5B33D

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33D00
3AZND 5GT3C 4YM6B 2NQBA 1TAFB 3AZLD 1KX3A 5CPJD 4Z2MG 3REHB 3X1UA 5GT0C 4YM6A 3UTBA 1P3GC 1M18D 3X1SB 4CAYB 3AV1C 2IO5C 3B6FC 4KGCA 1U35D 3REJC 3X1SA 1TZYD 5BT1D 2PYOD 3W96D 5B32G 3LJAD 1F66C 3WAAC 3WKJB 3TU4C 1P3BB 3X1VA 1P3MD 4CSRA 2YFVA 3REIB 1P3FA 5B1LD 3AN2A 5B40C 1P3BA 4M6BA 1HQ3D 3LZ0A 4AWLC 1BH9B 3AZID 1ULYA 1P34A 4J8WA 3NQJB 4KHAA 1BH9A 4X23C 4DRAA 4Z5TC 4WU9D 3LZ1C 5B2JD 5CP6A 3W98C 4EO5C 1M19C 5B0YA 4H9PA 3KWQC 3MGSD 3AV2A 1KX5A 1P3GB 3AZJC 1KX4A 3UTAA 1P3AB 3AFAC 3B6FB 5AY8D 3AZFD 5CPKC 2AROB 4WNNB 2CV5C 4KUDA 4H9NB 1P3LB 2AROA 4WNNA 1P3IA 1P3PC 1F66B 2F8NH 3RELC 1WWSA 5CPJC 4XUJA 1P3LA 3AZGC 3AZHB 3AYWD 4WU8A 3LELC 2YFWB 5B0ZC 1R4VA 2HUEB 2FJ7D 3MNND 3AZHA 4LD9A 3MVDC 2NZDC 3O62D 5AV9D 5AV5B 5GXQA 2YFWA 3AZKA 3W96C 5GT3D 4X23B 4Z5TB 5E5AC 3LZ1B 3B6GA 3W98B 3LJAC 1P3KB 5GT0D 5JRGA 3C1CC 1P3MC 3VH6A 2F8ND 1AOIC 3W97A 3AV1D 4J8VC 4ZBJC 3REJD 5AV6B 5KDMB 4QLCA 2CV5B 3WA9A 5AV6A 3A6NC 5BNXB 4J8UC 3AZNB 1F66D 3WAAD 3C1BA 4WU9C 3TU4D 3AZLB 1ID3A 4ZUXD 5CPJB 5B2IA 5BNXA 4XZQA 5B40D 1M18B 5GSUA 5BNVB 5B31D 3UT9C 2HIOA 1M1AC 1HTAA 5AY8C 3AZFC 1U35B 1M18A 3MGPA 1TZYB 2PYOB 3W96B 3W99A 1U35A 1S32A 5AVBC 1KX3C 3LJAB 1M19D 3X1UC 3X1TA 3UTBC 5B32A 3KWQD 1P3MB 4E44A 1AOIB 3AZJD 4G92B 5DNMD 5B1LB 3WTPA 4H9QB 3AFAD 5B33A 5BS7A 5CPKD 1HQ3B 3AZIB 5B1LA 5AVCD 4H9QA 5G49A 1BH8B 4H9SC 1P3PD 5CPID 3RELD 4UUZA 4WU9B 3X1VC 5B2JB 4YS3D 1EQZD 5C3IC 2LY8A 1P3FC 3AZGD 1TAFA 3MGSB 5B2JA 3LELD 3LZ0C 5B0ZD 3REHA 5AY8B 2BYMB 3AZFB 3MVDD 2BYKB 4J8WC 3KSYA 2NZDD 4CAYA 1ZLAC 1KU5A 5E5AD 2L5AA 5CP6C 5B0YC 3C1CD 4ZUXC 1AOID 1KX4C 4J8VD 3WKJA 4G91C 3AYWB 5DNND 5B31C 5B1MD 3REIA 2FJ7B 3MNNB 3VH6T 1N1JB 3O62B 5AV9B 1WWIA 3A6ND 2FJ7A 4J8UD 5GT3B 3KXBC 4XUJC 3O62A 5C3IB 5AV9A 3AZED 3NQJA 3REKD 5GT3A 5GT0B 5AV8D 3MGQD 2F8NB 3B0DC 4J8XC 5BO0B 3AV1B 5DNMC 3UT9D 1M1AD 2IO5B 3REJB 4LD9C 2F8NA 1P3GA 5GXQC 3AZKC 3B0CW 1P3AA 5AVCC 2NQBD 1ZLAB 3B6FA 5AVBD 4Z66C 1KX3D 3B6GC 1B67A 5CPIC 3X1UD 3WAAB 4NFTA 3UTBD 3TU4B 1EQZC 4H9NA 4YS3C 4ZUXB 5B24C 3WTPE 5F99C 1F66A 4KGCD 5B40B 5B31B 4R8PC 4AWLB 3KUYC 3WA9C 5B40A 2CWEA 1F1EA 1H3OB 4NE3A 3R45B 4JJNC 3KXBB 3X1VD 1ID3C 1JFIB 5AV5A 3VH5W 4EO5B 1M19B 5B2IC 1P3FD 3R45A 4XZQC 3AN2D 4X23A 4Z5TA 3KWQB 3LZ1A 3W98A 3LZ0D 3AZJB 2F8NG 1P3KA 2HIOC 5DNMB 1P34D 3AFAB 3KWQA 5CPKB 5DNNC 4WZSB 4J8WD 4NE6A 5B1MC 5AVCB 1ZLAD 1S32C 3AZMC 5CP6D 5KDMA 3MGRC 2CV5A 5B0YD 1P3PB 3X1TC 5CPIB 3RELB 3AV2D 1KX5D 4YS3B 1EQZB 3AZEC 1P3OC 3AZNA 3AZGB 3REKC 1KX4D 3RELA 5AV8C 3MGQC 5B33C 3AZLA 5CPJA 3LELB 5B0ZB 5B31G 4KUDD 3MVDB 2NZDB 3LELA 5BNVA 1P3ID 5B0ZA 2NQBC 5E5AB 3KXBD 3MVDA 2NZDA 4XUJD 1TZYA 2PYOA 3W96A 4YM6C 3C1CB 4WU8D 5E5AA 4J8XD 3LJAA 4J8VB 4KGCC 4ZBJB 4LD9D 1P3MA 5DNNB 3X1SC 1AOIA 5GXQD 5B1MB 3AZKD 4J8VA 4Z66D 3B6GD 3A6NB 1HQ3A 3V9RB 4J8UB 3AZIA 5JRGD 3AZEB 5B24D 1P3OB 5F99D 3W97D 1BH8A 1A7WA 3REKB 3WKJC 3AN2C 4WU9A 1P3BC 5AV8B 3MGQB 4QLCD 4R8PD 3UT9B 3KUYD 1P34C 1M1AB 3WA9D 3MGSA 3UT9A 1M1AA 2NQBB 3C1BD 5AY8A 2BYMA 5AVBB 4JJND 2BYKA 3AZFA 1KX3B 1ID3D 5B2ID 3X1UB 4XZQD 4WV4B 3UTBB 3AV2C 1KX5C 5AVBA 5GSUD 3UTAC 2HIOD 4KGCB 3MGPD 1P3AC 3W99D 3AYWA 4KUDC 1S32D 3AZMD 2AROC 3MGRD 1P3IC 3MNNA 3X1TD 5FUGB 1N1JA 5B32D 3B0BA 4CSRB 3X1VB 1P3LC 2YFVB 1P3OD 1P3FB 4H9SA 3AN2B 3WTPD 5FUGA 4WU8C 1Q9CA 5B33D 3LZ0B 3AZHC 1P34B 5GT0A 3VH5A 4J8WB 5BO0A 2HUEC 4KHAB 3AV1A 3REJA 5CP6B 2JSSA 5AV5C 5B0YB 5JRGC 4YM6D 1ZLAA 4H9PB 3AV2B 1KX5B 3W97C 3REHD 1P3KC 1KX4B 3UTAB 3WAAA 4G91B 3TU4A 4ZUXA 4QLCC 3X1SD 4KUDB 5AV6C 2RVQC 1P3IB 5B31A 3C1BC 5JA4B 4XUJB 4DRBA 3AZNC 1H3OA 3WKJD 2F8NK 4WU8B 3AZLC 1P3BD 3KXBA 3B0DB 5JA4A 5GSUC 1JFIA 4J8XB 1M19A 3REID 4NE5A 4LD9B 1M18C 3MGPC 4HGAC 4J8XA 4H9OB 5GXQB 3AZJA 3AZKB 3W99C 5DNMA 3AFAA 1U35C 5CHLB 4Z66B 5CPKA 3B6GB 4H9OA 1TZYC 4E45A 5BT1C 2PYOC 5JRGB 5AVCA 5B32C 4Z66A 5B24B 5F99B 3W97B 3UTAD 1P3PA 5CPIA 3WTPC 5BS7C 1EQZA 4YS3A 1P3GD 5B24A 4QLCB 5F99A 4R8PB 4G92C 3KUYB 3AZGA 1P3AD 5B1LC 3WA9B 3B6FD 3B0CT 2AROD 1HQ3C 4R8PA 3AZIC 3KUYA 3C1BB 4JJNB 1ID3B 1P3LD 5B2IB 4XZQB 5B2JC 4JJNA 5GSUB 3REHC 2HIOB 3AZHD 3C1CA 3MGSC 3NQUB 3MGPB 4HGAB 3W99B 1S32B 3AZMB 4H9RB 5DNNA 3VH6W 5AV5D 3NQUA 3MGRB 5B1MA 4Z2MH 3X1TB 4X23D 3VH5T 4Z5TD 5B32B 3AZMA 4H9RA 3LZ1D 3A6NA 3W98D 3MGRA 3V9RA 4J8UA 1P3KD 3WTPB 5B33B 3AZEA 1P3OA 3REIC 3REKA 3AYWC 5AV8A 1B6WA 5AV6D 3MGQA 2RVQD 2CV5D 5G49B 2FJ7C 3MNNC 1BFMA 4UUZB 3O62C 5AV9C
chains in the Genus database with same CATH superfamily
3AZND 5GT3C 4YM6B 2NQBA 1TAFB 3AZLD 1KX3A 5CPJD 4Z2MG 3REHB 3X1UA 5GT0C 4YM6A 3UTBA 1P3GC 1M18D 3X1SB 4CAYB 3AV1C 2IO5C 3B6FC 4KGCA 1U35D 3REJC 3X1SA 1TZYD 5BT1D 2PYOD 3W96D 5B32G 3LJAD 1F66C 3WAAC 3WKJB 3TU4C 1P3BB 3X1VA 1P3MD 4CSRA 2YFVA 3REIB 3EPJA 1P3FA 5B1LD 3AN2A 5B40C 1P3BA 4M6BA 1HQ3D 3LZ0A 4AWLC 1BH9B 3AZID 1ULYA 1P34A 4J8WA 2F2AC 3NQJB 4KHAA 1BH9A 4X23C 4DRAA 4Z5TC 4WU9D 3LZ1C 5B2JD 5CP6A 3W98C 4EO5C 1M19C 5B0YA 4H9PA 3KWQC 3MGSD 2G5HC 3AV2A 1P3GB 1KX5A 3AZJC 3FDDA 1KX4A 3UTAA 1P3AB 3AFAC 3B6FB 2ZM5A 5AY8D 3AZFD 5CPKC 2AROB 4WNNB 2CV5C 4KUDA 4H9NB 1P3LB 2AROA 4WNNA 1P3IA 1P3PC 1F66B 2F8NH 3RELC 1WWSA 5CPJC 4XUJA 1P3LA 3AZGC 3AZHB 3AYWD 4WU8A 3LELC 3P5JB 2YFWB 5B0ZC 1R4VA 2HUEB 3A1KA 3MNND 2FJ7D 3AZHA 2Y2GA 2VQRA 4LD9A 3MVDC 2NZDC 3O62D 5AV9D 5AV5B 5GXQA 2YFWA 3AZKA 3W96C 5GT3D 4X23B 4Z5TB 5E5AC 3LZ1B 3B6GA 3W98B 4WJ3C 3LJAC 1P3KB 2ZY2A 5GT0D 5JRGA 3C1CC 1P3MC 3VH6A 2F8ND 1AOIC 3W97A 3AV1D 4J8VC 4ZBJC 3REJD 5AV6B 5KDMB 4QLCA 2CV5B 3WA9A 5AV6A 3A6NC 5BNXB 4J8UC 3AZNB 1F66D 3WAAD 3C1BA 4WU9C 3TU4D 3AZLB 1ID3A 4ZUXD 5CPJB 5B2IA 5BNXA 4XZQA 5B40D 1M18B 5GSUA 5BNVB 5B31D 3UT9C 2HIOA 1M1AC 1HTAA 5AY8C 3AZFC 1U35B 1M18A 3MGPA 1TZYB 2PYOB 3W96B 3W99A 1U35A 1S32A 5AVBC 1KX3C 3LJAB 1M19D 3X1UC 2ZY5A 3X1TA 3UTBC 5B32A 3KWQD 1P3MB 4E44A 2Y2NA 3EG5B 1AOIB 3AZJD 4G92B 5DNMD 5B1LB 3WTPA 4H9QB 3AFAD 5B33A 5BS7A 5CPKD 1PZRA 1HQ3B 3AZIB 5B1LA 5AVCD 4H9QA 5G49A 1BH8B 2FFFB 4H9SC 1P3PD 5CPID 3RELD 4UUZA 4WU9B 3X1VC 5B2JB 4YS3D 1EQZD 5C3IC 2LY8A 1P3FC 3AZGD 1TAFA 3MGSB 5B2JA 3LELD 3LZ0C 5B0ZD 3REHA 1Z2CB 5AY8B 2BYMB 3AZFB 3MVDD 2BYKB 4J8WC 3KSYA 2NZDD 4CAYA 1ZLAC 1KU5A 2G5IC 2L5AA 5E5AD 5CP6C 5B0YC 3C1CD 4ZUXC 1AOID 1KX4C 4J8VD 3WKJA 4G91C 3AYWB 2Y2IA 5DNND 5B31C 5B1MD 3REIA 2FJ7B 3MNNB 3VH6T 1N1JB 3O62B 5AV9B 1WWIA 3A6ND 2FJ7A 4J8UD 5GT3B 2Y2MA 3H0RC 2JCHA 3KXBC 4XUJC 3O62A 5C3IB 5AV9A 3AZED 3NQJA 3REKD 5GT3A 5GT0B 5AV8D 3MGQD 2F8NB 3B0DC 4J8XC 5BO0B 3AV1B 5DNMC 3UT9D 1M1AD 2IO5B 3REJB 4LD9C 2F8NA 1P3GA 5GXQC 3AZKC 3B0CW 1P3AA 5AVCC 2NQBD 1ZLAB 3B6FA 5AVBD 4Z66C 1KX3D 3B6GC 1B67A 5CPIC 3X1UD 3WAAB 4NFTA 3UTBD 3TU4B 1EQZC 4H9NA 4YS3C 4ZUXB 5B24C 3WTPE 5F99C 1F66A 4KGCD 5B40B 5B31B 4R8PC 4AWLB 3KUYC 2JE5A 3WA9C 5B40A 2CWEA 3H0LC 1F1EA 3R45B 4NE3A 1H3OB 4JJNC 3KXBB 3X1VD 1ID3C 1JFIB 5AV5A 3VH5W 4EO5B 1M19B 5B2IC 1P3FD 3R45A 4XZQC 3AN2D 4X23A 4Z5TA 3KWQB 3LZ1A 3W98A 3LZ0D 3AZJB 2F8NG 1P3KA 2HIOC 5DNMB 1P34D 3AFAB 3KWQA 5CPKB 5DNNC 4WZSB 4J8WD 4NE6A 5B1MC 5AVCB 1ZLAD 3A1IA 1S32C 3AZMC 5CP6D 5KDMA 3MGRC 2CV5A 2Y2PA 5B0YD 1P3PB 3X1TC 5CPIB 3RELB 3AV2D 1KX5D 4YS3B 1EQZB 3AZEC 1P3OC 3AZNA 3AZGB 3REKC 1KX4D 2Y2HA 2ZY4A 3RELA 3AL0C 5AV8C 3MGQC 5B33C 3AZLA 5CPJA 3LELB 5B0ZB 2Y2QA 5B31G 4KUDD 3MVDB 2NZDB 3LELA 5BNVA 1P3ID 5B0ZA 2NQBC 5E5AB 3KXBD 3MVDA 2NZDA 4XUJD 1TZYA 2PYOA 3W96A 3EPLA 4YM6C 3C1CB 4WU8D 5E5AA 4DQYB 4J8XD 3LJAA 4J8VB 4KGCC 4ZBJB 4LD9D 1P3MA 5DNNB 3X1SC 1AOIA 5GXQD 5B1MB 3AZKD 4J8VA 4Z66D 3B6GD 3A6NB 1HQ3A 3IP4C 3V9RB 4J8UB 3AZIA 3EPHA 5JRGD 3AZEB 5B24D 1P3OB 5F99D 3W97D 1BH8A 1A7WA 3REKB 3WKJC 3AN2C 4WU9A 1P3BC 5AV8B 3MGQB 4QLCD 4R8PD 3UT9B 3KUYD 1P34C 1M1AB 3WA9D 3MGSA 2RIQA 2XD1A 3UT9A 1M1AA 2NQBB 3C1BD 5AY8A 2BYMA 5AVBB 4JJND 2BYKA 3AZFA 1KX3B 1ID3D 5B2ID 3X1UB 4XZQD 4WV4B 3UTBB 3AV2C 1KX5C 5AVBA 5GSUD 3UTAC 2HIOD 4KGCB 3MGPD 1P3AC 3W99D 3AYWA 4KUDC 1S32D 3AZMD 2AROC 3MGRD 1P3IC 2W8SA 3MNNA 3X1TD 5FUGB 1N1JA 5B32D 3B0BA 4CSRB 3X1VB 1P3LC 2YFVB 1P3OD 1P3FB 4H9SA 3AN2B 3WTPD 5FUGA 4WU8C 1Q9CA 5B33D 2DQNC 3LZ0B 3AZHC 1P34B 5GT0A 3VH5A 4J8WB 5BO0A 2HUEC 4KHAB 3AV1A 3REJA 5CP6B 2JSSA 5AV5C 2UWXA 5B0YB 5JRGC 4YM6D 1ZLAA 4H9PB 3AV2B 1KX5B 3W97C 3REHD 1P3KC 1KX4B 3UTAB 3WAAA 4G91B 3TU4A 4ZUXA 2XD5A 4QLCC 3X1SD 4KUDB 5AV6C 2J8PA 2RVQC 1P3IB 1T3UA 5B31A 3C1BC 5JA4B 4XUJB 4DRBA 3AZNC 1H3OA 3WKJD 3F6TA 2F8NK 4WU8B 3AZLC 1P3BD 3KXBA 3B0DB 5JA4A 5GSUC 1JFIA 4J8XB 1M19A 3REID 4UPKA 4NE5A 4LD9B 1M18C 2Y2LA 3MGPC 4HGAC 4J8XA 4H9OB 5GXQB 3AZJA 3AZKB 3W99C 5DNMA 3AFAA 1U35C 5CHLB 4Z66B 5CPKA 3B6GB 4H9OA 1TZYC 4E45A 5BT1C 2PYOC 5JRGB 5AVCA 5B32C 4Z66A 5B24B 5F99B 3W97B 3UTAD 1P3PA 5CPIA 3WTPC 5BS7C 1EQZA 4YS3A 1P3GD 5B24A 4QLCB 5F99A 4R8PB 4G92C 3KUYB 3AZGA 1P3AD 5B1LC 3WA9B 3B6FD 3B0CT 2AROD 1HQ3C 4R8PA 3AZIC 3KUYA 3C1BB 4JJNB 1ID3B 1P3LD 2ZY3A 3H0MC 5B2IB 4XZQB 3EPKA 2DF4C 5B2JC 4JJNA 5GSUB 3REHC 2HIOB 3AZHD 3C1CA 3MGSC 3NQUB 3MGPB 4HGAB 3W99B 1S32B 3AZMB 4H9RB 5DNNA 3VH6W 5AV5D 3NQUA 3MGRB 5B1MA 4Z2MH 2Y2JA 3X1TB 4X23D 3VH5T 4Z5TD 5B32B 3AZMA 4H9RA 3LZ1D 3A6NA 3W98D 3MGRA 3V9RA 4J8UA 1P3KD 3WTPB 5B33B 3KFUG 3AZEA 1P3OA 3REIC 3REKA 2Y2OA 3AYWC 5AV8A 1B6WA 5AV6D 3MGQA 1W2EA 2Y2KA 2RVQD 2CV5D 5G49B 2FJ7C 3MNNC 1BFMA 4UUZB 2BG1A 3O62C 5AV9C
chains in the Genus database with same CATH topology
3AZND 5GT3C 4YM6B 2NQBA 1TAFB 3AZLD 1KX3A 5CPJD 4Z2MG 3REHB 3X1UA 5GT0C 4YM6A 3UTBA 1P3GC 1M18D 3X1SB 4CAYB 3AV1C 2IO5C 3B6FC 4KGCA 1U35D 3REJC 3X1SA 1TZYD 5BT1D 2PYOD 3W96D 5B32G 3LJAD 1F66C 3WAAC 3WKJB 3TU4C 1P3BB 3X1VA 1P3MD 4CSRA 2YFVA 3REIB 3EPJA 1P3FA 5B1LD 3AN2A 5B40C 1P3BA 4M6BA 1HQ3D 3LZ0A 4AWLC 1BH9B 3AZID 1ULYA 1P34A 4J8WA 2F2AC 3NQJB 4KHAA 1BH9A 4X23C 4DRAA 4Z5TC 4WU9D 3LZ1C 5B2JD 5CP6A 3W98C 4EO5C 1M19C 5B0YA 4H9PA 3KWQC 3MGSD 2G5HC 3AV2A 1P3GB 1KX5A 3AZJC 3FDDA 1KX4A 3UTAA 1P3AB 3AFAC 3B6FB 2ZM5A 5AY8D 3AZFD 5CPKC 2AROB 4WNNB 2CV5C 4KUDA 4H9NB 1P3LB 2AROA 4WNNA 1P3IA 1P3PC 1F66B 2F8NH 3RELC 1WWSA 5CPJC 4XUJA 1P3LA 3AZGC 3AZHB 3AYWD 4WU8A 3LELC 3P5JB 2YFWB 5B0ZC 1R4VA 2HUEB 3A1KA 3MNND 2FJ7D 3AZHA 2Y2GA 2VQRA 4LD9A 3MVDC 2NZDC 3O62D 5AV9D 5AV5B 5GXQA 2YFWA 3AZKA 3W96C 5GT3D 4X23B 4Z5TB 5E5AC 3LZ1B 3B6GA 3W98B 4WJ3C 3LJAC 1P3KB 2ZY2A 5GT0D 5JRGA 3C1CC 1P3MC 3VH6A 2F8ND 1AOIC 3W97A 3AV1D 4J8VC 4ZBJC 3REJD 5AV6B 5KDMB 4QLCA 2CV5B 3WA9A 5AV6A 3A6NC 5BNXB 4J8UC 3AZNB 1F66D 3WAAD 3C1BA 4WU9C 3TU4D 3AZLB 1ID3A 4ZUXD 5CPJB 5B2IA 5BNXA 4XZQA 5B40D 1M18B 5GSUA 5BNVB 5B31D 3UT9C 2HIOA 1M1AC 1HTAA 5AY8C 3AZFC 1U35B 1M18A 3MGPA 1TZYB 2PYOB 3W96B 3W99A 1U35A 1S32A 5AVBC 1KX3C 3LJAB 1M19D 3X1UC 2ZY5A 3X1TA 3UTBC 5B32A 3KWQD 1P3MB 4E44A 2Y2NA 3EG5B 1AOIB 3AZJD 4G92B 5DNMD 5B1LB 3WTPA 4H9QB 3AFAD 5B33A 5BS7A 5CPKD 1PZRA 1HQ3B 3AZIB 5B1LA 5AVCD 4H9QA 5G49A 1BH8B 2FFFB 4H9SC 1P3PD 5CPID 3RELD 4UUZA 4WU9B 3X1VC 5B2JB 4YS3D 1EQZD 5C3IC 2LY8A 1P3FC 3AZGD 1TAFA 3MGSB 5B2JA 3LELD 3LZ0C 5B0ZD 3REHA 1Z2CB 5AY8B 2BYMB 3AZFB 3MVDD 2BYKB 4J8WC 3KSYA 2NZDD 4CAYA 1ZLAC 1KU5A 2G5IC 2L5AA 5E5AD 5CP6C 5B0YC 3C1CD 4ZUXC 1AOID 1KX4C 4J8VD 3WKJA 4G91C 3AYWB 2Y2IA 5DNND 5B31C 5B1MD 3REIA 2FJ7B 3MNNB 3VH6T 1N1JB 3O62B 5AV9B 1WWIA 3A6ND 2FJ7A 4J8UD 5GT3B 2Y2MA 3H0RC 2JCHA 3KXBC 4XUJC 3O62A 5C3IB 5AV9A 3AZED 3NQJA 3REKD 5GT3A 5GT0B 5AV8D 3MGQD 2F8NB 3B0DC 4J8XC 5BO0B 3AV1B 5DNMC 3UT9D 1M1AD 2IO5B 3REJB 4LD9C 2F8NA 1P3GA 5GXQC 3AZKC 3B0CW 1P3AA 5AVCC 2NQBD 1ZLAB 3B6FA 5AVBD 4Z66C 1KX3D 3B6GC 1B67A 5CPIC 3X1UD 3WAAB 4NFTA 3UTBD 3TU4B 1EQZC 4H9NA 4YS3C 4ZUXB 5B24C 3WTPE 5F99C 1F66A 4KGCD 5B40B 5B31B 4R8PC 4AWLB 3KUYC 2JE5A 3WA9C 5B40A 2CWEA 3H0LC 1F1EA 3R45B 4NE3A 1H3OB 4JJNC 3KXBB 3X1VD 1ID3C 1JFIB 5AV5A 3VH5W 4EO5B 1M19B 5B2IC 1P3FD 3R45A 4XZQC 3AN2D 4X23A 4Z5TA 3KWQB 3LZ1A 3W98A 3LZ0D 3AZJB 2F8NG 1P3KA 2HIOC 5DNMB 1P34D 3AFAB 3KWQA 5CPKB 5DNNC 4WZSB 4J8WD 4NE6A 5B1MC 5AVCB 1ZLAD 3A1IA 1S32C 3AZMC 5CP6D 5KDMA 3MGRC 2CV5A 2Y2PA 5B0YD 1P3PB 3X1TC 5CPIB 3RELB 3AV2D 1KX5D 4YS3B 1EQZB 3AZEC 1P3OC 3AZNA 3AZGB 3REKC 1KX4D 2Y2HA 2ZY4A 3RELA 3AL0C 5AV8C 3MGQC 5B33C 3AZLA 5CPJA 3LELB 5B0ZB 2Y2QA 5B31G 4KUDD 3MVDB 2NZDB 3LELA 5BNVA 1P3ID 5B0ZA 2NQBC 5E5AB 3KXBD 3MVDA 2NZDA 4XUJD 1TZYA 2PYOA 3W96A 3EPLA 4YM6C 3C1CB 4WU8D 5E5AA 4DQYB 4J8XD 3LJAA 4J8VB 4KGCC 4ZBJB 4LD9D 1P3MA 5DNNB 3X1SC 1AOIA 5GXQD 5B1MB 3AZKD 4J8VA 4Z66D 3B6GD 3A6NB 1HQ3A 3IP4C 3V9RB 4J8UB 3AZIA 3EPHA 5JRGD 3AZEB 5B24D 1P3OB 5F99D 3W97D 1BH8A 1A7WA 3REKB 3WKJC 3AN2C 4WU9A 1P3BC 5AV8B 3MGQB 4QLCD 4R8PD 3UT9B 3KUYD 1P34C 1M1AB 3WA9D 3MGSA 2RIQA 2XD1A 3UT9A 1M1AA 2NQBB 3C1BD 5AY8A 2BYMA 5AVBB 4JJND 2BYKA 3AZFA 1KX3B 1ID3D 5B2ID 3X1UB 4XZQD 4WV4B 3UTBB 3AV2C 1KX5C 5AVBA 5GSUD 3UTAC 2HIOD 4KGCB 3MGPD 1P3AC 3W99D 3AYWA 4KUDC 1S32D 3AZMD 2AROC 3MGRD 1P3IC 2W8SA 3MNNA 3X1TD 5FUGB 1N1JA 5B32D 3B0BA 4CSRB 3X1VB 1P3LC 2YFVB 1P3OD 1P3FB 4H9SA 3AN2B 3WTPD 5FUGA 4WU8C 1Q9CA 5B33D 2DQNC 3LZ0B 3AZHC 1P34B 5GT0A 3VH5A 4J8WB 5BO0A 2HUEC 4KHAB 3AV1A 3REJA 5CP6B 2JSSA 5AV5C 2UWXA 5B0YB 5JRGC 4YM6D 1ZLAA 4H9PB 3AV2B 1KX5B 3W97C 3REHD 1P3KC 1KX4B 3UTAB 3WAAA 4G91B 3TU4A 4ZUXA 2XD5A 4QLCC 3X1SD 4KUDB 5AV6C 2J8PA 2RVQC 1P3IB 1T3UA 5B31A 3C1BC 5JA4B 4XUJB 4DRBA 3AZNC 1H3OA 3WKJD 3F6TA 2F8NK 4WU8B 3AZLC 1P3BD 3KXBA 3B0DB 5JA4A 5GSUC 1JFIA 4J8XB 1M19A 3REID 4UPKA 4NE5A 4LD9B 1M18C 2Y2LA 3MGPC 4HGAC 4J8XA 4H9OB 5GXQB 3AZJA 3AZKB 3W99C 5DNMA 3AFAA 1U35C 5CHLB 4Z66B 5CPKA 3B6GB 4H9OA 1TZYC 4E45A 5BT1C 2PYOC 5JRGB 5AVCA 5B32C 4Z66A 5B24B 5F99B 3W97B 3UTAD 1P3PA 5CPIA 3WTPC 5BS7C 1EQZA 4YS3A 1P3GD 5B24A 4QLCB 5F99A 4R8PB 4G92C 3KUYB 3AZGA 1P3AD 5B1LC 3WA9B 3B6FD 3B0CT 2AROD 1HQ3C 4R8PA 3AZIC 3KUYA 3C1BB 4JJNB 1ID3B 1P3LD 2ZY3A 3H0MC 5B2IB 4XZQB 3EPKA 2DF4C 5B2JC 4JJNA 5GSUB 3REHC 2HIOB 3AZHD 3C1CA 3MGSC 3NQUB 3MGPB 4HGAB 3W99B 1S32B 3AZMB 4H9RB 5DNNA 3VH6W 5AV5D 3NQUA 3MGRB 5B1MA 4Z2MH 2Y2JA 3X1TB 4X23D 3VH5T 4Z5TD 5B32B 3AZMA 4H9RA 3LZ1D 3A6NA 3W98D 3MGRA 3V9RA 4J8UA 1P3KD 3WTPB 5B33B 3KFUG 3AZEA 1P3OA 3REIC 3REKA 2Y2OA 3AYWC 5AV8A 1B6WA 5AV6D 3MGQA 1W2EA 2Y2KA 2RVQD 2CV5D 5G49B 2FJ7C 3MNNC 1BFMA 4UUZB 2BG1A 3O62C 5AV9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN D;  5GT3 C;  4YM6 B;  2NQB A;  1TAF B;  3AZL D;  1KX3 A;  5CPJ D;  4Z2M G;  3REH B;  3X1U A;  5GT0 C;  4YM6 A;  3UTB A;  1P3G C;  1M18 D;  3X1S B;  4CAY B;  3AV1 C;  2IO5 C;  3B6F C;  4KGC A;  1U35 D;  3REJ C;  3X1S A;  1TZY D;  5BT1 D;  2PYO D;  3W96 D;  5B32 G;  3LJA D;  1F66 C;  3WAA C;  3WKJ B;  3TU4 C;  1P3B B;  3X1V A;  1P3M D;  4CSR A;  2YFV A;  3REI B;  1P3F A;  5B1L D;  3AN2 A;  5B40 C;  1P3B A;  4M6B A;  1HQ3 D;  3LZ0 A;  4AWL C;  1BH9 B;  3AZI D;  1ULY A;  1P34 A;  4J8W A;  3NQJ B;  4KHA A;  1BH9 A;  4X23 C;  4DRA A;  4Z5T C;  4WU9 D;  3LZ1 C;  5B2J D;  5CP6 A;  3W98 C;  4EO5 C;  1M19 C;  5B0Y A;  4H9P A;  3KWQ C;  3MGS D;  3AV2 A;  1KX5 A;  1P3G B;  3AZJ C;  1KX4 A;  3UTA A;  1P3A B;  3AFA C;  3B6F B;  5AY8 D;  3AZF D;  5CPK C;  2ARO B;  4WNN B;  2CV5 C;  4KUD A;  4H9N B;  1P3L B;  2ARO A;  4WNN A;  1P3I A;  1P3P C;  1F66 B;  2F8N H;  3REL C;  1WWS A;  5CPJ C;  4XUJ A;  1P3L A;  3AZG C;  3AZH B;  3AYW D;  4WU8 A;  3LEL C;  2YFW B;  5B0Z C;  1R4V A;  2HUE B;  2FJ7 D;  3MNN D;  3AZH A;  4LD9 A;  3MVD C;  2NZD C;  3O62 D;  5AV9 D;  5AV5 B;  5GXQ A;  2YFW A;  3AZK A;  3W96 C;  5GT3 D;  4X23 B;  4Z5T B;  5E5A C;  3LZ1 B;  3B6G A;  3W98 B;  3LJA C;  1P3K B;  5GT0 D;  5JRG A;  3C1C C;  1P3M C;  3VH6 A;  2F8N D;  1AOI C;  3W97 A;  3AV1 D;  4J8V C;  4ZBJ C;  3REJ D;  5AV6 B;  5KDM B;  4QLC A;  2CV5 B;  3WA9 A;  5AV6 A;  3A6N C;  5BNX B;  4J8U C;  3AZN B;  1F66 D;  3WAA D;  3C1B A;  4WU9 C;  3TU4 D;  3AZL B;  1ID3 A;  4ZUX D;  5CPJ B;  5B2I A;  5BNX A;  4XZQ A;  5B40 D;  1M18 B;  5GSU A;  5BNV B;  5B31 D;  3UT9 C;  2HIO A;  1M1A C;  1HTA A;  5AY8 C;  3AZF C;  1U35 B;  1M18 A;  3MGP A;  1TZY B;  2PYO B;  3W96 B;  3W99 A;  1U35 A;  1S32 A;  5AVB C;  1KX3 C;  3LJA B;  1M19 D;  3X1U C;  3X1T A;  3UTB C;  5B32 A;  3KWQ D;  1P3M B;  4E44 A;  1AOI B;  3AZJ D;  4G92 B;  5DNM D;  5B1L B;  3WTP A;  4H9Q B;  3AFA D;  5B33 A;  5BS7 A;  5CPK D;  1HQ3 B;  3AZI B;  5B1L A;  5AVC D;  4H9Q A;  5G49 A;  1BH8 B;  4H9S C;  1P3P D;  5CPI D;  3REL D;  4UUZ A;  4WU9 B;  3X1V C;  5B2J B;  4YS3 D;  1EQZ D;  5C3I C;  2LY8 A;  1P3F C;  3AZG D;  1TAF A;  3MGS B;  5B2J A;  3LEL D;  3LZ0 C;  5B0Z D;  3REH A;  5AY8 B;  2BYM B;  3AZF B;  3MVD D;  2BYK B;  4J8W C;  3KSY A;  2NZD D;  4CAY A;  1ZLA C;  1KU5 A;  5E5A D;  2L5A A;  5CP6 C;  5B0Y C;  3C1C D;  4ZUX C;  1AOI D;  1KX4 C;  4J8V D;  3WKJ A;  4G91 C;  3AYW B;  5DNN D;  5B31 C;  5B1M D;  3REI A;  2FJ7 B;  3MNN B;  3VH6 T;  1N1J B;  3O62 B;  5AV9 B;  1WWI A;  3A6N D;  2FJ7 A;  4J8U D;  5GT3 B;  3KXB C;  4XUJ C;  3O62 A;  5C3I B;  5AV9 A;  3AZE D;  3NQJ A;  3REK D;  5GT3 A;  5GT0 B;  5AV8 D;  3MGQ D;  2F8N B;  3B0D C;  4J8X C;  5BO0 B;  3AV1 B;  5DNM C;  3UT9 D;  1M1A D;  2IO5 B;  3REJ B;  4LD9 C;  2F8N A;  1P3G A;  5GXQ C;  3AZK C;  3B0C W;  1P3A A;  5AVC C;  2NQB D;  1ZLA B;  3B6F A;  5AVB D;  4Z66 C;  1KX3 D;  3B6G C;  1B67 A;  5CPI C;  3X1U D;  3WAA B;  4NFT A;  3UTB D;  3TU4 B;  1EQZ C;  4H9N A;  4YS3 C;  4ZUX B;  5B24 C;  3WTP E;  5F99 C;  1F66 A;  4KGC D;  5B40 B;  5B31 B;  4R8P C;  4AWL B;  3KUY C;  3WA9 C;  5B40 A;  2CWE A;  1F1E A;  1H3O B;  4NE3 A;  3R45 B;  4JJN C;  3KXB B;  3X1V D;  1ID3 C;  1JFI B;  5AV5 A;  3VH5 W;  4EO5 B;  1M19 B;  5B2I C;  1P3F D;  3R45 A;  4XZQ C;  3AN2 D;  4X23 A;  4Z5T A;  3KWQ B;  3LZ1 A;  3W98 A;  3LZ0 D;  3AZJ B;  2F8N G;  1P3K A;  2HIO C;  5DNM B;  1P34 D;  3AFA B;  3KWQ A;  5CPK B;  5DNN C;  4WZS B;  4J8W D;  4NE6 A;  5B1M C;  5AVC B;  1ZLA D;  1S32 C;  3AZM C;  5CP6 D;  5KDM A;  3MGR C;  2CV5 A;  5B0Y D;  1P3P B;  3X1T C;  5CPI B;  3REL B;  3AV2 D;  1KX5 D;  4YS3 B;  1EQZ B;  3AZE C;  1P3O C;  3AZN A;  3AZG B;  3REK C;  1KX4 D;  3REL A;  5AV8 C;  3MGQ C;  5B33 C;  3AZL A;  5CPJ A;  3LEL B;  5B0Z B;  5B31 G;  4KUD D;  3MVD B;  2NZD B;  3LEL A;  5BNV A;  1P3I D;  5B0Z A;  2NQB C;  5E5A B;  3KXB D;  3MVD A;  2NZD A;  4XUJ D;  1TZY A;  2PYO A;  3W96 A;  4YM6 C;  3C1C B;  4WU8 D;  5E5A A;  4J8X D;  3LJA A;  4J8V B;  4KGC C;  4ZBJ B;  4LD9 D;  1P3M A;  5DNN B;  3X1S C;  1AOI A;  5GXQ D;  5B1M B;  3AZK D;  4J8V A;  4Z66 D;  3B6G D;  3A6N B;  1HQ3 A;  3V9R B;  4J8U B;  3AZI A;  5JRG D;  3AZE B;  5B24 D;  1P3O B;  5F99 D;  3W97 D;  1BH8 A;  1A7W A;  3REK B;  3WKJ C;  3AN2 C;  4WU9 A;  1P3B C;  5AV8 B;  3MGQ B;  4QLC D;  4R8P D;  3UT9 B;  3KUY D;  1P34 C;  1M1A B;  3WA9 D;  3MGS A;  3UT9 A;  1M1A A;  2NQB B;  3C1B D;  5AY8 A;  2BYM A;  5AVB B;  4JJN D;  2BYK A;  3AZF A;  1KX3 B;  1ID3 D;  5B2I D;  3X1U B;  4XZQ D;  4WV4 B;  3UTB B;  3AV2 C;  1KX5 C;  5AVB A;  5GSU D;  3UTA C;  2HIO D;  4KGC B;  3MGP D;  1P3A C;  3W99 D;  3AYW A;  4KUD C;  1S32 D;  3AZM D;  2ARO C;  3MGR D;  1P3I C;  3MNN A;  3X1T D;  5FUG B;  1N1J A;  5B32 D;  3B0B A;  4CSR B;  3X1V B;  1P3L C;  2YFV B;  1P3O D;  1P3F B;  4H9S A;  3AN2 B;  3WTP D;  5FUG A;  4WU8 C;  1Q9C A;  5B33 D;  3LZ0 B;  3AZH C;  1P34 B;  5GT0 A;  3VH5 A;  4J8W B;  5BO0 A;  2HUE C;  4KHA B;  3AV1 A;  3REJ A;  5CP6 B;  2JSS A;  5AV5 C;  5B0Y B;  5JRG C;  4YM6 D;  1ZLA A;  4H9P B;  3AV2 B;  1KX5 B;  3W97 C;  3REH D;  1P3K C;  1KX4 B;  3UTA B;  3WAA A;  4G91 B;  3TU4 A;  4ZUX A;  4QLC C;  3X1S D;  4KUD B;  5AV6 C;  2RVQ C;  1P3I B;  5B31 A;  3C1B C;  5JA4 B;  4XUJ B;  4DRB A;  3AZN C;  1H3O A;  3WKJ D;  2F8N K;  4WU8 B;  3AZL C;  1P3B D;  3KXB A;  3B0D B;  5JA4 A;  5GSU C;  1JFI A;  4J8X B;  1M19 A;  3REI D;  4NE5 A;  4LD9 B;  1M18 C;  3MGP C;  4HGA C;  4J8X A;  4H9O B;  5GXQ B;  3AZJ A;  3AZK B;  3W99 C;  5DNM A;  3AFA A;  1U35 C;  5CHL B;  4Z66 B;  5CPK A;  3B6G B;  4H9O A;  1TZY C;  4E45 A;  5BT1 C;  2PYO C;  5JRG B;  5AVC A;  5B32 C;  4Z66 A;  5B24 B;  5F99 B;  3W97 B;  3UTA D;  1P3P A;  5CPI A;  3WTP C;  5BS7 C;  1EQZ A;  4YS3 A;  1P3G D;  5B24 A;  4QLC B;  5F99 A;  4R8P B;  4G92 C;  3KUY B;  3AZG A;  1P3A D;  5B1L C;  3WA9 B;  3B6F D;  3B0C T;  2ARO D;  1HQ3 C;  4R8P A;  3AZI C;  3KUY A;  3C1B B;  4JJN B;  1ID3 B;  1P3L D;  5B2I B;  4XZQ B;  5B2J C;  4JJN A;  5GSU B;  3REH C;  2HIO B;  3AZH D;  3C1C A;  3MGS C;  3NQU B;  3MGP B;  4HGA B;  3W99 B;  1S32 B;  3AZM B;  4H9R B;  5DNN A;  3VH6 W;  5AV5 D;  3NQU A;  3MGR B;  5B1M A;  4Z2M H;  3X1T B;  4X23 D;  3VH5 T;  4Z5T D;  5B32 B;  3AZM A;  4H9R A;  3LZ1 D;  3A6N A;  3W98 D;  3MGR A;  3V9R A;  4J8U A;  1P3K D;  3WTP B;  5B33 B;  3AZE A;  1P3O A;  3REI C;  3REK A;  3AYW C;  5AV8 A;  1B6W A;  5AV6 D;  3MGQ A;  2RVQ D;  2CV5 D;  5G49 B;  2FJ7 C;  3MNN C;  1BFM A;  4UUZ B;  3O62 C;  5AV9 C; 
#chains in the Genus database with same CATH topology
 3AZN D;  5GT3 C;  4YM6 B;  2NQB A;  1TAF B;  3AZL D;  1KX3 A;  5CPJ D;  4Z2M G;  3REH B;  3X1U A;  5GT0 C;  4YM6 A;  3UTB A;  1P3G C;  1M18 D;  3X1S B;  4CAY B;  3AV1 C;  2IO5 C;  3B6F C;  4KGC A;  1U35 D;  3REJ C;  3X1S A;  1TZY D;  5BT1 D;  2PYO D;  3W96 D;  5B32 G;  3LJA D;  1F66 C;  3WAA C;  3WKJ B;  3TU4 C;  1P3B B;  3X1V A;  1P3M D;  4CSR A;  2YFV A;  3REI B;  3EPJ A;  1P3F A;  5B1L D;  3AN2 A;  5B40 C;  1P3B A;  4M6B A;  1HQ3 D;  3LZ0 A;  4AWL C;  1BH9 B;  3AZI D;  1ULY A;  1P34 A;  4J8W A;  2F2A C;  3NQJ B;  4KHA A;  1BH9 A;  4X23 C;  4DRA A;  4Z5T C;  4WU9 D;  3LZ1 C;  5B2J D;  5CP6 A;  3W98 C;  4EO5 C;  1M19 C;  5B0Y A;  4H9P A;  3KWQ C;  3MGS D;  2G5H C;  3AV2 A;  1P3G B;  1KX5 A;  3AZJ C;  3FDD A;  1KX4 A;  3UTA A;  1P3A B;  3AFA C;  3B6F B;  2ZM5 A;  5AY8 D;  3AZF D;  5CPK C;  2ARO B;  4WNN B;  2CV5 C;  4KUD A;  4H9N B;  1P3L B;  2ARO A;  4WNN A;  1P3I A;  1P3P C;  1F66 B;  2F8N H;  3REL C;  1WWS A;  5CPJ C;  4XUJ A;  1P3L A;  3AZG C;  3AZH B;  3AYW D;  4WU8 A;  3LEL C;  3P5J B;  2YFW B;  5B0Z C;  1R4V A;  2HUE B;  3A1K A;  3MNN D;  2FJ7 D;  3AZH A;  2Y2G A;  2VQR A;  4LD9 A;  3MVD C;  2NZD C;  3O62 D;  5AV9 D;  5AV5 B;  5GXQ A;  2YFW A;  3AZK A;  3W96 C;  5GT3 D;  4X23 B;  4Z5T B;  5E5A C;  3LZ1 B;  3B6G A;  3W98 B;  4WJ3 C;  3LJA C;  1P3K B;  2ZY2 A;  5GT0 D;  5JRG A;  3C1C C;  1P3M C;  3VH6 A;  2F8N D;  1AOI C;  3W97 A;  3AV1 D;  4J8V C;  4ZBJ C;  3REJ D;  5AV6 B;  5KDM B;  4QLC A;  2CV5 B;  3WA9 A;  5AV6 A;  3A6N C;  5BNX B;  4J8U C;  3AZN B;  1F66 D;  3WAA D;  3C1B A;  4WU9 C;  3TU4 D;  3AZL B;  1ID3 A;  4ZUX D;  5CPJ B;  5B2I A;  5BNX A;  4XZQ A;  5B40 D;  1M18 B;  5GSU A;  5BNV B;  5B31 D;  3UT9 C;  2HIO A;  1M1A C;  1HTA A;  5AY8 C;  3AZF C;  1U35 B;  1M18 A;  3MGP A;  1TZY B;  2PYO B;  3W96 B;  3W99 A;  1U35 A;  1S32 A;  5AVB C;  1KX3 C;  3LJA B;  1M19 D;  3X1U C;  2ZY5 A;  3X1T A;  3UTB C;  5B32 A;  3KWQ D;  1P3M B;  4E44 A;  2Y2N A;  3EG5 B;  1AOI B;  3AZJ D;  4G92 B;  5DNM D;  5B1L B;  3WTP A;  4H9Q B;  3AFA D;  5B33 A;  5BS7 A;  5CPK D;  1PZR A;  1HQ3 B;  3AZI B;  5B1L A;  5AVC D;  4H9Q A;  5G49 A;  1BH8 B;  2FFF B;  4H9S C;  1P3P D;  5CPI D;  3REL D;  4UUZ A;  4WU9 B;  3X1V C;  5B2J B;  4YS3 D;  1EQZ D;  5C3I C;  2LY8 A;  1P3F C;  3AZG D;  1TAF A;  3MGS B;  5B2J A;  3LEL D;  3LZ0 C;  5B0Z D;  3REH A;  1Z2C B;  5AY8 B;  2BYM B;  3AZF B;  3MVD D;  2BYK B;  4J8W C;  3KSY A;  2NZD D;  4CAY A;  1ZLA C;  1KU5 A;  2G5I C;  2L5A A;  5E5A D;  5CP6 C;  5B0Y C;  3C1C D;  4ZUX C;  1AOI D;  1KX4 C;  4J8V D;  3WKJ A;  4G91 C;  3AYW B;  2Y2I A;  5DNN D;  5B31 C;  5B1M D;  3REI A;  2FJ7 B;  3MNN B;  3VH6 T;  1N1J B;  3O62 B;  5AV9 B;  1WWI A;  3A6N D;  2FJ7 A;  4J8U D;  5GT3 B;  2Y2M A;  3H0R C;  2JCH A;  3KXB C;  4XUJ C;  3O62 A;  5C3I B;  5AV9 A;  3AZE D;  3NQJ A;  3REK D;  5GT3 A;  5GT0 B;  5AV8 D;  3MGQ D;  2F8N B;  3B0D C;  4J8X C;  5BO0 B;  3AV1 B;  5DNM C;  3UT9 D;  1M1A D;  2IO5 B;  3REJ B;  4LD9 C;  2F8N A;  1P3G A;  5GXQ C;  3AZK C;  3B0C W;  1P3A A;  5AVC C;  2NQB D;  1ZLA B;  3B6F A;  5AVB D;  4Z66 C;  1KX3 D;  3B6G C;  1B67 A;  5CPI C;  3X1U D;  3WAA B;  4NFT A;  3UTB D;  3TU4 B;  1EQZ C;  4H9N A;  4YS3 C;  4ZUX B;  5B24 C;  3WTP E;  5F99 C;  1F66 A;  4KGC D;  5B40 B;  5B31 B;  4R8P C;  4AWL B;  3KUY C;  2JE5 A;  3WA9 C;  5B40 A;  2CWE A;  3H0L C;  1F1E A;  3R45 B;  4NE3 A;  1H3O B;  4JJN C;  3KXB B;  3X1V D;  1ID3 C;  1JFI B;  5AV5 A;  3VH5 W;  4EO5 B;  1M19 B;  5B2I C;  1P3F D;  3R45 A;  4XZQ C;  3AN2 D;  4X23 A;  4Z5T A;  3KWQ B;  3LZ1 A;  3W98 A;  3LZ0 D;  3AZJ B;  2F8N G;  1P3K A;  2HIO C;  5DNM B;  1P34 D;  3AFA B;  3KWQ A;  5CPK B;  5DNN C;  4WZS B;  4J8W D;  4NE6 A;  5B1M C;  5AVC B;  1ZLA D;  3A1I A;  1S32 C;  3AZM C;  5CP6 D;  5KDM A;  3MGR C;  2CV5 A;  2Y2P A;  5B0Y D;  1P3P B;  3X1T C;  5CPI B;  3REL B;  3AV2 D;  1KX5 D;  4YS3 B;  1EQZ B;  3AZE C;  1P3O C;  3AZN A;  3AZG B;  3REK C;  1KX4 D;  2Y2H A;  2ZY4 A;  3REL A;  3AL0 C;  5AV8 C;  3MGQ C;  5B33 C;  3AZL A;  5CPJ A;  3LEL B;  5B0Z B;  2Y2Q A;  5B31 G;  4KUD D;  3MVD B;  2NZD B;  3LEL A;  5BNV A;  1P3I D;  5B0Z A;  2NQB C;  5E5A B;  3KXB D;  3MVD A;  2NZD A;  4XUJ D;  1TZY A;  2PYO A;  3W96 A;  3EPL A;  4YM6 C;  3C1C B;  4WU8 D;  5E5A A;  4DQY B;  4J8X D;  3LJA A;  4J8V B;  4KGC C;  4ZBJ B;  4LD9 D;  1P3M A;  5DNN B;  3X1S C;  1AOI A;  5GXQ D;  5B1M B;  3AZK D;  4J8V A;  4Z66 D;  3B6G D;  3A6N B;  1HQ3 A;  3IP4 C;  3V9R B;  4J8U B;  3AZI A;  3EPH A;  5JRG D;  3AZE B;  5B24 D;  1P3O B;  5F99 D;  3W97 D;  1BH8 A;  1A7W A;  3REK B;  3WKJ C;  3AN2 C;  4WU9 A;  1P3B C;  5AV8 B;  3MGQ B;  4QLC D;  4R8P D;  3UT9 B;  3KUY D;  1P34 C;  1M1A B;  3WA9 D;  3MGS A;  2RIQ A;  2XD1 A;  3UT9 A;  1M1A A;  2NQB B;  3C1B D;  5AY8 A;  2BYM A;  5AVB B;  4JJN D;  2BYK A;  3AZF A;  1KX3 B;  1ID3 D;  5B2I D;  3X1U B;  4XZQ D;  4WV4 B;  3UTB B;  3AV2 C;  1KX5 C;  5AVB A;  5GSU D;  3UTA C;  2HIO D;  4KGC B;  3MGP D;  1P3A C;  3W99 D;  3AYW A;  4KUD C;  1S32 D;  3AZM D;  2ARO C;  3MGR D;  1P3I C;  2W8S A;  3MNN A;  3X1T D;  5FUG B;  1N1J A;  5B32 D;  3B0B A;  4CSR B;  3X1V B;  1P3L C;  2YFV B;  1P3O D;  1P3F B;  4H9S A;  3AN2 B;  3WTP D;  5FUG A;  4WU8 C;  1Q9C A;  5B33 D;  2DQN C;  3LZ0 B;  3AZH C;  1P34 B;  5GT0 A;  3VH5 A;  4J8W B;  5BO0 A;  2HUE C;  4KHA B;  3AV1 A;  3REJ A;  5CP6 B;  2JSS A;  5AV5 C;  2UWX A;  5B0Y B;  5JRG C;  4YM6 D;  1ZLA A;  4H9P B;  3AV2 B;  1KX5 B;  3W97 C;  3REH D;  1P3K C;  1KX4 B;  3UTA B;  3WAA A;  4G91 B;  3TU4 A;  4ZUX A;  2XD5 A;  4QLC C;  3X1S D;  4KUD B;  5AV6 C;  2J8P A;  2RVQ C;  1P3I B;  1T3U A;  5B31 A;  3C1B C;  5JA4 B;  4XUJ B;  4DRB A;  3AZN C;  1H3O A;  3WKJ D;  3F6T A;  2F8N K;  4WU8 B;  3AZL C;  1P3B D;  3KXB A;  3B0D B;  5JA4 A;  5GSU C;  1JFI A;  4J8X B;  1M19 A;  3REI D;  4UPK A;  4NE5 A;  4LD9 B;  1M18 C;  2Y2L A;  3MGP C;  4HGA C;  4J8X A;  4H9O B;  5GXQ B;  3AZJ A;  3AZK B;  3W99 C;  5DNM A;  3AFA A;  1U35 C;  5CHL B;  4Z66 B;  5CPK A;  3B6G B;  4H9O A;  1TZY C;  4E45 A;  5BT1 C;  2PYO C;  5JRG B;  5AVC A;  5B32 C;  4Z66 A;  5B24 B;  5F99 B;  3W97 B;  3UTA D;  1P3P A;  5CPI A;  3WTP C;  5BS7 C;  1EQZ A;  4YS3 A;  1P3G D;  5B24 A;  4QLC B;  5F99 A;  4R8P B;  4G92 C;  3KUY B;  3AZG A;  1P3A D;  5B1L C;  3WA9 B;  3B6F D;  3B0C T;  2ARO D;  1HQ3 C;  4R8P A;  3AZI C;  3KUY A;  3C1B B;  4JJN B;  1ID3 B;  1P3L D;  2ZY3 A;  3H0M C;  5B2I B;  4XZQ B;  3EPK A;  2DF4 C;  5B2J C;  4JJN A;  5GSU B;  3REH C;  2HIO B;  3AZH D;  3C1C A;  3MGS C;  3NQU B;  3MGP B;  4HGA B;  3W99 B;  1S32 B;  3AZM B;  4H9R B;  5DNN A;  3VH6 W;  5AV5 D;  3NQU A;  3MGR B;  5B1M A;  4Z2M H;  2Y2J A;  3X1T B;  4X23 D;  3VH5 T;  4Z5T D;  5B32 B;  3AZM A;  4H9R A;  3LZ1 D;  3A6N A;  3W98 D;  3MGR A;  3V9R A;  4J8U A;  1P3K D;  3WTP B;  5B33 B;  3KFU G;  3AZE A;  1P3O A;  3REI C;  3REK A;  2Y2O A;  3AYW C;  5AV8 A;  1B6W A;  5AV6 D;  3MGQ A;  1W2E A;  2Y2K A;  2RVQ D;  2CV5 D;  5G49 B;  2FJ7 C;  3MNN C;  1BFM A;  4UUZ B;  2BG1 A;  3O62 C;  5AV9 C; 
#chains in the Genus database with same CATH homology
 3AZN D;  5GT3 C;  4YM6 B;  2NQB A;  1TAF B;  3AZL D;  1KX3 A;  5CPJ D;  4Z2M G;  3REH B;  3X1U A;  5GT0 C;  4YM6 A;  3UTB A;  1P3G C;  1M18 D;  3X1S B;  4CAY B;  3AV1 C;  2IO5 C;  3B6F C;  4KGC A;  1U35 D;  3REJ C;  3X1S A;  1TZY D;  5BT1 D;  2PYO D;  3W96 D;  5B32 G;  3LJA D;  1F66 C;  3WAA C;  3WKJ B;  3TU4 C;  1P3B B;  3X1V A;  1P3M D;  4CSR A;  2YFV A;  3REI B;  3EPJ A;  1P3F A;  5B1L D;  3AN2 A;  5B40 C;  1P3B A;  4M6B A;  1HQ3 D;  3LZ0 A;  4AWL C;  1BH9 B;  3AZI D;  1ULY A;  1P34 A;  4J8W A;  2F2A C;  3NQJ B;  4KHA A;  1BH9 A;  4X23 C;  4DRA A;  4Z5T C;  4WU9 D;  3LZ1 C;  5B2J D;  5CP6 A;  3W98 C;  4EO5 C;  1M19 C;  5B0Y A;  4H9P A;  3KWQ C;  3MGS D;  2G5H C;  3AV2 A;  1P3G B;  1KX5 A;  3AZJ C;  3FDD A;  1KX4 A;  3UTA A;  1P3A B;  3AFA C;  3B6F B;  2ZM5 A;  5AY8 D;  3AZF D;  5CPK C;  2ARO B;  4WNN B;  2CV5 C;  4KUD A;  4H9N B;  1P3L B;  2ARO A;  4WNN A;  1P3I A;  1P3P C;  1F66 B;  2F8N H;  3REL C;  1WWS A;  5CPJ C;  4XUJ A;  1P3L A;  3AZG C;  3AZH B;  3AYW D;  4WU8 A;  3LEL C;  3P5J B;  2YFW B;  5B0Z C;  1R4V A;  2HUE B;  3A1K A;  3MNN D;  2FJ7 D;  3AZH A;  2Y2G A;  2VQR A;  4LD9 A;  3MVD C;  2NZD C;  3O62 D;  5AV9 D;  5AV5 B;  5GXQ A;  2YFW A;  3AZK A;  3W96 C;  5GT3 D;  4X23 B;  4Z5T B;  5E5A C;  3LZ1 B;  3B6G A;  3W98 B;  4WJ3 C;  3LJA C;  1P3K B;  2ZY2 A;  5GT0 D;  5JRG A;  3C1C C;  1P3M C;  3VH6 A;  2F8N D;  1AOI C;  3W97 A;  3AV1 D;  4J8V C;  4ZBJ C;  3REJ D;  5AV6 B;  5KDM B;  4QLC A;  2CV5 B;  3WA9 A;  5AV6 A;  3A6N C;  5BNX B;  4J8U C;  3AZN B;  1F66 D;  3WAA D;  3C1B A;  4WU9 C;  3TU4 D;  3AZL B;  1ID3 A;  4ZUX D;  5CPJ B;  5B2I A;  5BNX A;  4XZQ A;  5B40 D;  1M18 B;  5GSU A;  5BNV B;  5B31 D;  3UT9 C;  2HIO A;  1M1A C;  1HTA A;  5AY8 C;  3AZF C;  1U35 B;  1M18 A;  3MGP A;  1TZY B;  2PYO B;  3W96 B;  3W99 A;  1U35 A;  1S32 A;  5AVB C;  1KX3 C;  3LJA B;  1M19 D;  3X1U C;  2ZY5 A;  3X1T A;  3UTB C;  5B32 A;  3KWQ D;  1P3M B;  4E44 A;  2Y2N A;  3EG5 B;  1AOI B;  3AZJ D;  4G92 B;  5DNM D;  5B1L B;  3WTP A;  4H9Q B;  3AFA D;  5B33 A;  5BS7 A;  5CPK D;  1PZR A;  1HQ3 B;  3AZI B;  5B1L A;  5AVC D;  4H9Q A;  5G49 A;  1BH8 B;  2FFF B;  4H9S C;  1P3P D;  5CPI D;  3REL D;  4UUZ A;  4WU9 B;  3X1V C;  5B2J B;  4YS3 D;  1EQZ D;  5C3I C;  2LY8 A;  1P3F C;  3AZG D;  1TAF A;  3MGS B;  5B2J A;  3LEL D;  3LZ0 C;  5B0Z D;  3REH A;  1Z2C B;  5AY8 B;  2BYM B;  3AZF B;  3MVD D;  2BYK B;  4J8W C;  3KSY A;  2NZD D;  4CAY A;  1ZLA C;  1KU5 A;  2G5I C;  2L5A A;  5E5A D;  5CP6 C;  5B0Y C;  3C1C D;  4ZUX C;  1AOI D;  1KX4 C;  4J8V D;  3WKJ A;  4G91 C;  3AYW B;  2Y2I A;  5DNN D;  5B31 C;  5B1M D;  3REI A;  2FJ7 B;  3MNN B;  3VH6 T;  1N1J B;  3O62 B;  5AV9 B;  1WWI A;  3A6N D;  2FJ7 A;  4J8U D;  5GT3 B;  2Y2M A;  3H0R C;  2JCH A;  3KXB C;  4XUJ C;  3O62 A;  5C3I B;  5AV9 A;  3AZE D;  3NQJ A;  3REK D;  5GT3 A;  5GT0 B;  5AV8 D;  3MGQ D;  2F8N B;  3B0D C;  4J8X C;  5BO0 B;  3AV1 B;  5DNM C;  3UT9 D;  1M1A D;  2IO5 B;  3REJ B;  4LD9 C;  2F8N A;  1P3G A;  5GXQ C;  3AZK C;  3B0C W;  1P3A A;  5AVC C;  2NQB D;  1ZLA B;  3B6F A;  5AVB D;  4Z66 C;  1KX3 D;  3B6G C;  1B67 A;  5CPI C;  3X1U D;  3WAA B;  4NFT A;  3UTB D;  3TU4 B;  1EQZ C;  4H9N A;  4YS3 C;  4ZUX B;  5B24 C;  3WTP E;  5F99 C;  1F66 A;  4KGC D;  5B40 B;  5B31 B;  4R8P C;  4AWL B;  3KUY C;  2JE5 A;  3WA9 C;  5B40 A;  2CWE A;  3H0L C;  1F1E A;  3R45 B;  4NE3 A;  1H3O B;  4JJN C;  3KXB B;  3X1V D;  1ID3 C;  1JFI B;  5AV5 A;  3VH5 W;  4EO5 B;  1M19 B;  5B2I C;  1P3F D;  3R45 A;  4XZQ C;  3AN2 D;  4X23 A;  4Z5T A;  3KWQ B;  3LZ1 A;  3W98 A;  3LZ0 D;  3AZJ B;  2F8N G;  1P3K A;  2HIO C;  5DNM B;  1P34 D;  3AFA B;  3KWQ A;  5CPK B;  5DNN C;  4WZS B;  4J8W D;  4NE6 A;  5B1M C;  5AVC B;  1ZLA D;  3A1I A;  1S32 C;  3AZM C;  5CP6 D;  5KDM A;  3MGR C;  2CV5 A;  2Y2P A;  5B0Y D;  1P3P B;  3X1T C;  5CPI B;  3REL B;  3AV2 D;  1KX5 D;  4YS3 B;  1EQZ B;  3AZE C;  1P3O C;  3AZN A;  3AZG B;  3REK C;  1KX4 D;  2Y2H A;  2ZY4 A;  3REL A;  3AL0 C;  5AV8 C;  3MGQ C;  5B33 C;  3AZL A;  5CPJ A;  3LEL B;  5B0Z B;  2Y2Q A;  5B31 G;  4KUD D;  3MVD B;  2NZD B;  3LEL A;  5BNV A;  1P3I D;  5B0Z A;  2NQB C;  5E5A B;  3KXB D;  3MVD A;  2NZD A;  4XUJ D;  1TZY A;  2PYO A;  3W96 A;  3EPL A;  4YM6 C;  3C1C B;  4WU8 D;  5E5A A;  4DQY B;  4J8X D;  3LJA A;  4J8V B;  4KGC C;  4ZBJ B;  4LD9 D;  1P3M A;  5DNN B;  3X1S C;  1AOI A;  5GXQ D;  5B1M B;  3AZK D;  4J8V A;  4Z66 D;  3B6G D;  3A6N B;  1HQ3 A;  3IP4 C;  3V9R B;  4J8U B;  3AZI A;  3EPH A;  5JRG D;  3AZE B;  5B24 D;  1P3O B;  5F99 D;  3W97 D;  1BH8 A;  1A7W A;  3REK B;  3WKJ C;  3AN2 C;  4WU9 A;  1P3B C;  5AV8 B;  3MGQ B;  4QLC D;  4R8P D;  3UT9 B;  3KUY D;  1P34 C;  1M1A B;  3WA9 D;  3MGS A;  2RIQ A;  2XD1 A;  3UT9 A;  1M1A A;  2NQB B;  3C1B D;  5AY8 A;  2BYM A;  5AVB B;  4JJN D;  2BYK A;  3AZF A;  1KX3 B;  1ID3 D;  5B2I D;  3X1U B;  4XZQ D;  4WV4 B;  3UTB B;  3AV2 C;  1KX5 C;  5AVB A;  5GSU D;  3UTA C;  2HIO D;  4KGC B;  3MGP D;  1P3A C;  3W99 D;  3AYW A;  4KUD C;  1S32 D;  3AZM D;  2ARO C;  3MGR D;  1P3I C;  2W8S A;  3MNN A;  3X1T D;  5FUG B;  1N1J A;  5B32 D;  3B0B A;  4CSR B;  3X1V B;  1P3L C;  2YFV B;  1P3O D;  1P3F B;  4H9S A;  3AN2 B;  3WTP D;  5FUG A;  4WU8 C;  1Q9C A;  5B33 D;  2DQN C;  3LZ0 B;  3AZH C;  1P34 B;  5GT0 A;  3VH5 A;  4J8W B;  5BO0 A;  2HUE C;  4KHA B;  3AV1 A;  3REJ A;  5CP6 B;  2JSS A;  5AV5 C;  2UWX A;  5B0Y B;  5JRG C;  4YM6 D;  1ZLA A;  4H9P B;  3AV2 B;  1KX5 B;  3W97 C;  3REH D;  1P3K C;  1KX4 B;  3UTA B;  3WAA A;  4G91 B;  3TU4 A;  4ZUX A;  2XD5 A;  4QLC C;  3X1S D;  4KUD B;  5AV6 C;  2J8P A;  2RVQ C;  1P3I B;  1T3U A;  5B31 A;  3C1B C;  5JA4 B;  4XUJ B;  4DRB A;  3AZN C;  1H3O A;  3WKJ D;  3F6T A;  2F8N K;  4WU8 B;  3AZL C;  1P3B D;  3KXB A;  3B0D B;  5JA4 A;  5GSU C;  1JFI A;  4J8X B;  1M19 A;  3REI D;  4UPK A;  4NE5 A;  4LD9 B;  1M18 C;  2Y2L A;  3MGP C;  4HGA C;  4J8X A;  4H9O B;  5GXQ B;  3AZJ A;  3AZK B;  3W99 C;  5DNM A;  3AFA A;  1U35 C;  5CHL B;  4Z66 B;  5CPK A;  3B6G B;  4H9O A;  1TZY C;  4E45 A;  5BT1 C;  2PYO C;  5JRG B;  5AVC A;  5B32 C;  4Z66 A;  5B24 B;  5F99 B;  3W97 B;  3UTA D;  1P3P A;  5CPI A;  3WTP C;  5BS7 C;  1EQZ A;  4YS3 A;  1P3G D;  5B24 A;  4QLC B;  5F99 A;  4R8P B;  4G92 C;  3KUY B;  3AZG A;  1P3A D;  5B1L C;  3WA9 B;  3B6F D;  3B0C T;  2ARO D;  1HQ3 C;  4R8P A;  3AZI C;  3KUY A;  3C1B B;  4JJN B;  1ID3 B;  1P3L D;  2ZY3 A;  3H0M C;  5B2I B;  4XZQ B;  3EPK A;  2DF4 C;  5B2J C;  4JJN A;  5GSU B;  3REH C;  2HIO B;  3AZH D;  3C1C A;  3MGS C;  3NQU B;  3MGP B;  4HGA B;  3W99 B;  1S32 B;  3AZM B;  4H9R B;  5DNN A;  3VH6 W;  5AV5 D;  3NQU A;  3MGR B;  5B1M A;  4Z2M H;  2Y2J A;  3X1T B;  4X23 D;  3VH5 T;  4Z5T D;  5B32 B;  3AZM A;  4H9R A;  3LZ1 D;  3A6N A;  3W98 D;  3MGR A;  3V9R A;  4J8U A;  1P3K D;  3WTP B;  5B33 B;  3KFU G;  3AZE A;  1P3O A;  3REI C;  3REK A;  2Y2O A;  3AYW C;  5AV8 A;  1B6W A;  5AV6 D;  3MGQ A;  1W2E A;  2Y2K A;  2RVQ D;  2CV5 D;  5G49 B;  2FJ7 C;  3MNN C;  1BFM A;  4UUZ B;  2BG1 A;  3O62 C;  5AV9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...