AB 5E5AA 1P3FA 4H9RA 5GT0C 2NZDB 2HIOD 4QLCD 5BS7C 4KHAB 5AV9D 3AZMB 5B33D 3LJAD 5G49A 3MGPC 3W96B 3WA9D 4KGCA 2F8NK 5CPJC 5B32G 5GT3B 4NE6A 3X1SD 4LD9D 3RELB 4R8PC 1M18D 5B2IC 5F99C 1P3OB 5B1LD 3C1CA 5DNNB 3AYWB 2F8NA 3R45A 5B40D 4HGAB 5GXQB 4XZQA 4E44A 5E5AD 1P3FD 4X23B 5B31B 5AVCB 3LZ1A 1HTAA 5CPKC 1A7WA 3C1BC 2BYKA 3AV1B 3WTPC 5B32C 4KGCD 5BO0A 4ZUXC 3REIC 3AZEC 1KX4B 5AV6A 3AZLB 2NQBB 5B0YB 1ZLAB 1U35C 1P3PA 5DNMB 3C1CD 2F8ND 5F99D 1HQ3A 3A6NC 3NQUA 4YS3C 4KUDC 3UTAC 3AZNB 3AV2B 1EQZB 3LZ1D 3AZKC 2CV5A 4Z66A 3KUYA 5B0ZB 3WKJB 1P3GA
chains in the Genus database with same CATH superfamily
1P3LA 3X1TB 1KU5A 5AV6D 2RVQC 4UPKA 1P3MA 2PYOA 2FJ7B 2G5IC 4YM6B 3AZFC 2JE5A 4AWLC 2CWEA 3AZJA 1ID3C 4H9PB 5CHLB 5AY8C 5G49B 1HQ3D 3MGQB 5JRGC 2W8SA 3UT9C 3A6ND 1S32B 4H9OA 5B24C 2XD5A 4J8VC 3AZKD 4Z66D 3KUYD 3B6FC 1P3GD 5AVBA 1KX3A 5JA4B 1P3IC 1P3LD 5BT1D 3AZGA 2XD1A 1P34C 1ULYA 3EPJA 3R45B 5CPIA 1P3MD 5C3IB 1P3AC 4XZQB 4E45A 2PYOD 1KX5A 3X1UA 1TAFB 2NZDC 5B31G 4XUJA 4J8WA 3AZJD 3VH6A 3LZ0B 3MGRB 3AZMC 3REHD 3WAAA 1P3KA 2AROC 4G92B 3UTBB 4WU8B 5BO0B 2JCHA 1N1JB 4G91B 3REJB 1P3PB 3EG5B 4J8XB 5AVBD 3RELC 1M19A 5KDMB 1M1AA 1P3OC 3B6FD 3W99C 3AYWC 3B6GA 3TU4B 4HGAC 5CPID 5GXQC 1P34D 2YFVB 2Y2HA 3NQUB 5GSUB 4X23C 3REKA 3AN2A 1KX5D 3X1UD 5B31C 5AVCC 4JJNC 2CV5B 4XUJD 4J8WD 3LELA 1P3KD 3MGSC 3KWQB 3AV1C 3B0DB 2AROD 3P5JB 4Z5TC 1P3BA 1KX4C 3X1VB 3AZLC 1AOIA 3NQJA 5AV8A 3KSYA 5B1LA 3O62B 5DNMC 3AZHB 4WU9A 5B40A 1M19D 1M1AD 1BH8A 2YFWA 5B2JB 4H9QA 3B6GD 3AFAB 5BS7A 3AN2D 3REKD 2BYMB 3AZNC 3AV2C 3MGPA 4JJND 3LELD 5B0ZC 3W97B 3WKJC 5CPJA 4WZSB 3MNNB 5CP6B 3MGSD 1KX3B 4DQYB 3X1TC 1P3BD 5FUGA 3AZGB 1AOID 4Z5TD 2F8NG 3B0CW 5AV8D 4YM6C 4R8PA 3W98B 5F99A 4EO5B 5B2IA 1F66B 4WU9D 4UUZA 5AV5C 5B1MB 3WAAB 4NFTA 3AZIB 2Y2PA 3EPKA 3MGQC 5GT0D 1S32C 5CPKA 3C1BA 3KXBC 3MGPD 3WTPA 3WTPE 1TZYB 4ZUXA 4J8UB 5CPJD 3REIA 4H9NB 1U35A 3IP4C 2HIOB 5C3IC 4QLCB 5AV9B 4R8PD 5B2ID 5B33B 3LJAB 4CSRA 3WA9B 5AV5D 2L5AA 3LZ0C 5BNXA 3A6NA 3MGRC 4YS3A 4G92C 3UTBC 1JFIA 3X1SB 3UTAA 4WU8C 3AZKA 5CPKD 4LD9B 4G91C 3C1BD 1WWSA 1M18B 1BH9B 3WTPD 5B1LB 5B32D 3REJC 3KXBD 4ZUXD 3REID 4J8XC 3AZED 5B40B 2IO5C 5E5AB 1P3FB 3TU4C 4H9RB 1U35D 3AZFA 5GSUC 3REHA 1ID3A 2VQRA 1B6WA 5AY8A 4KGCB 2ZY4A 5JRGA 4YS3D 3UT9A 4KUDD 3KWQC 3B0DC 2RIQA 2HUEB 1F1EA 3UTAD 2G5HC 3V9RA 3MVDC 5B24A 3X1VC 4J8VA 4Z2MG 3B6FA 3O62C 1P3IA 3C1CB 3AZHC 5F99B 2F8NB 1P34A 2RVQD 3VH5A 5B2JC 1P3AA 3AFAC 3AZFD 2NZDA 3LZ1B 4KHAA 4CAYA 1T3UA 4ZBJB 1ID3D 3AZMA 3W96C 2BYKB 5AY8D 2AROA 5JRGD 3UT9D 5GT3C 3W97C 5AV6B 3MNNC 3B0CT 5CP6C 1KX3C 3H0LC 3AZGC 5B24D 3MVDD 4J8VD 3RELA 3W98C 5DNNC 4EO5C 1P3OA 1P3ID 1F66C 3W99A 3AYWA 1HQ3B 5B1MC 5GXQA 5BNXB 3A6NB 1P3AD 3AZIC 4H9SA 4X23A 4WNNA 5B31A 2NZDD 5AVCA 4JJNA 3AZKB 4Z66B 3KUYB 3AZMD 1P3GB 3MGSA 3AV1A 1P3LB 1TZYC 4J8UC 4Z5TA 1KX4A 2NQBC 5B0YC 5GT3D 3AZLA 1P3MB 1ZLAC 1B67A 2PYOB 5DNMA 2HIOC 4QLCC 3RELD 5AV9C 1BFMA 3AZJB 1P3OD 3W99D 5B33C 3LJAC 5DNND 3REHB 3AYWD 2ZY5A 3WA9C 5GT0A 5GXQD 2Y2JA 4H9OB 4X23D 1EQZC 3X1SC 5B31D 1WWIA 5AVCD 3AZNA 3AV2A 3V9RB 5B24B 4LD9C 5AVBB 5B0ZA 2ZM5A 1M18C 3B6FB 3AV1D 3WKJA 2Y2IA 3X1TA 4NE3A 1KX4D 5B40C 5CPIB 3AZLD 1P34B 2FJ7C 2NQBD 5B0YD 5E5AC 1P3FC 1ZLAD 4YM6A 2FFFB 3X1UB 5DNMD 1KX5B 3VH5W 5AV5A 4XUJB 4J8WB 4CAYB 1P3KB 4H9PA 4WV4B 4KGCC 2AROB 3VH6W 3MGQA 1S32A 2HUEC 3AZND 3AV2D 1EQZD 5B32A 3H0RC 3KXBA 3AZEA 5B0ZD 1M19B 1M1AB 3WKJD 3FDDA 5JA4A 3C1CC 3W99B 3X1TD 3B6GB 2F8NH 4XZQC 4DRAA 3AN2B 3REKB 2FJ7D 4YM6D 1TAFA 3LZ1C 4WNNB 4JJNB 4KUDA 4ZBJC 3LZ0A 3LELB 3MGRA 1H3OA 3MGSB 3UTBA 3MGQD 4NE5A 1P3BB 4WU8A 5AV6C 1AOIB 4Z5TB 1S32D 3NQJB 1N1JA 5AV8B 1P3PC 1W2EA 4DRBA 3REJA 4WU9B 4J8XA 5KDMA 1BH8B 2YFWB 1Q9CA 2J8PA 4H9QB 2LY8A 1HQ3C 5BNVA 3TU4A 5GT0B 4M6BA 4XZQD 2YFVA 5GSUA 2CV5C 3MGPB 4Z66C 3A1KA 3LZ0D 3KUYC 3MGRD 5CPJB 2Y2NA 1P3GC 3KWQA 1P3LC 5BT1C 3UTBD 5FUGB 4WU8D 3MVDA 3X1VA 1P3MC 2PYOC 4R8PB 5B2IB 3O62A 3REJD 1P3PD 3AZHA 4UUZB 4J8XD 5AV5B 2Y2KA 3AZJC 3REHC 5B2JA 3TU4D 1Z2CB 3AFAA 1R4VA 5GSUD 3B0BA 5CPKB 2Y2MA 2BYMA 3C1BB 3W96A 2Y2OA 3WTPB 2CV5D 5B32B 3KXBB 4ZUXB 3REIB 5AVBC 3W97A 5GT3A 3AZEB 3KWQD 3MNNA 5CP6A 1U35B 5CPIC 4Z2MH 3X1VD 3VH5T 3O62D 1KX5C 5DNNA 3X1UC 3W98A 3AZHD 1F66A 4CSRB 2Y2QA 3WAAC 3VH6T 4XUJC 4J8WC 2ZY3A 5B1MA 4YS3B 5B2JD 1P3KC 4KUDB 3AZIA 1H3OB 3AFAD 1JFIB 3UTAB 3KFUG 3W96D 2Y2GA 1TZYA 2JSSA 4J8UA 1M19C 1M1AC 3W97D 2NQBA 3MNND 5B0YA 5CP6D 1KX3D 2DF4C 1ZLAA 3B6GC 2IO5B 4H9NA 3AZGD 3AZFB 2UWXA 5BNVB 2HIOA 4QLCA 4AWLB 3REKC 3AN2C 5AV9A 3W98D 4H9SC 1F66D 1ID3B 5B33A 3LJAA 5AY8B 3WA9A 3AL0C 5JRGB 3LELC 5B1MD 3UT9B 3WAAD 3AZID 1EQZA 3X1SA 1P3BC 1AOIC 3MVDB 4J8VB 5AV8C 4LD9A 3EPLA 5B1LC 3A1IA 1M18A 1BH9A 1P3IB 4WU9C 1TZYD 4J8UD 3EPHA 3F6TA 2DQNC 3H0MC 1P3AB 2FJ7A 5E5AA 1P3FA 4H9RA 5GT0C 2NZDB 2HIOD 4QLCD 5BS7C 4KHAB 5AV9D 3AZMB 5B33D 3LJAD 5G49A 3MGPC 3W96B 3WA9D 4KGCA 2F8NK 2Y2LA 5CPJC 5B32G 5GT3B 4NE6A 3X1SD 2BG1A 4LD9D 3RELB 4R8PC 1M18D 5B2IC 5F99C 1P3OB 5B1LD 3C1CA 5DNNB 3AYWB 2F8NA 2ZY2A 3R45A 4HGAB 5B40D 5GXQB 4XZQA 4E44A 5E5AD 1P3FD 4X23B 5B31B 5AVCB 3LZ1A 1HTAA 5CPKC 1A7WA 3C1BC 2BYKA 3AV1B 3WTPC 5B32C 4KGCD 5BO0A 4ZUXC 3REIC 3AZEC 1PZRA 1KX4B 5AV6A 3AZLB 2NQBB 5B0YB 4WJ3C 1ZLAB 1U35C 1P3PA 5DNMB 3C1CD 2F8ND 5F99D 1HQ3A 3A6NC 3NQUA 4YS3C 4KUDC 3UTAC 3AZNB 3AV2B 1EQZB 3LZ1D 3AZKC 2CV5A 4Z66A 3KUYA 2F2AC 5B0ZB 3WKJB 1P3GA
chains in the Genus database with same CATH topology
1P3LA 3X1TB 1KU5A 5AV6D 2RVQC 4UPKA 1P3MA 2PYOA 2FJ7B 2G5IC 4YM6B 3AZFC 2JE5A 4AWLC 2CWEA 3AZJA 1ID3C 4H9PB 5CHLB 5AY8C 5G49B 1HQ3D 3MGQB 5JRGC 2W8SA 3UT9C 3A6ND 1S32B 4H9OA 5B24C 2XD5A 4J8VC 3AZKD 4Z66D 3KUYD 3B6FC 1P3GD 5AVBA 1KX3A 5JA4B 1P3IC 1P3LD 5BT1D 3AZGA 2XD1A 1P34C 1ULYA 3EPJA 3R45B 5CPIA 1P3MD 5C3IB 1P3AC 4XZQB 4E45A 2PYOD 1KX5A 3X1UA 1TAFB 2NZDC 5B31G 4XUJA 4J8WA 3AZJD 3VH6A 3LZ0B 3MGRB 3AZMC 3REHD 3WAAA 1P3KA 2AROC 4G92B 3UTBB 4WU8B 5BO0B 2JCHA 1N1JB 4G91B 3REJB 1P3PB 3EG5B 4J8XB 5AVBD 3RELC 1M19A 5KDMB 1M1AA 1P3OC 3B6FD 3W99C 3AYWC 3B6GA 3TU4B 4HGAC 5CPID 5GXQC 1P34D 2YFVB 2Y2HA 3NQUB 5GSUB 4X23C 3REKA 3AN2A 1KX5D 3X1UD 5B31C 5AVCC 4JJNC 2CV5B 4XUJD 4J8WD 3LELA 1P3KD 3MGSC 3KWQB 3AV1C 3B0DB 2AROD 3P5JB 4Z5TC 1P3BA 1KX4C 3X1VB 3AZLC 1AOIA 3NQJA 5AV8A 3KSYA 5B1LA 3O62B 5DNMC 3AZHB 4WU9A 5B40A 1M19D 1M1AD 1BH8A 2YFWA 5B2JB 4H9QA 3B6GD 3AFAB 5BS7A 3AN2D 3REKD 2BYMB 3AZNC 3AV2C 3MGPA 4JJND 3LELD 5B0ZC 3W97B 3WKJC 5CPJA 4WZSB 3MNNB 5CP6B 3MGSD 1KX3B 4DQYB 3X1TC 1P3BD 5FUGA 3AZGB 1AOID 4Z5TD 2F8NG 3B0CW 5AV8D 4YM6C 4R8PA 3W98B 5F99A 4EO5B 5B2IA 1F66B 4WU9D 4UUZA 5AV5C 5B1MB 3WAAB 4NFTA 3AZIB 2Y2PA 3EPKA 3MGQC 5GT0D 1S32C 5CPKA 3C1BA 3KXBC 3MGPD 3WTPA 3WTPE 1TZYB 4ZUXA 4J8UB 5CPJD 3REIA 4H9NB 1U35A 3IP4C 2HIOB 5C3IC 4QLCB 5AV9B 4R8PD 5B2ID 5B33B 3LJAB 4CSRA 3WA9B 5AV5D 2L5AA 3LZ0C 5BNXA 3A6NA 3MGRC 4YS3A 4G92C 3UTBC 1JFIA 3X1SB 3UTAA 4WU8C 3AZKA 5CPKD 4LD9B 4G91C 3C1BD 1WWSA 1M18B 1BH9B 3WTPD 5B1LB 5B32D 3REJC 3KXBD 4ZUXD 3REID 4J8XC 3AZED 5B40B 2IO5C 5E5AB 1P3FB 3TU4C 4H9RB 1U35D 3AZFA 5GSUC 3REHA 1ID3A 2VQRA 1B6WA 5AY8A 4KGCB 2ZY4A 5JRGA 4YS3D 3UT9A 4KUDD 3KWQC 3B0DC 2RIQA 2HUEB 1F1EA 3UTAD 2G5HC 3V9RA 3MVDC 5B24A 3X1VC 4J8VA 4Z2MG 3B6FA 3O62C 1P3IA 3C1CB 3AZHC 5F99B 2F8NB 1P34A 2RVQD 3VH5A 5B2JC 1P3AA 3AFAC 3AZFD 2NZDA 3LZ1B 4KHAA 4CAYA 1T3UA 4ZBJB 1ID3D 3AZMA 3W96C 2BYKB 5AY8D 2AROA 5JRGD 3UT9D 5GT3C 3W97C 5AV6B 3MNNC 3B0CT 5CP6C 1KX3C 3H0LC 3AZGC 5B24D 3MVDD 4J8VD 3RELA 3W98C 5DNNC 4EO5C 1P3OA 1P3ID 1F66C 3W99A 3AYWA 1HQ3B 5B1MC 5GXQA 5BNXB 3A6NB 1P3AD 3AZIC 4H9SA 4X23A 4WNNA 5B31A 2NZDD 5AVCA 4JJNA 3AZKB 4Z66B 3KUYB 3AZMD 1P3GB 3MGSA 3AV1A 1P3LB 1TZYC 4J8UC 4Z5TA 1KX4A 2NQBC 5B0YC 5GT3D 3AZLA 1P3MB 1ZLAC 1B67A 2PYOB 5DNMA 2HIOC 4QLCC 3RELD 5AV9C 1BFMA 3AZJB 1P3OD 3W99D 5B33C 3LJAC 5DNND 3REHB 3AYWD 2ZY5A 3WA9C 5GT0A 5GXQD 2Y2JA 4H9OB 4X23D 1EQZC 3X1SC 5B31D 1WWIA 5AVCD 3AZNA 3AV2A 3V9RB 5B24B 4LD9C 5AVBB 5B0ZA 2ZM5A 1M18C 3B6FB 3AV1D 3WKJA 2Y2IA 3X1TA 4NE3A 1KX4D 5B40C 5CPIB 3AZLD 1P34B 2FJ7C 2NQBD 5B0YD 5E5AC 1P3FC 1ZLAD 4YM6A 2FFFB 3X1UB 5DNMD 1KX5B 3VH5W 5AV5A 4XUJB 4J8WB 4CAYB 1P3KB 4H9PA 4WV4B 4KGCC 2AROB 3VH6W 3MGQA 1S32A 2HUEC 3AZND 3AV2D 1EQZD 5B32A 3H0RC 3KXBA 3AZEA 5B0ZD 1M19B 1M1AB 3WKJD 3FDDA 5JA4A 3C1CC 3W99B 3X1TD 3B6GB 2F8NH 4XZQC 4DRAA 3AN2B 3REKB 2FJ7D 4YM6D 1TAFA 3LZ1C 4WNNB 4JJNB 4KUDA 4ZBJC 3LZ0A 3LELB 3MGRA 1H3OA 3MGSB 3UTBA 3MGQD 4NE5A 1P3BB 4WU8A 5AV6C 1AOIB 4Z5TB 1S32D 3NQJB 1N1JA 5AV8B 1P3PC 1W2EA 4DRBA 3REJA 4WU9B 4J8XA 5KDMA 1BH8B 2YFWB 1Q9CA 2J8PA 4H9QB 2LY8A 1HQ3C 5BNVA 3TU4A 5GT0B 4M6BA 4XZQD 2YFVA 5GSUA 2CV5C 3MGPB 4Z66C 3A1KA 3LZ0D 3KUYC 3MGRD 5CPJB 2Y2NA 1P3GC 3KWQA 1P3LC 5BT1C 3UTBD 5FUGB 4WU8D 3MVDA 3X1VA 1P3MC 2PYOC 4R8PB 5B2IB 3O62A 3REJD 1P3PD 3AZHA 4UUZB 4J8XD 5AV5B 2Y2KA 3AZJC 3REHC 5B2JA 3TU4D 1Z2CB 3AFAA 1R4VA 5GSUD 3B0BA 5CPKB 2Y2MA 2BYMA 3C1BB 3W96A 2Y2OA 3WTPB 2CV5D 5B32B 3KXBB 4ZUXB 3REIB 5AVBC 3W97A 5GT3A 3AZEB 3KWQD 3MNNA 5CP6A 1U35B 5CPIC 4Z2MH 3X1VD 3VH5T 3O62D 1KX5C 5DNNA 3X1UC 3W98A 3AZHD 1F66A 4CSRB 2Y2QA 3WAAC 3VH6T 4XUJC 4J8WC 2ZY3A 5B1MA 4YS3B 5B2JD 1P3KC 4KUDB 3AZIA 1H3OB 3AFAD 1JFIB 3UTAB 3KFUG 3W96D 2Y2GA 1TZYA 2JSSA 4J8UA 1M19C 1M1AC 3W97D 2NQBA 3MNND 5B0YA 5CP6D 1KX3D 2DF4C 1ZLAA 3B6GC 2IO5B 4H9NA 3AZGD 3AZFB 2UWXA 5BNVB 2HIOA 4QLCA 4AWLB 3REKC 3AN2C 5AV9A 3W98D 4H9SC 1F66D 1ID3B 5B33A 3LJAA 5AY8B 3WA9A 3AL0C 5JRGB 3LELC 5B1MD 3UT9B 3WAAD 3AZID 1EQZA 3X1SA 1P3BC 1AOIC 3MVDB 4J8VB 5AV8C 4LD9A 3EPLA 5B1LC 3A1IA 1M18A 1BH9A 1P3IB 4WU9C 1TZYD 4J8UD 3EPHA 3F6TA 2DQNC 3H0MC 1P3AB 2FJ7A 5E5AA 1P3FA 4H9RA 5GT0C 2NZDB 2HIOD 4QLCD 5BS7C 4KHAB 5AV9D 3AZMB 5B33D 3LJAD 5G49A 3MGPC 3W96B 3WA9D 4KGCA 2F8NK 2Y2LA 5CPJC 5B32G 5GT3B 4NE6A 3X1SD 2BG1A 4LD9D 3RELB 4R8PC 1M18D 5B2IC 5F99C 1P3OB 5B1LD 3C1CA 5DNNB 3AYWB 2F8NA 2ZY2A 3R45A 4HGAB 5B40D 5GXQB 4XZQA 4E44A 5E5AD 1P3FD 4X23B 5B31B 5AVCB 3LZ1A 1HTAA 5CPKC 1A7WA 3C1BC 2BYKA 3AV1B 3WTPC 5B32C 4KGCD 5BO0A 4ZUXC 3REIC 3AZEC 1PZRA 1KX4B 5AV6A 3AZLB 2NQBB 5B0YB 4WJ3C 1ZLAB 1U35C 1P3PA 5DNMB 3C1CD 2F8ND 5F99D 1HQ3A 3A6NC 3NQUA 4YS3C 4KUDC 3UTAC 3AZNB 3AV2B 1EQZB 3LZ1D 3AZKC 2CV5A 4Z66A 3KUYA 2F2AC 5B0ZB 3WKJB 1P3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3L A;  3X1T B;  1KU5 A;  5AV6 D;  2RVQ C;  1P3M A;  2PYO A;  2FJ7 B;  4YM6 B;  3AZF C;  4AWL C;  2CWE A;  3AZJ A;  1ID3 C;  4H9P B;  5CHL B;  5AY8 C;  5G49 B;  1HQ3 D;  3MGQ B;  5JRG C;  3UT9 C;  3A6N D;  1S32 B;  4H9O A;  5B24 C;  4J8V C;  3AZK D;  4Z66 D;  3KUY D;  3B6F C;  1P3G D;  5AVB A;  1KX3 A;  5JA4 B;  1P3I C;  1P3L D;  5BT1 D;  3AZG A;  1P34 C;  1ULY A;  5CPI A;  3R45 B;  1P3M D;  5C3I B;  1P3A C;  4XZQ B;  4E45 A;  2PYO D;  1KX5 A;  3X1U A;  1TAF B;  2NZD C;  5B31 G;  4XUJ A;  4J8W A;  3AZJ D;  3VH6 A;  3LZ0 B;  3MGR B;  3AZM C;  3REH D;  3WAA A;  1P3K A;  2ARO C;  4G92 B;  3UTB B;  4WU8 B;  5BO0 B;  1N1J B;  4G91 B;  3REJ B;  1P3P B;  4J8X B;  5AVB D;  3REL C;  1M19 A;  5KDM B;  1M1A A;  1P3O C;  3B6F D;  3W99 C;  3AYW C;  3B6G A;  3TU4 B;  4HGA C;  5CPI D;  5GXQ C;  1P34 D;  2YFV B;  3NQU B;  5GSU B;  3REK A;  4X23 C;  3AN2 A;  1KX5 D;  3X1U D;  5B31 C;  5AVC C;  4JJN C;  2CV5 B;  4XUJ D;  4J8W D;  3LEL A;  1P3K D;  3MGS C;  3KWQ B;  3AV1 C;  3B0D B;  2ARO D;  4Z5T C;  1P3B A;  1KX4 C;  3X1V B;  3AZL C;  1AOI A;  3NQJ A;  5AV8 A;  3KSY A;  5B1L A;  3O62 B;  5DNM C;  3AZH B;  4WU9 A;  5B40 A;  1M19 D;  1M1A D;  1BH8 A;  2YFW A;  5B2J B;  4H9Q A;  3B6G D;  3AFA B;  5BS7 A;  3AN2 D;  3REK D;  2BYM B;  3AZN C;  3AV2 C;  3MGP A;  4JJN D;  3LEL D;  5B0Z C;  3W97 B;  3WKJ C;  5CPJ A;  4WZS B;  3MNN B;  5CP6 B;  3MGS D;  1KX3 B;  3X1T C;  1P3B D;  5FUG A;  3AZG B;  1AOI D;  4Z5T D;  2F8N G;  3B0C W;  5AV8 D;  4YM6 C;  4R8P A;  3W98 B;  5F99 A;  4EO5 B;  5B2I A;  1F66 B;  4WU9 D;  4UUZ A;  5AV5 C;  5B1M B;  3WAA B;  4NFT A;  3AZI B;  3MGQ C;  5GT0 D;  1S32 C;  5CPK A;  3C1B A;  3KXB C;  3MGP D;  3WTP A;  3WTP E;  1TZY B;  4ZUX A;  4J8U B;  5CPJ D;  3REI A;  4H9N B;  1U35 A;  2HIO B;  5C3I C;  4QLC B;  5AV9 B;  4R8P D;  5B2I D;  5B33 B;  3LJA B;  4CSR A;  3WA9 B;  5AV5 D;  2L5A A;  3LZ0 C;  5BNX A;  3A6N A;  3MGR C;  4YS3 A;  4G92 C;  3UTB C;  1JFI A;  3X1S B;  3UTA A;  4WU8 C;  3AZK A;  5CPK D;  4LD9 B;  4G91 C;  3C1B D;  1WWS A;  1M18 B;  1BH9 B;  3WTP D;  5B1L B;  5B32 D;  3REJ C;  3KXB D;  4ZUX D;  3REI D;  4J8X C;  3AZE D;  5B40 B;  2IO5 C;  5E5A B;  1P3F B;  3TU4 C;  4H9R B;  1U35 D;  3AZF A;  5GSU C;  3REH A;  1ID3 A;  1B6W A;  5AY8 A;  4KGC B;  5JRG A;  4YS3 D;  3UT9 A;  4KUD D;  3KWQ C;  3B0D C;  2HUE B;  1F1E A;  3UTA D;  3V9R A;  3MVD C;  5B24 A;  3X1V C;  4J8V A;  4Z2M G;  3B6F A;  3O62 C;  1P3I A;  3C1C B;  3AZH C;  5F99 B;  2F8N B;  1P34 A;  2RVQ D;  3VH5 A;  5B2J C;  1P3A A;  3AFA C;  3AZF D;  2NZD A;  3LZ1 B;  4KHA A;  4CAY A;  4ZBJ B;  1ID3 D;  3AZM A;  3W96 C;  2BYK B;  5AY8 D;  2ARO A;  5JRG D;  3UT9 D;  5GT3 C;  3W97 C;  5AV6 B;  3MNN C;  3B0C T;  5CP6 C;  1KX3 C;  3AZG C;  5B24 D;  3MVD D;  4J8V D;  3REL A;  3W98 C;  5DNN C;  4EO5 C;  1P3O A;  1P3I D;  1F66 C;  3W99 A;  3AYW A;  1HQ3 B;  5B1M C;  5GXQ A;  5BNX B;  3A6N B;  1P3A D;  3AZI C;  4H9S A;  4X23 A;  4WNN A;  5B31 A;  2NZD D;  5AVC A;  4JJN A;  3AZK B;  4Z66 B;  3KUY B;  3AZM D;  1P3G B;  3MGS A;  3AV1 A;  1P3L B;  1TZY C;  4J8U C;  4Z5T A;  1KX4 A;  2NQB C;  5B0Y C;  5GT3 D;  3AZL A;  1P3M B;  1ZLA C;  1B67 A;  2PYO B;  5DNM A;  2HIO C;  4QLC C;  3REL D;  5AV9 C;  1BFM A;  3AZJ B;  1P3O D;  3W99 D;  5B33 C;  3LJA C;  5DNN D;  3REH B;  3AYW D;  3WA9 C;  5GT0 A;  5GXQ D;  4H9O B;  4X23 D;  1EQZ C;  3X1S C;  5B31 D;  1WWI A;  5AVC D;  3AZN A;  3AV2 A;  3V9R B;  5B24 B;  4LD9 C;  5AVB B;  5B0Z A;  3WKJ A;  1M18 C;  3B6F B;  3AV1 D;  3X1T A;  4NE3 A;  1KX4 D;  5B40 C;  5CPI B;  3AZL D;  1P34 B;  2FJ7 C;  2NQB D;  5B0Y D;  5E5A C;  1P3F C;  1ZLA D;  4YM6 A;  1KX5 B;  3X1U B;  5DNM D;  3VH5 W;  5AV5 A;  4XUJ B;  4J8W B;  4CAY B;  1P3K B;  4H9P A;  4WV4 B;  4KGC C;  2ARO B;  3VH6 W;  3MGQ A;  1S32 A;  2HUE C;  3AZN D;  3AV2 D;  1EQZ D;  5B32 A;  3KXB A;  3AZE A;  5B0Z D;  1M19 B;  1M1A B;  3WKJ D;  5JA4 A;  3C1C C;  3W99 B;  3X1T D;  3B6G B;  2F8N H;  4XZQ C;  4DRA A;  3AN2 B;  3REK B;  2FJ7 D;  4YM6 D;  1TAF A;  3LZ1 C;  4WNN B;  4JJN B;  4KUD A;  4ZBJ C;  3LZ0 A;  3LEL B;  3MGR A;  1H3O A;  3MGS B;  3UTB A;  3MGQ D;  4NE5 A;  1P3B B;  4WU8 A;  5AV6 C;  1AOI B;  4Z5T B;  1S32 D;  3NQJ B;  1N1J A;  5AV8 B;  1P3P C;  4DRB A;  3REJ A;  4WU9 B;  4J8X A;  5KDM A;  1BH8 B;  2YFW B;  1Q9C A;  4H9Q B;  2LY8 A;  1HQ3 C;  5BNV A;  3TU4 A;  5GT0 B;  4M6B A;  4XZQ D;  2YFV A;  5GSU A;  2CV5 C;  3MGP B;  4Z66 C;  3KUY C;  3LZ0 D;  3MGR D;  5CPJ B;  1P3G C;  3KWQ A;  1P3L C;  5BT1 C;  3UTB D;  5FUG B;  4WU8 D;  3MVD A;  3X1V A;  1P3M C;  2PYO C;  4R8P B;  5B2I B;  3O62 A;  3REJ D;  1P3P D;  3AZH A;  4UUZ B;  4J8X D;  5AV5 B;  3AZJ C;  3REH C;  5B2J A;  3TU4 D;  3AFA A;  1R4V A;  5GSU D;  3B0B A;  5CPK B;  2BYM A;  3C1B B;  3W96 A;  3WTP B;  2CV5 D;  5B32 B;  3KXB B;  4ZUX B;  3REI B;  5AVB C;  3W97 A;  5GT3 A;  3AZE B;  3KWQ D;  3MNN A;  5CP6 A;  1U35 B;  5CPI C;  4Z2M H;  3X1V D;  3VH5 T;  3O62 D;  1KX5 C;  5DNN A;  3X1U C;  3W98 A;  3AZH D;  1F66 A;  4CSR B;  3WAA C;  3VH6 T;  4XUJ C;  4J8W C;  5B1M A;  4YS3 B;  5B2J D;  1P3K C;  4KUD B;  3AZI A;  1H3O B;  3AFA D;  1JFI B;  3UTA B;  3W96 D;  1TZY A;  2JSS A;  4J8U A;  1M19 C;  1M1A C;  3W97 D;  2NQB A;  3MNN D;  5B0Y A;  5CP6 D;  1KX3 D;  1ZLA A;  3B6G C;  2IO5 B;  4H9N A;  3AZG D;  3AZF B;  5BNV B;  2HIO A;  4QLC A;  4AWL B;  3REK C;  3AN2 C;  5AV9 A;  3W98 D;  4H9S C;  1F66 D;  1ID3 B;  5B33 A;  3LJA A;  5AY8 B;  3WA9 A;  5JRG B;  3LEL C;  5B1M D;  3UT9 B;  3WAA D;  3AZI D;  1EQZ A;  3X1S A;  1P3B C;  1AOI C;  3MVD B;  4J8V B;  5AV8 C;  4LD9 A;  5B1L C;  1M18 A;  1BH9 A;  1P3I B;  4WU9 C;  1TZY D;  4J8U D;  2FJ7 A;  1P3A B;  5E5A A;  1P3F A;  4H9R A;  5GT0 C;  2NZD B;  2HIO D;  4QLC D;  5BS7 C;  4KHA B;  5AV9 D;  3AZM B;  5B33 D;  3LJA D;  5G49 A;  3MGP C;  3W96 B;  3WA9 D;  4KGC A;  2F8N K;  5CPJ C;  5B32 G;  5GT3 B;  4NE6 A;  3X1S D;  4LD9 D;  3REL B;  4R8P C;  1M18 D;  5B2I C;  5F99 C;  1P3O B;  5B1L D;  3C1C A;  5DNN B;  3AYW B;  2F8N A;  3R45 A;  5B40 D;  4HGA B;  5GXQ B;  4XZQ A;  4E44 A;  5E5A D;  1P3F D;  4X23 B;  5B31 B;  5AVC B;  3LZ1 A;  1HTA A;  5CPK C;  1A7W A;  3C1B C;  2BYK A;  3AV1 B;  3WTP C;  5B32 C;  4KGC D;  5BO0 A;  4ZUX C;  3REI C;  3AZE C;  1KX4 B;  5AV6 A;  3AZL B;  2NQB B;  5B0Y B;  1ZLA B;  1U35 C;  1P3P A;  5DNM B;  3C1C D;  2F8N D;  5F99 D;  1HQ3 A;  3A6N C;  3NQU A;  4YS3 C;  4KUD C;  3UTA C;  3AZN B;  3AV2 B;  1EQZ B;  3LZ1 D;  3AZK C;  2CV5 A;  4Z66 A;  3KUY A;  5B0Z B;  3WKJ B;  1P3G A; 
#chains in the Genus database with same CATH topology
 1P3L A;  3X1T B;  1KU5 A;  5AV6 D;  2RVQ C;  4UPK A;  1P3M A;  2PYO A;  2FJ7 B;  2G5I C;  4YM6 B;  3AZF C;  2JE5 A;  4AWL C;  2CWE A;  3AZJ A;  1ID3 C;  4H9P B;  5CHL B;  5AY8 C;  5G49 B;  1HQ3 D;  3MGQ B;  5JRG C;  2W8S A;  3UT9 C;  3A6N D;  1S32 B;  4H9O A;  5B24 C;  2XD5 A;  4J8V C;  3AZK D;  4Z66 D;  3KUY D;  3B6F C;  1P3G D;  5AVB A;  1KX3 A;  5JA4 B;  1P3I C;  1P3L D;  5BT1 D;  3AZG A;  2XD1 A;  1P34 C;  1ULY A;  3EPJ A;  3R45 B;  5CPI A;  1P3M D;  5C3I B;  1P3A C;  4XZQ B;  4E45 A;  2PYO D;  1KX5 A;  3X1U A;  1TAF B;  2NZD C;  5B31 G;  4XUJ A;  4J8W A;  3AZJ D;  3VH6 A;  3LZ0 B;  3MGR B;  3AZM C;  3REH D;  3WAA A;  1P3K A;  2ARO C;  4G92 B;  3UTB B;  4WU8 B;  5BO0 B;  2JCH A;  1N1J B;  4G91 B;  3REJ B;  1P3P B;  3EG5 B;  4J8X B;  5AVB D;  3REL C;  1M19 A;  5KDM B;  1M1A A;  1P3O C;  3B6F D;  3W99 C;  3AYW C;  3B6G A;  3TU4 B;  4HGA C;  5CPI D;  5GXQ C;  1P34 D;  2YFV B;  2Y2H A;  3NQU B;  5GSU B;  4X23 C;  3REK A;  3AN2 A;  1KX5 D;  3X1U D;  5B31 C;  5AVC C;  4JJN C;  2CV5 B;  4XUJ D;  4J8W D;  3LEL A;  1P3K D;  3MGS C;  3KWQ B;  3AV1 C;  3B0D B;  2ARO D;  3P5J B;  4Z5T C;  1P3B A;  1KX4 C;  3X1V B;  3AZL C;  1AOI A;  3NQJ A;  5AV8 A;  3KSY A;  5B1L A;  3O62 B;  5DNM C;  3AZH B;  4WU9 A;  5B40 A;  1M19 D;  1M1A D;  1BH8 A;  2YFW A;  5B2J B;  4H9Q A;  3B6G D;  3AFA B;  5BS7 A;  3AN2 D;  3REK D;  2BYM B;  3AZN C;  3AV2 C;  3MGP A;  4JJN D;  3LEL D;  5B0Z C;  3W97 B;  3WKJ C;  5CPJ A;  4WZS B;  3MNN B;  5CP6 B;  3MGS D;  1KX3 B;  4DQY B;  3X1T C;  1P3B D;  5FUG A;  3AZG B;  1AOI D;  4Z5T D;  2F8N G;  3B0C W;  5AV8 D;  4YM6 C;  4R8P A;  3W98 B;  5F99 A;  4EO5 B;  5B2I A;  1F66 B;  4WU9 D;  4UUZ A;  5AV5 C;  5B1M B;  3WAA B;  4NFT A;  3AZI B;  2Y2P A;  3EPK A;  3MGQ C;  5GT0 D;  1S32 C;  5CPK A;  3C1B A;  3KXB C;  3MGP D;  3WTP A;  3WTP E;  1TZY B;  4ZUX A;  4J8U B;  5CPJ D;  3REI A;  4H9N B;  1U35 A;  3IP4 C;  2HIO B;  5C3I C;  4QLC B;  5AV9 B;  4R8P D;  5B2I D;  5B33 B;  3LJA B;  4CSR A;  3WA9 B;  5AV5 D;  2L5A A;  3LZ0 C;  5BNX A;  3A6N A;  3MGR C;  4YS3 A;  4G92 C;  3UTB C;  1JFI A;  3X1S B;  3UTA A;  4WU8 C;  3AZK A;  5CPK D;  4LD9 B;  4G91 C;  3C1B D;  1WWS A;  1M18 B;  1BH9 B;  3WTP D;  5B1L B;  5B32 D;  3REJ C;  3KXB D;  4ZUX D;  3REI D;  4J8X C;  3AZE D;  5B40 B;  2IO5 C;  5E5A B;  1P3F B;  3TU4 C;  4H9R B;  1U35 D;  3AZF A;  5GSU C;  3REH A;  1ID3 A;  2VQR A;  1B6W A;  5AY8 A;  4KGC B;  2ZY4 A;  5JRG A;  4YS3 D;  3UT9 A;  4KUD D;  3KWQ C;  3B0D C;  2RIQ A;  2HUE B;  1F1E A;  3UTA D;  2G5H C;  3V9R A;  3MVD C;  5B24 A;  3X1V C;  4J8V A;  4Z2M G;  3B6F A;  3O62 C;  1P3I A;  3C1C B;  3AZH C;  5F99 B;  2F8N B;  1P34 A;  2RVQ D;  3VH5 A;  5B2J C;  1P3A A;  3AFA C;  3AZF D;  2NZD A;  3LZ1 B;  4KHA A;  4CAY A;  1T3U A;  4ZBJ B;  1ID3 D;  3AZM A;  3W96 C;  2BYK B;  5AY8 D;  2ARO A;  5JRG D;  3UT9 D;  5GT3 C;  3W97 C;  5AV6 B;  3MNN C;  3B0C T;  5CP6 C;  1KX3 C;  3H0L C;  3AZG C;  5B24 D;  3MVD D;  4J8V D;  3REL A;  3W98 C;  5DNN C;  4EO5 C;  1P3O A;  1P3I D;  1F66 C;  3W99 A;  3AYW A;  1HQ3 B;  5B1M C;  5GXQ A;  5BNX B;  3A6N B;  1P3A D;  3AZI C;  4H9S A;  4X23 A;  4WNN A;  5B31 A;  2NZD D;  5AVC A;  4JJN A;  3AZK B;  4Z66 B;  3KUY B;  3AZM D;  1P3G B;  3MGS A;  3AV1 A;  1P3L B;  1TZY C;  4J8U C;  4Z5T A;  1KX4 A;  2NQB C;  5B0Y C;  5GT3 D;  3AZL A;  1P3M B;  1ZLA C;  1B67 A;  2PYO B;  5DNM A;  2HIO C;  4QLC C;  3REL D;  5AV9 C;  1BFM A;  3AZJ B;  1P3O D;  3W99 D;  5B33 C;  3LJA C;  5DNN D;  3REH B;  3AYW D;  2ZY5 A;  3WA9 C;  5GT0 A;  5GXQ D;  2Y2J A;  4H9O B;  4X23 D;  1EQZ C;  3X1S C;  5B31 D;  1WWI A;  5AVC D;  3AZN A;  3AV2 A;  3V9R B;  5B24 B;  4LD9 C;  5AVB B;  5B0Z A;  2ZM5 A;  1M18 C;  3B6F B;  3AV1 D;  3WKJ A;  2Y2I A;  3X1T A;  4NE3 A;  1KX4 D;  5B40 C;  5CPI B;  3AZL D;  1P34 B;  2FJ7 C;  2NQB D;  5B0Y D;  5E5A C;  1P3F C;  1ZLA D;  4YM6 A;  2FFF B;  3X1U B;  5DNM D;  1KX5 B;  3VH5 W;  5AV5 A;  4XUJ B;  4J8W B;  4CAY B;  1P3K B;  4H9P A;  4WV4 B;  4KGC C;  2ARO B;  3VH6 W;  3MGQ A;  1S32 A;  2HUE C;  3AZN D;  3AV2 D;  1EQZ D;  5B32 A;  3H0R C;  3KXB A;  3AZE A;  5B0Z D;  1M19 B;  1M1A B;  3WKJ D;  3FDD A;  5JA4 A;  3C1C C;  3W99 B;  3X1T D;  3B6G B;  2F8N H;  4XZQ C;  4DRA A;  3AN2 B;  3REK B;  2FJ7 D;  4YM6 D;  1TAF A;  3LZ1 C;  4WNN B;  4JJN B;  4KUD A;  4ZBJ C;  3LZ0 A;  3LEL B;  3MGR A;  1H3O A;  3MGS B;  3UTB A;  3MGQ D;  4NE5 A;  1P3B B;  4WU8 A;  5AV6 C;  1AOI B;  4Z5T B;  1S32 D;  3NQJ B;  1N1J A;  5AV8 B;  1P3P C;  1W2E A;  4DRB A;  3REJ A;  4WU9 B;  4J8X A;  5KDM A;  1BH8 B;  2YFW B;  1Q9C A;  2J8P A;  4H9Q B;  2LY8 A;  1HQ3 C;  5BNV A;  3TU4 A;  5GT0 B;  4M6B A;  4XZQ D;  2YFV A;  5GSU A;  2CV5 C;  3MGP B;  4Z66 C;  3A1K A;  3LZ0 D;  3KUY C;  3MGR D;  5CPJ B;  2Y2N A;  1P3G C;  3KWQ A;  1P3L C;  5BT1 C;  3UTB D;  5FUG B;  4WU8 D;  3MVD A;  3X1V A;  1P3M C;  2PYO C;  4R8P B;  5B2I B;  3O62 A;  3REJ D;  1P3P D;  3AZH A;  4UUZ B;  4J8X D;  5AV5 B;  2Y2K A;  3AZJ C;  3REH C;  5B2J A;  3TU4 D;  1Z2C B;  3AFA A;  1R4V A;  5GSU D;  3B0B A;  5CPK B;  2Y2M A;  2BYM A;  3C1B B;  3W96 A;  2Y2O A;  3WTP B;  2CV5 D;  5B32 B;  3KXB B;  4ZUX B;  3REI B;  5AVB C;  3W97 A;  5GT3 A;  3AZE B;  3KWQ D;  3MNN A;  5CP6 A;  1U35 B;  5CPI C;  4Z2M H;  3X1V D;  3VH5 T;  3O62 D;  1KX5 C;  5DNN A;  3X1U C;  3W98 A;  3AZH D;  1F66 A;  4CSR B;  2Y2Q A;  3WAA C;  3VH6 T;  4XUJ C;  4J8W C;  2ZY3 A;  5B1M A;  4YS3 B;  5B2J D;  1P3K C;  4KUD B;  3AZI A;  1H3O B;  3AFA D;  1JFI B;  3UTA B;  3KFU G;  3W96 D;  2Y2G A;  1TZY A;  2JSS A;  4J8U A;  1M19 C;  1M1A C;  3W97 D;  2NQB A;  3MNN D;  5B0Y A;  5CP6 D;  1KX3 D;  2DF4 C;  1ZLA A;  3B6G C;  2IO5 B;  4H9N A;  3AZG D;  3AZF B;  2UWX A;  5BNV B;  2HIO A;  4QLC A;  4AWL B;  3REK C;  3AN2 C;  5AV9 A;  3W98 D;  4H9S C;  1F66 D;  1ID3 B;  5B33 A;  3LJA A;  5AY8 B;  3WA9 A;  3AL0 C;  5JRG B;  3LEL C;  5B1M D;  3UT9 B;  3WAA D;  3AZI D;  1EQZ A;  3X1S A;  1P3B C;  1AOI C;  3MVD B;  4J8V B;  5AV8 C;  4LD9 A;  3EPL A;  5B1L C;  3A1I A;  1M18 A;  1BH9 A;  1P3I B;  4WU9 C;  1TZY D;  4J8U D;  3EPH A;  3F6T A;  2DQN C;  3H0M C;  1P3A B;  2FJ7 A;  5E5A A;  1P3F A;  4H9R A;  5GT0 C;  2NZD B;  2HIO D;  4QLC D;  5BS7 C;  4KHA B;  5AV9 D;  3AZM B;  5B33 D;  3LJA D;  5G49 A;  3MGP C;  3W96 B;  3WA9 D;  4KGC A;  2F8N K;  2Y2L A;  5CPJ C;  5B32 G;  5GT3 B;  4NE6 A;  3X1S D;  2BG1 A;  4LD9 D;  3REL B;  4R8P C;  1M18 D;  5B2I C;  5F99 C;  1P3O B;  5B1L D;  3C1C A;  5DNN B;  3AYW B;  2F8N A;  2ZY2 A;  3R45 A;  4HGA B;  5B40 D;  5GXQ B;  4XZQ A;  4E44 A;  5E5A D;  1P3F D;  4X23 B;  5B31 B;  5AVC B;  3LZ1 A;  1HTA A;  5CPK C;  1A7W A;  3C1B C;  2BYK A;  3AV1 B;  3WTP C;  5B32 C;  4KGC D;  5BO0 A;  4ZUX C;  3REI C;  3AZE C;  1PZR A;  1KX4 B;  5AV6 A;  3AZL B;  2NQB B;  5B0Y B;  4WJ3 C;  1ZLA B;  1U35 C;  1P3P A;  5DNM B;  3C1C D;  2F8N D;  5F99 D;  1HQ3 A;  3A6N C;  3NQU A;  4YS3 C;  4KUD C;  3UTA C;  3AZN B;  3AV2 B;  1EQZ B;  3LZ1 D;  3AZK C;  2CV5 A;  4Z66 A;  3KUY A;  2F2A C;  5B0Z B;  3WKJ B;  1P3G A; 
#chains in the Genus database with same CATH homology
 1P3L A;  3X1T B;  1KU5 A;  5AV6 D;  2RVQ C;  4UPK A;  1P3M A;  2PYO A;  2FJ7 B;  2G5I C;  4YM6 B;  3AZF C;  2JE5 A;  4AWL C;  2CWE A;  3AZJ A;  1ID3 C;  4H9P B;  5CHL B;  5AY8 C;  5G49 B;  1HQ3 D;  3MGQ B;  5JRG C;  2W8S A;  3UT9 C;  3A6N D;  1S32 B;  4H9O A;  5B24 C;  2XD5 A;  4J8V C;  3AZK D;  4Z66 D;  3KUY D;  3B6F C;  1P3G D;  5AVB A;  1KX3 A;  5JA4 B;  1P3I C;  1P3L D;  5BT1 D;  3AZG A;  2XD1 A;  1P34 C;  1ULY A;  3EPJ A;  3R45 B;  5CPI A;  1P3M D;  5C3I B;  1P3A C;  4XZQ B;  4E45 A;  2PYO D;  1KX5 A;  3X1U A;  1TAF B;  2NZD C;  5B31 G;  4XUJ A;  4J8W A;  3AZJ D;  3VH6 A;  3LZ0 B;  3MGR B;  3AZM C;  3REH D;  3WAA A;  1P3K A;  2ARO C;  4G92 B;  3UTB B;  4WU8 B;  5BO0 B;  2JCH A;  1N1J B;  4G91 B;  3REJ B;  1P3P B;  3EG5 B;  4J8X B;  5AVB D;  3REL C;  1M19 A;  5KDM B;  1M1A A;  1P3O C;  3B6F D;  3W99 C;  3AYW C;  3B6G A;  3TU4 B;  4HGA C;  5CPI D;  5GXQ C;  1P34 D;  2YFV B;  2Y2H A;  3NQU B;  5GSU B;  4X23 C;  3REK A;  3AN2 A;  1KX5 D;  3X1U D;  5B31 C;  5AVC C;  4JJN C;  2CV5 B;  4XUJ D;  4J8W D;  3LEL A;  1P3K D;  3MGS C;  3KWQ B;  3AV1 C;  3B0D B;  2ARO D;  3P5J B;  4Z5T C;  1P3B A;  1KX4 C;  3X1V B;  3AZL C;  1AOI A;  3NQJ A;  5AV8 A;  3KSY A;  5B1L A;  3O62 B;  5DNM C;  3AZH B;  4WU9 A;  5B40 A;  1M19 D;  1M1A D;  1BH8 A;  2YFW A;  5B2J B;  4H9Q A;  3B6G D;  3AFA B;  5BS7 A;  3AN2 D;  3REK D;  2BYM B;  3AZN C;  3AV2 C;  3MGP A;  4JJN D;  3LEL D;  5B0Z C;  3W97 B;  3WKJ C;  5CPJ A;  4WZS B;  3MNN B;  5CP6 B;  3MGS D;  1KX3 B;  4DQY B;  3X1T C;  1P3B D;  5FUG A;  3AZG B;  1AOI D;  4Z5T D;  2F8N G;  3B0C W;  5AV8 D;  4YM6 C;  4R8P A;  3W98 B;  5F99 A;  4EO5 B;  5B2I A;  1F66 B;  4WU9 D;  4UUZ A;  5AV5 C;  5B1M B;  3WAA B;  4NFT A;  3AZI B;  2Y2P A;  3EPK A;  3MGQ C;  5GT0 D;  1S32 C;  5CPK A;  3C1B A;  3KXB C;  3MGP D;  3WTP A;  3WTP E;  1TZY B;  4ZUX A;  4J8U B;  5CPJ D;  3REI A;  4H9N B;  1U35 A;  3IP4 C;  2HIO B;  5C3I C;  4QLC B;  5AV9 B;  4R8P D;  5B2I D;  5B33 B;  3LJA B;  4CSR A;  3WA9 B;  5AV5 D;  2L5A A;  3LZ0 C;  5BNX A;  3A6N A;  3MGR C;  4YS3 A;  4G92 C;  3UTB C;  1JFI A;  3X1S B;  3UTA A;  4WU8 C;  3AZK A;  5CPK D;  4LD9 B;  4G91 C;  3C1B D;  1WWS A;  1M18 B;  1BH9 B;  3WTP D;  5B1L B;  5B32 D;  3REJ C;  3KXB D;  4ZUX D;  3REI D;  4J8X C;  3AZE D;  5B40 B;  2IO5 C;  5E5A B;  1P3F B;  3TU4 C;  4H9R B;  1U35 D;  3AZF A;  5GSU C;  3REH A;  1ID3 A;  2VQR A;  1B6W A;  5AY8 A;  4KGC B;  2ZY4 A;  5JRG A;  4YS3 D;  3UT9 A;  4KUD D;  3KWQ C;  3B0D C;  2RIQ A;  2HUE B;  1F1E A;  3UTA D;  2G5H C;  3V9R A;  3MVD C;  5B24 A;  3X1V C;  4J8V A;  4Z2M G;  3B6F A;  3O62 C;  1P3I A;  3C1C B;  3AZH C;  5F99 B;  2F8N B;  1P34 A;  2RVQ D;  3VH5 A;  5B2J C;  1P3A A;  3AFA C;  3AZF D;  2NZD A;  3LZ1 B;  4KHA A;  4CAY A;  1T3U A;  4ZBJ B;  1ID3 D;  3AZM A;  3W96 C;  2BYK B;  5AY8 D;  2ARO A;  5JRG D;  3UT9 D;  5GT3 C;  3W97 C;  5AV6 B;  3MNN C;  3B0C T;  5CP6 C;  1KX3 C;  3H0L C;  3AZG C;  5B24 D;  3MVD D;  4J8V D;  3REL A;  3W98 C;  5DNN C;  4EO5 C;  1P3O A;  1P3I D;  1F66 C;  3W99 A;  3AYW A;  1HQ3 B;  5B1M C;  5GXQ A;  5BNX B;  3A6N B;  1P3A D;  3AZI C;  4H9S A;  4X23 A;  4WNN A;  5B31 A;  2NZD D;  5AVC A;  4JJN A;  3AZK B;  4Z66 B;  3KUY B;  3AZM D;  1P3G B;  3MGS A;  3AV1 A;  1P3L B;  1TZY C;  4J8U C;  4Z5T A;  1KX4 A;  2NQB C;  5B0Y C;  5GT3 D;  3AZL A;  1P3M B;  1ZLA C;  1B67 A;  2PYO B;  5DNM A;  2HIO C;  4QLC C;  3REL D;  5AV9 C;  1BFM A;  3AZJ B;  1P3O D;  3W99 D;  5B33 C;  3LJA C;  5DNN D;  3REH B;  3AYW D;  2ZY5 A;  3WA9 C;  5GT0 A;  5GXQ D;  2Y2J A;  4H9O B;  4X23 D;  1EQZ C;  3X1S C;  5B31 D;  1WWI A;  5AVC D;  3AZN A;  3AV2 A;  3V9R B;  5B24 B;  4LD9 C;  5AVB B;  5B0Z A;  2ZM5 A;  1M18 C;  3B6F B;  3AV1 D;  3WKJ A;  2Y2I A;  3X1T A;  4NE3 A;  1KX4 D;  5B40 C;  5CPI B;  3AZL D;  1P34 B;  2FJ7 C;  2NQB D;  5B0Y D;  5E5A C;  1P3F C;  1ZLA D;  4YM6 A;  2FFF B;  3X1U B;  5DNM D;  1KX5 B;  3VH5 W;  5AV5 A;  4XUJ B;  4J8W B;  4CAY B;  1P3K B;  4H9P A;  4WV4 B;  4KGC C;  2ARO B;  3VH6 W;  3MGQ A;  1S32 A;  2HUE C;  3AZN D;  3AV2 D;  1EQZ D;  5B32 A;  3H0R C;  3KXB A;  3AZE A;  5B0Z D;  1M19 B;  1M1A B;  3WKJ D;  3FDD A;  5JA4 A;  3C1C C;  3W99 B;  3X1T D;  3B6G B;  2F8N H;  4XZQ C;  4DRA A;  3AN2 B;  3REK B;  2FJ7 D;  4YM6 D;  1TAF A;  3LZ1 C;  4WNN B;  4JJN B;  4KUD A;  4ZBJ C;  3LZ0 A;  3LEL B;  3MGR A;  1H3O A;  3MGS B;  3UTB A;  3MGQ D;  4NE5 A;  1P3B B;  4WU8 A;  5AV6 C;  1AOI B;  4Z5T B;  1S32 D;  3NQJ B;  1N1J A;  5AV8 B;  1P3P C;  1W2E A;  4DRB A;  3REJ A;  4WU9 B;  4J8X A;  5KDM A;  1BH8 B;  2YFW B;  1Q9C A;  2J8P A;  4H9Q B;  2LY8 A;  1HQ3 C;  5BNV A;  3TU4 A;  5GT0 B;  4M6B A;  4XZQ D;  2YFV A;  5GSU A;  2CV5 C;  3MGP B;  4Z66 C;  3A1K A;  3LZ0 D;  3KUY C;  3MGR D;  5CPJ B;  2Y2N A;  1P3G C;  3KWQ A;  1P3L C;  5BT1 C;  3UTB D;  5FUG B;  4WU8 D;  3MVD A;  3X1V A;  1P3M C;  2PYO C;  4R8P B;  5B2I B;  3O62 A;  3REJ D;  1P3P D;  3AZH A;  4UUZ B;  4J8X D;  5AV5 B;  2Y2K A;  3AZJ C;  3REH C;  5B2J A;  3TU4 D;  1Z2C B;  3AFA A;  1R4V A;  5GSU D;  3B0B A;  5CPK B;  2Y2M A;  2BYM A;  3C1B B;  3W96 A;  2Y2O A;  3WTP B;  2CV5 D;  5B32 B;  3KXB B;  4ZUX B;  3REI B;  5AVB C;  3W97 A;  5GT3 A;  3AZE B;  3KWQ D;  3MNN A;  5CP6 A;  1U35 B;  5CPI C;  4Z2M H;  3X1V D;  3VH5 T;  3O62 D;  1KX5 C;  5DNN A;  3X1U C;  3W98 A;  3AZH D;  1F66 A;  4CSR B;  2Y2Q A;  3WAA C;  3VH6 T;  4XUJ C;  4J8W C;  2ZY3 A;  5B1M A;  4YS3 B;  5B2J D;  1P3K C;  4KUD B;  3AZI A;  1H3O B;  3AFA D;  1JFI B;  3UTA B;  3KFU G;  3W96 D;  2Y2G A;  1TZY A;  2JSS A;  4J8U A;  1M19 C;  1M1A C;  3W97 D;  2NQB A;  3MNN D;  5B0Y A;  5CP6 D;  1KX3 D;  2DF4 C;  1ZLA A;  3B6G C;  2IO5 B;  4H9N A;  3AZG D;  3AZF B;  2UWX A;  5BNV B;  2HIO A;  4QLC A;  4AWL B;  3REK C;  3AN2 C;  5AV9 A;  3W98 D;  4H9S C;  1F66 D;  1ID3 B;  5B33 A;  3LJA A;  5AY8 B;  3WA9 A;  3AL0 C;  5JRG B;  3LEL C;  5B1M D;  3UT9 B;  3WAA D;  3AZI D;  1EQZ A;  3X1S A;  1P3B C;  1AOI C;  3MVD B;  4J8V B;  5AV8 C;  4LD9 A;  3EPL A;  5B1L C;  3A1I A;  1M18 A;  1BH9 A;  1P3I B;  4WU9 C;  1TZY D;  4J8U D;  3EPH A;  3F6T A;  2DQN C;  3H0M C;  1P3A B;  2FJ7 A;  5E5A A;  1P3F A;  4H9R A;  5GT0 C;  2NZD B;  2HIO D;  4QLC D;  5BS7 C;  4KHA B;  5AV9 D;  3AZM B;  5B33 D;  3LJA D;  5G49 A;  3MGP C;  3W96 B;  3WA9 D;  4KGC A;  2F8N K;  2Y2L A;  5CPJ C;  5B32 G;  5GT3 B;  4NE6 A;  3X1S D;  2BG1 A;  4LD9 D;  3REL B;  4R8P C;  1M18 D;  5B2I C;  5F99 C;  1P3O B;  5B1L D;  3C1C A;  5DNN B;  3AYW B;  2F8N A;  2ZY2 A;  3R45 A;  4HGA B;  5B40 D;  5GXQ B;  4XZQ A;  4E44 A;  5E5A D;  1P3F D;  4X23 B;  5B31 B;  5AVC B;  3LZ1 A;  1HTA A;  5CPK C;  1A7W A;  3C1B C;  2BYK A;  3AV1 B;  3WTP C;  5B32 C;  4KGC D;  5BO0 A;  4ZUX C;  3REI C;  3AZE C;  1PZR A;  1KX4 B;  5AV6 A;  3AZL B;  2NQB B;  5B0Y B;  4WJ3 C;  1ZLA B;  1U35 C;  1P3P A;  5DNM B;  3C1C D;  2F8N D;  5F99 D;  1HQ3 A;  3A6N C;  3NQU A;  4YS3 C;  4KUD C;  3UTA C;  3AZN B;  3AV2 B;  1EQZ B;  3LZ1 D;  3AZK C;  2CV5 A;  4Z66 A;  3KUY A;  2F2A C;  5B0Z B;  3WKJ B;  1P3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...