2FJ7A

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7A00
5B32B 1P3FC 5AV8B 3AFAD 4J8UA 4LD9C 3W99D 5B1MA 5AV8C 5B1LB 4H9OB 1S32C 3X1VC 3LZ1C 5KDMB 4Z5TD 5B31D 5B1LC 1M1AA 4X23A 1P34A 2PYOA 4J8WB 1M18C 3X1SA 5GSUC 3AZGD 1BH9A 1F66A 3VH5A 5B0YB 1KX3C 4YS3D 3KXBA 5CPIC 1P3MC 2HIOA 5GT3B 2FJ7D 3B6GA 3KWQA 5B33C 3MGSA 1P3KD 5F99B 5DNNB 4HGAB 5AVCD 4WV4B 3REIC 1M19A 1TAFA 1HQ3B 5AY8C 4HGAC 3AZHA 2NZDD 5AVBA 5CP6D 1P3LB 3WTPB 3MNND 1JFIB 5B40A 4XUJD 3WA9A 3R45B 3A6ND 1P3LC 3O62A 3REHD 3AV1C 4J8VA 3AV2B 5GXQC 4ZBJB 3AZID 1ID3A 1U35A 5DNMC 3VH5W 4NFTA 4Z66D 3UT9D 3AYWA 3V9RA 5E5AB 3AZEA 1P3BA 1KX4A 4KGCB 3REKA 1S32D 3LZ1D 3NQUB 5BNXA 5E5AC 5BS7A 1M18D 3X1TD 3X1UB 3MVDD 5GSUD 5B32A 1P3ID 4H9RB 2F8ND 3MGRB 5AV8A 3WAAB 4H9PB 4WU9C 5B2IC 1KX3D 5CPID 3MGRC 5B1LA 5B33D 1ZLAB 4H9OA 5G49B 4J8UB 5JRGC 5KDMA 3C1BB 4J8UC 4J8WA 3W98B 5B1MC 5AY8D 4NE3A 5AV6D 1P3GD 4R8PD 5B0YA 3MGPB 2CV5B 3LJAB 5GT3A 4X23C 1P3AB 5BT1D 2CV5C 2PYOC 3RELD 1WWSA 3X1SC 5F99A 5DNNA 1F66C 3C1CD 4J8XD 3KXBC 1HQ3A 5B0ZB 2HIOC 3UTAD 3AN2B 3MGQD 3B6GC 3KWQC 1P3LA 5CPJB 3WTPA 1JFIA 3B0DB 4G91B 4YM6B 3AN2C 3R45A 4ZUXA 3AFAB 3AV2A 4G91C 3B0CW 4YM6C 1M19C 1A7WA 3AZHC 4DRBA 5AVBC 5E5AA 4KGCA 3WA9C 5B40C 5JRGD 3AZND 3NQUA 4Z5TB 3O62C 4J8VC 1EQZB 3LELB 1ID3C 3X1UA 2HUEB 3UTBD 1EQZC 3WAAA 1KX4C 4H9PA 3LELC 3REKC 4YS3B 5B24B 1M1AD 2FJ7B 4X23D 2AROD 5JA4B 5G49A 1P34D 1ZLAA 5BS7C 2PYOD 4XZQD 5AV9B 2RVQC 5B32C 4EO5B 3AZMA 4JJNB 1P3OD 1F66D 3W97D 3C1BA 5AVCB 5CPKB 3KXBD 3W98A 4EO5C 2HIOD 3KWQD 1KX5A 2F8NK 4KUDD 5AV5D 3MGSD 3MNNB 3AZKB 4XUJB 3MGPA 2CV5A 3REJA 1P3PB 3LJAA 1AOIB 3REHB 1P3AA 3KUYB 1M19D 4J8WC 1P3PC 1AOIC 3LZ0D 4Z66B 3KUYC 3WKJB 3WA9D 5B40D 1KU5A 5B0YC 2JSSA 5B0ZA 3AN2A 5GT3C 3O62D 4J8VD 3WKJC 5B2JB 5CPJA 4QLCB 1ID3D 1U35D 4YM6A 1P3IB 1TZYD 3AYWD 5F99C 5DNNC 3AZED 1P3BD 3AFAA 3REKD 1HQ3C 1P3FD 4ZUXB 3WTPC 4E45A 4LD9D 4M6BA 1ULYA 2RVQD 4DRAA 5B32D 4ZUXC 4Z5TA 5AV8D 2NQBB 4Z2MH 3AV2C 1EQZA 3LELA 4ZBJC 3X1VD 2NQBC 5AV6B 1P3GB 1B6WA 4H9SA 5B1LD 1HTAA 4KGCC 4R8PB 4YS3A 4CSRB 5B24A 2FJ7A 3W96B 5JA4A 5AV9A 3X1UC 2LY8A 3W96C 4G92B 4JJNA 3AZLB 1P3MD 1WWIA 3WAAC 4WNNB 5AVCA 3C1CB 5CPKA 5B0YD 2BYKB 4WU8B 5GT3D 3UTAB 3MGQB 2NZDA 3AZMB 3AZFB 1ZLAC 3MNNA 3AZKA 3B6FB 4XUJA 3REID 5C3IB 3A6NA 3AZMC 5B31G 1P3PA 1AOIA 3REHA 3C1BC 4Z2MG 4H9NB 1KX5B 3KUYA 3W98C 1HQ3D 4NE5A 3AZJB 4KHAB 4Z66A 3REJB 1KX5C 1P3LD 3AV1D 3VH6W 3WKJA 5GT0B 5GXQD 3AZJC 3MGPC 3REJC 3LJAC 5DNMD 5GT0C 5B2JA 1P3AC 4QLCA 3TU4B 3MVDA 1P3IA 2BYMB 5E5AD 2F8NH 3VH5T 3TU4C 3NQJB 3WTPE 5B0ZC 2AROB 5CPJC 5BO0B 3B0DC 4WU9D 5B2ID 3X1UD 3W99B 1P3OB 3MGRD 3W97B 3WAAD 3AFAC 2NQBA 2L5AA 5AV6A 1P3GA 5B31B 1ZLAD 4KUDB 5AV5B 4R8PA 4J8UD 4CSRA 4Z5TC 5B1MD 3AZGB 3W96A 3C1BD 4CAYA 3AZGC 2HUEC 1H3OB 3LZ0B 3AZLA 4H9SC 2F8NG 4WNNA 3C1CA 4YS3C 2CV5D 2BYKA 5BNVB 5B24C 3X1SD 4WU8A 3UTAA 1P3KB 3MGQA 2FJ7C 3AZFA 3B6FA 5AV9C 1TZYB 1N1JB 4JJNC 3B6GD 4H9NA 2NZDB 5AVCC 5CPKC 5CP6B 5B0ZD 3AZJA 4KHAA 3AN2D 1R4VA 1P3FB 2NZDC 3A6NB 5CP6C 5GT0A 3MNNC 3AZKC 4LD9B 4XUJC 4YM6D 3AZNA 3A6NC 3AZIB 5FUGB 3REHC 3AZHD 5AVBD 3UT9B 3AZIC 3TU4A 3X1VB 1S32B 3LZ1B 3B0CT 3UTBA 2YFWB 4Z66C 3UT9C 2BYMA 3NQJA 1M18B 3B0BA 3X1TB 3MVDB 4UUZB 5GSUB 5B2JC 1EQZD 2AROA 2F8NB 4QLCC 1KX4D 3LELD 5BO0A 4XZQA 3X1TC 3MVDC 1P3IC 2YFVB 1KX3B 3W99A 5CPIB 1P3OA 1P3MB 3W97A 5B33B 5B24D 5B31A 4KUDA 5AV5A 1Q9CA 5AV9D 3REIB 4JJND 5AY8B 3AZGA 5CPKD 5AV6C 1H3OA 4E44A 3LZ0A 1P3GC 3VH6A 4H9QB 4R8PC 3AV1B 3AZKD 5GXQB 1BH8B 5BNVA 4J8WD 2IO5B 4CAYB 4WZSB 3RELB 1P3KA 1P3PD 1AOID 5DNMB 3KUYD 5BT1C 2IO5C 3RELC 4J8XB 4AWLB 5CHLB 4G92C 1TZYA 1N1JA 3AZLC 3WKJD 3C1CC 5CP6A 4J8XC 4AWLC 3UTAC 4WU8C 1P3FA 3MGQC 5B2JD 3AZFC 5F99D 5DNND 4QLCD 3B6FC 4LD9A 4WU9B 5B2IB 5C3IC 3AZIA 5FUGA 3UT9A 3WTPD 1S32A 3X1VA 3LZ1A 5JRGB 3AZNB 4ZUXD 2YFWA 3AV2D 3AZNC 1M18A 3X1TA 4UUZA 5B1MB 5GSUA 2NQBD 3UTBB 2F8NA 4KGCD 2YFVA 1KX3A 5CPIA 3UTBC 1P3MA 1F1EA 1M1AB 4X23B 5B33A 1P34B 2PYOB 4XZQB 3X1SB 3W96D 1M1AC 2CWEA 1BH9B 2AROC 1F66B 1P34C 4XZQC 3REIA 3W99C 5B32G 3KXBB 3AZLD 1P3OC 2HIOB 5AY8A 3W97C 3B6GB 3KWQB 3MGSB 4WU8D 5B31C 3AZMD 3AZFD 4H9QA 4KUDC 5AV5C 3AV1A 3MGSC 3B6FD 5GXQA 1BH8A 1M19B 3W98D 3RELA 1TAFB 5DNMA 3AZHB 1KX5D 5AVBB 4NE6A 3WA9B 5B40B 3AZJD 3MGPD 4J8XA 3LZ0C 3REJD 3LJAD 3O62B 5GT0D 4J8VB 1P3AD 3VH6T 1ID3B 1U35B 1P3KC 3AYWB 3V9RB 3AZEB 1P3BB 1KX4B 3REKB 3TU4D 4WU9A 5B2IA 1U35C 1BFMA 3KSYA 4H9RA 1TZYC 3AYWC 5BNXB 3MGRA 3AZEC 1P3BC 5CPJD 1B67A 5JRGA
chains in the Genus database with same CATH superfamily
5B32B 1P3FC 5AV8B 3AFAD 4J8UA 4LD9C 3W99D 5B1MA 5AV8C 5B1LB 4H9OB 1S32C 3X1VC 3LZ1C 5KDMB 3H0LC 4Z5TD 5B31D 5B1LC 3IP4C 2JCHA 1M1AA 2Y2IA 4X23A 1PZRA 1P34A 2PYOA 4J8WB 1M18C 3X1SA 5GSUC 3AZGD 1BH9A 1F66A 3VH5A 5B0YB 1KX3C 4YS3D 3KXBA 5CPIC 1P3MC 2HIOA 5GT3B 2FJ7D 3B6GA 3KWQA 5B33C 3MGSA 1P3KD 5F99B 5DNNB 4HGAB 5AVCD 4WV4B 3REIC 1M19A 2Y2PA 1TAFA 1HQ3B 2RIQA 5AY8C 4HGAC 3AZHA 2NZDD 5AVBA 5CP6D 1P3LB 3WTPB 3MNND 1JFIB 5B40A 4XUJD 3WA9A 1W2EA 3R45B 3A6ND 1P3LC 2Y2JA 3O62A 3REHD 4J8VA 3AV1C 3AV2B 5GXQC 4ZBJB 3AZID 1ID3A 1U35A 5DNMC 3VH5W 4NFTA 4Z66D 3UT9D 3AYWA 3V9RA 5E5AB 3AZEA 1P3BA 1KX4A 4KGCB 3REKA 1S32D 3LZ1D 3NQUB 5BNXA 5E5AC 5BS7A 1M18D 3X1TD 3X1UB 3MVDD 5GSUD 5B32A 1P3ID 4H9RB 3F6TA 2F8ND 3MGRB 5AV8A 2ZY2A 3WAAB 4H9PB 4WU9C 5B2IC 1KX3D 5CPID 3H0RC 2Y2NA 3MGRC 3AL0C 5B1LA 5B33D 1ZLAB 4H9OA 5G49B 4J8UB 5JRGC 5KDMA 3C1BB 4J8UC 2JE5A 4J8WA 3W98B 5B1MC 5AY8D 4NE3A 5AV6D 1P3GD 1T3UA 2ZY4A 4R8PD 5B0YA 3MGPB 2CV5B 3LJAB 5GT3A 4X23C 1P3AB 5BT1D 2CV5C 2PYOC 3RELD 1WWSA 3X1SC 5F99A 5DNNA 1F66C 3C1CD 4J8XD 3KXBC 1HQ3A 5B0ZB 2HIOC 2BG1A 3UTAD 3AN2B 3MGQD 3B6GC 3KWQC 4DQYB 1P3LA 5CPJB 3WTPA 1JFIA 3B0DB 4G91B 4YM6B 3AN2C 3R45A 4ZUXA 3AFAB 3AV2A 4G91C 3B0CW 4YM6C 3KFUG 1M19C 1A7WA 3AZHC 4DRBA 5AVBC 5E5AA 4KGCA 3WA9C 5B40C 5JRGD 3AZND 3NQUA 4Z5TB 3O62C 4J8VC 1EQZB 3LELB 1ID3C 3X1UA 2HUEB 1Z2CB 3UTBD 1EQZC 3WAAA 1KX4C 4H9PA 3LELC 3REKC 4YS3B 5B24B 1M1AD 2FJ7B 4X23D 2AROD 5JA4B 5G49A 1P34D 1ZLAA 5BS7C 2PYOD 4XZQD 5AV9B 2RVQC 5B32C 4EO5B 3AZMA 4JJNB 1P3OD 1F66D 3W97D 3C1BA 5AVCB 5CPKB 3KXBD 3W98A 4EO5C 2HIOD 3KWQD 1KX5A 2F8NK 2ZY3A 4KUDD 5AV5D 3MGSD 3MNNB 2FFFB 3AZKB 4XUJB 3MGPA 2CV5A 3REJA 1P3PB 3LJAA 1AOIB 3REHB 1P3AA 3KUYB 1M19D 4J8WC 1P3PC 1AOIC 3EPKA 3LZ0D 4Z66B 3KUYC 3WKJB 3WA9D 5B40D 1KU5A 5B0YC 2F2AC 2JSSA 5B0ZA 3AN2A 5GT3C 3O62D 4J8VD 3WKJC 5B2JB 5CPJA 4QLCB 1ID3D 1U35D 4YM6A 1P3IB 1TZYD 3AYWD 5F99C 5DNNC 3AZED 1P3BD 3AFAA 3REKD 1HQ3C 3EPLA 1P3FD 4ZUXB 3WTPC 4E45A 4LD9D 4M6BA 1ULYA 2RVQD 4DRAA 5B32D 4ZUXC 4Z5TA 5AV8D 2NQBB 4Z2MH 3AV2C 1EQZA 3LELA 4ZBJC 3X1VD 2J8PA 3A1IA 5AV6B 1B6WA 1P3GB 2NQBC 4H9SA 5B1LD 1HTAA 4KGCC 4R8PB 2Y2QA 4YS3A 4CSRB 5B24A 2FJ7A 3W96B 5JA4A 5AV9A 3X1UC 2LY8A 3W96C 4G92B 4JJNA 3AZLB 1P3MD 1WWIA 3WAAC 4WNNB 5AVCA 3C1CB 5CPKA 5B0YD 2BYKB 4WU8B 5GT3D 3UTAB 3MGQB 2NZDA 3AZMB 3AZFB 1ZLAC 3MNNA 3AZKA 3B6FB 4XUJA 3REID 5C3IB 3A6NA 3AZMC 5B31G 1P3PA 1AOIA 3REHA 3C1BC 4Z2MG 4H9NB 1KX5B 3KUYA 3W98C 1HQ3D 4NE5A 3AZJB 4KHAB 4Z66A 3REJB 1KX5C 1P3LD 3AV1D 3VH6W 3WKJA 5GT0B 5GXQD 3AZJC 3MGPC 2XD1A 3REJC 3LJAC 5DNMD 5GT0C 5B2JA 1P3AC 4QLCA 3TU4B 3MVDA 1P3IA 2BYMB 5E5AD 2F8NH 3VH5T 3TU4C 3NQJB 3WTPE 5B0ZC 2AROB 5CPJC 5BO0B 3B0DC 4WU9D 5B2ID 3X1UD 3W99B 1P3OB 3MGRD 3W97B 3WAAD 3AFAC 2NQBA 2DQNC 3A1KA 2L5AA 5AV6A 1P3GA 5B31B 1ZLAD 4KUDB 5AV5B 4R8PA 4J8UD 4CSRA 4Z5TC 5B1MD 3AZGB 3W96A 3C1BD 4CAYA 3AZGC 2HUEC 1H3OB 3LZ0B 3AZLA 4H9SC 2F8NG 4WNNA 3C1CA 4YS3C 2CV5D 2BYKA 5BNVB 5B24C 3X1SD 4WU8A 3UTAA 1P3KB 3MGQA 2FJ7C 3AZFA 2Y2LA 3B6FA 5AV9C 1TZYB 1N1JB 4JJNC 3B6GD 4H9NA 2NZDB 5AVCC 5CPKC 5CP6B 5B0ZD 3AZJA 4KHAA 3AN2D 1R4VA 1P3FB 2NZDC 3A6NB 4WJ3C 5CP6C 5GT0A 3MNNC 3AZKC 4LD9B 4XUJC 4YM6D 3H0MC 3AZNA 3A6NC 3AZIB 5FUGB 3REHC 3AZHD 5AVBD 3UT9B 2Y2HA 3TU4A 3AZIC 3X1VB 1S32B 3LZ1B 3B0CT 3UTBA 2YFWB 4Z66C 3UT9C 2BYMA 3FDDA 2G5HC 3NQJA 1M18B 3B0BA 3X1TB 3MVDB 4UUZB 5GSUB 5B2JC 1EQZD 2AROA 2F8NB 4QLCC 1KX4D 3LELD 5BO0A 4XZQA 3X1TC 2Y2MA 3MVDC 2YFVB 1P3IC 3EG5B 1KX3B 5CPIB 3W99A 1P3OA 1P3MB 3W97A 2UWXA 5B33B 2ZM5A 5B24D 5B31A 4KUDA 5AV5A 4UPKA 1Q9CA 2ZY5A 5AV9D 3REIB 3P5JB 4JJND 5AY8B 3AZGA 5CPKD 2Y2OA 5AV6C 1H3OA 4E44A 3LZ0A 1P3GC 3VH6A 4H9QB 4R8PC 3AV1B 3AZKD 2XD5A 5GXQB 2W8SA 1BH8B 5BNVA 4J8WD 2IO5B 4CAYB 4WZSB 3RELB 1P3KA 1P3PD 1AOID 5DNMB 3KUYD 5BT1C 3EPJA 2IO5C 2G5IC 3RELC 4J8XB 4AWLB 5CHLB 4G92C 1TZYA 1N1JA 3AZLC 3WKJD 3C1CC 5CP6A 4J8XC 4AWLC 3UTAC 4WU8C 1P3FA 3MGQC 5B2JD 3AZFC 5F99D 5DNND 4QLCD 3B6FC 4LD9A 4WU9B 5B2IB 5C3IC 3AZIA 5FUGA 3UT9A 3WTPD 1S32A 3X1VA 3LZ1A 5JRGB 3AZNB 2DF4C 4ZUXD 2YFWA 2VQRA 3AV2D 3AZNC 1M18A 3X1TA 4UUZA 5B1MB 5GSUA 2NQBD 3UTBB 2F8NA 4KGCD 2YFVA 1KX3A 5CPIA 3UTBC 1P3MA 1F1EA 1M1AB 4X23B 2Y2GA 5B33A 1P34B 2PYOB 4XZQB 3X1SB 3W96D 1M1AC 2CWEA 1BH9B 2AROC 1F66B 1P34C 4XZQC 2Y2KA 3REIA 3W99C 5B32G 3KXBB 3AZLD 1P3OC 2HIOB 5AY8A 3W97C 3B6GB 3KWQB 3MGSB 4WU8D 5B31C 3AZMD 3AZFD 4H9QA 4KUDC 5AV5C 3AV1A 3MGSC 3B6FD 5GXQA 1BH8A 1M19B 3W98D 3RELA 1TAFB 5DNMA 3AZHB 1KX5D 5AVBB 4NE6A 3WA9B 5B40B 3AZJD 3MGPD 4J8XA 3EPHA 3LZ0C 3REJD 3LJAD 3O62B 5GT0D 4J8VB 1P3AD 3VH6T 1ID3B 1U35B 1P3KC 3AYWB 3V9RB 3AZEB 1P3BB 1KX4B 3REKB 3TU4D 4WU9A 5B2IA 1U35C 1BFMA 3KSYA 4H9RA 1TZYC 3AYWC 5BNXB 3MGRA 3AZEC 1P3BC 5CPJD 1B67A 5JRGA
chains in the Genus database with same CATH topology
5B32B 1P3FC 5AV8B 3AFAD 4J8UA 4LD9C 3W99D 5B1MA 5AV8C 5B1LB 4H9OB 1S32C 3X1VC 3LZ1C 5KDMB 3H0LC 4Z5TD 5B31D 5B1LC 3IP4C 2JCHA 1M1AA 2Y2IA 4X23A 1PZRA 1P34A 2PYOA 4J8WB 1M18C 3X1SA 5GSUC 3AZGD 1BH9A 1F66A 3VH5A 5B0YB 1KX3C 4YS3D 3KXBA 5CPIC 1P3MC 2HIOA 5GT3B 2FJ7D 3B6GA 3KWQA 5B33C 3MGSA 1P3KD 5F99B 5DNNB 4HGAB 5AVCD 4WV4B 3REIC 1M19A 2Y2PA 1TAFA 1HQ3B 2RIQA 5AY8C 4HGAC 3AZHA 2NZDD 5AVBA 5CP6D 1P3LB 3WTPB 3MNND 1JFIB 5B40A 4XUJD 3WA9A 1W2EA 3R45B 3A6ND 1P3LC 2Y2JA 3O62A 3REHD 4J8VA 3AV1C 3AV2B 5GXQC 4ZBJB 3AZID 1ID3A 1U35A 5DNMC 3VH5W 4NFTA 4Z66D 3UT9D 3AYWA 3V9RA 5E5AB 3AZEA 1P3BA 1KX4A 4KGCB 3REKA 1S32D 3LZ1D 3NQUB 5BNXA 5E5AC 5BS7A 1M18D 3X1TD 3X1UB 3MVDD 5GSUD 5B32A 1P3ID 4H9RB 3F6TA 2F8ND 3MGRB 5AV8A 2ZY2A 3WAAB 4H9PB 4WU9C 5B2IC 1KX3D 5CPID 3H0RC 2Y2NA 3MGRC 3AL0C 5B1LA 5B33D 1ZLAB 4H9OA 5G49B 4J8UB 5JRGC 5KDMA 3C1BB 4J8UC 2JE5A 4J8WA 3W98B 5B1MC 5AY8D 4NE3A 5AV6D 1P3GD 1T3UA 2ZY4A 4R8PD 5B0YA 3MGPB 2CV5B 3LJAB 5GT3A 4X23C 1P3AB 5BT1D 2CV5C 2PYOC 3RELD 1WWSA 3X1SC 5F99A 5DNNA 1F66C 3C1CD 4J8XD 3KXBC 1HQ3A 5B0ZB 2HIOC 2BG1A 3UTAD 3AN2B 3MGQD 3B6GC 3KWQC 4DQYB 1P3LA 5CPJB 3WTPA 1JFIA 3B0DB 4G91B 4YM6B 3AN2C 3R45A 4ZUXA 3AFAB 3AV2A 4G91C 3B0CW 4YM6C 3KFUG 1M19C 1A7WA 3AZHC 4DRBA 5AVBC 5E5AA 4KGCA 3WA9C 5B40C 5JRGD 3AZND 3NQUA 4Z5TB 3O62C 4J8VC 1EQZB 3LELB 1ID3C 3X1UA 2HUEB 1Z2CB 3UTBD 1EQZC 3WAAA 1KX4C 4H9PA 3LELC 3REKC 4YS3B 5B24B 1M1AD 2FJ7B 4X23D 2AROD 5JA4B 5G49A 1P34D 1ZLAA 5BS7C 2PYOD 4XZQD 5AV9B 2RVQC 5B32C 4EO5B 3AZMA 4JJNB 1P3OD 1F66D 3W97D 3C1BA 5AVCB 5CPKB 3KXBD 3W98A 4EO5C 2HIOD 3KWQD 1KX5A 2F8NK 2ZY3A 4KUDD 5AV5D 3MGSD 3MNNB 2FFFB 3AZKB 4XUJB 3MGPA 2CV5A 3REJA 1P3PB 3LJAA 1AOIB 3REHB 1P3AA 3KUYB 1M19D 4J8WC 1P3PC 1AOIC 3EPKA 3LZ0D 4Z66B 3KUYC 3WKJB 3WA9D 5B40D 1KU5A 5B0YC 2F2AC 2JSSA 5B0ZA 3AN2A 5GT3C 3O62D 4J8VD 3WKJC 5B2JB 5CPJA 4QLCB 1ID3D 1U35D 4YM6A 1P3IB 1TZYD 3AYWD 5F99C 5DNNC 3AZED 1P3BD 3AFAA 3REKD 1HQ3C 3EPLA 1P3FD 4ZUXB 3WTPC 4E45A 4LD9D 4M6BA 1ULYA 2RVQD 4DRAA 5B32D 4ZUXC 4Z5TA 5AV8D 2NQBB 4Z2MH 3AV2C 1EQZA 3LELA 4ZBJC 3X1VD 2J8PA 3A1IA 5AV6B 1B6WA 1P3GB 2NQBC 4H9SA 5B1LD 1HTAA 4KGCC 4R8PB 2Y2QA 4YS3A 4CSRB 5B24A 2FJ7A 3W96B 5JA4A 5AV9A 3X1UC 2LY8A 3W96C 4G92B 4JJNA 3AZLB 1P3MD 1WWIA 3WAAC 4WNNB 5AVCA 3C1CB 5CPKA 5B0YD 2BYKB 4WU8B 5GT3D 3UTAB 3MGQB 2NZDA 3AZMB 3AZFB 1ZLAC 3MNNA 3AZKA 3B6FB 4XUJA 3REID 5C3IB 3A6NA 3AZMC 5B31G 1P3PA 1AOIA 3REHA 3C1BC 4Z2MG 4H9NB 1KX5B 3KUYA 3W98C 1HQ3D 4NE5A 3AZJB 4KHAB 4Z66A 3REJB 1KX5C 1P3LD 3AV1D 3VH6W 3WKJA 5GT0B 5GXQD 3AZJC 3MGPC 2XD1A 3REJC 3LJAC 5DNMD 5GT0C 5B2JA 1P3AC 4QLCA 3TU4B 3MVDA 1P3IA 2BYMB 5E5AD 2F8NH 3VH5T 3TU4C 3NQJB 3WTPE 5B0ZC 2AROB 5CPJC 5BO0B 3B0DC 4WU9D 5B2ID 3X1UD 3W99B 1P3OB 3MGRD 3W97B 3WAAD 3AFAC 2NQBA 2DQNC 3A1KA 2L5AA 5AV6A 1P3GA 5B31B 1ZLAD 4KUDB 5AV5B 4R8PA 4J8UD 4CSRA 4Z5TC 5B1MD 3AZGB 3W96A 3C1BD 4CAYA 3AZGC 2HUEC 1H3OB 3LZ0B 3AZLA 4H9SC 2F8NG 4WNNA 3C1CA 4YS3C 2CV5D 2BYKA 5BNVB 5B24C 3X1SD 4WU8A 3UTAA 1P3KB 3MGQA 2FJ7C 3AZFA 2Y2LA 3B6FA 5AV9C 1TZYB 1N1JB 4JJNC 3B6GD 4H9NA 2NZDB 5AVCC 5CPKC 5CP6B 5B0ZD 3AZJA 4KHAA 3AN2D 1R4VA 1P3FB 2NZDC 3A6NB 4WJ3C 5CP6C 5GT0A 3MNNC 3AZKC 4LD9B 4XUJC 4YM6D 3H0MC 3AZNA 3A6NC 3AZIB 5FUGB 3REHC 3AZHD 5AVBD 3UT9B 2Y2HA 3TU4A 3AZIC 3X1VB 1S32B 3LZ1B 3B0CT 3UTBA 2YFWB 4Z66C 3UT9C 2BYMA 3FDDA 2G5HC 3NQJA 1M18B 3B0BA 3X1TB 3MVDB 4UUZB 5GSUB 5B2JC 1EQZD 2AROA 2F8NB 4QLCC 1KX4D 3LELD 5BO0A 4XZQA 3X1TC 2Y2MA 3MVDC 2YFVB 1P3IC 3EG5B 1KX3B 5CPIB 3W99A 1P3OA 1P3MB 3W97A 2UWXA 5B33B 2ZM5A 5B24D 5B31A 4KUDA 5AV5A 4UPKA 1Q9CA 2ZY5A 5AV9D 3REIB 3P5JB 4JJND 5AY8B 3AZGA 5CPKD 2Y2OA 5AV6C 1H3OA 4E44A 3LZ0A 1P3GC 3VH6A 4H9QB 4R8PC 3AV1B 3AZKD 2XD5A 5GXQB 2W8SA 1BH8B 5BNVA 4J8WD 2IO5B 4CAYB 4WZSB 3RELB 1P3KA 1P3PD 1AOID 5DNMB 3KUYD 5BT1C 3EPJA 2IO5C 2G5IC 3RELC 4J8XB 4AWLB 5CHLB 4G92C 1TZYA 1N1JA 3AZLC 3WKJD 3C1CC 5CP6A 4J8XC 4AWLC 3UTAC 4WU8C 1P3FA 3MGQC 5B2JD 3AZFC 5F99D 5DNND 4QLCD 3B6FC 4LD9A 4WU9B 5B2IB 5C3IC 3AZIA 5FUGA 3UT9A 3WTPD 1S32A 3X1VA 3LZ1A 5JRGB 3AZNB 2DF4C 4ZUXD 2YFWA 2VQRA 3AV2D 3AZNC 1M18A 3X1TA 4UUZA 5B1MB 5GSUA 2NQBD 3UTBB 2F8NA 4KGCD 2YFVA 1KX3A 5CPIA 3UTBC 1P3MA 1F1EA 1M1AB 4X23B 2Y2GA 5B33A 1P34B 2PYOB 4XZQB 3X1SB 3W96D 1M1AC 2CWEA 1BH9B 2AROC 1F66B 1P34C 4XZQC 2Y2KA 3REIA 3W99C 5B32G 3KXBB 3AZLD 1P3OC 2HIOB 5AY8A 3W97C 3B6GB 3KWQB 3MGSB 4WU8D 5B31C 3AZMD 3AZFD 4H9QA 4KUDC 5AV5C 3AV1A 3MGSC 3B6FD 5GXQA 1BH8A 1M19B 3W98D 3RELA 1TAFB 5DNMA 3AZHB 1KX5D 5AVBB 4NE6A 3WA9B 5B40B 3AZJD 3MGPD 4J8XA 3EPHA 3LZ0C 3REJD 3LJAD 3O62B 5GT0D 4J8VB 1P3AD 3VH6T 1ID3B 1U35B 1P3KC 3AYWB 3V9RB 3AZEB 1P3BB 1KX4B 3REKB 3TU4D 4WU9A 5B2IA 1U35C 1BFMA 3KSYA 4H9RA 1TZYC 3AYWC 5BNXB 3MGRA 3AZEC 1P3BC 5CPJD 1B67A 5JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 B;  1P3F C;  5AV8 B;  3AFA D;  4J8U A;  4LD9 C;  3W99 D;  5B1M A;  5AV8 C;  5B1L B;  4H9O B;  1S32 C;  3X1V C;  3LZ1 C;  5KDM B;  4Z5T D;  5B31 D;  5B1L C;  1M1A A;  4X23 A;  1P34 A;  2PYO A;  4J8W B;  1M18 C;  3X1S A;  5GSU C;  3AZG D;  1BH9 A;  1F66 A;  3VH5 A;  5B0Y B;  1KX3 C;  4YS3 D;  3KXB A;  5CPI C;  1P3M C;  2HIO A;  5GT3 B;  2FJ7 D;  3B6G A;  3KWQ A;  5B33 C;  3MGS A;  1P3K D;  5F99 B;  5DNN B;  4HGA B;  5AVC D;  4WV4 B;  3REI C;  1M19 A;  1TAF A;  1HQ3 B;  5AY8 C;  4HGA C;  3AZH A;  2NZD D;  5AVB A;  5CP6 D;  1P3L B;  3WTP B;  3MNN D;  1JFI B;  5B40 A;  4XUJ D;  3WA9 A;  3R45 B;  3A6N D;  1P3L C;  3O62 A;  3REH D;  3AV1 C;  4J8V A;  3AV2 B;  5GXQ C;  4ZBJ B;  3AZI D;  1ID3 A;  1U35 A;  5DNM C;  3VH5 W;  4NFT A;  4Z66 D;  3UT9 D;  3AYW A;  3V9R A;  5E5A B;  3AZE A;  1P3B A;  1KX4 A;  4KGC B;  3REK A;  1S32 D;  3LZ1 D;  3NQU B;  5BNX A;  5E5A C;  5BS7 A;  1M18 D;  3X1T D;  3X1U B;  3MVD D;  5GSU D;  5B32 A;  1P3I D;  4H9R B;  2F8N D;  3MGR B;  5AV8 A;  3WAA B;  4H9P B;  4WU9 C;  5B2I C;  1KX3 D;  5CPI D;  3MGR C;  5B1L A;  5B33 D;  1ZLA B;  4H9O A;  5G49 B;  4J8U B;  5JRG C;  5KDM A;  3C1B B;  4J8U C;  4J8W A;  3W98 B;  5B1M C;  5AY8 D;  4NE3 A;  5AV6 D;  1P3G D;  4R8P D;  5B0Y A;  3MGP B;  2CV5 B;  3LJA B;  5GT3 A;  4X23 C;  1P3A B;  5BT1 D;  2CV5 C;  2PYO C;  3REL D;  1WWS A;  3X1S C;  5F99 A;  5DNN A;  1F66 C;  3C1C D;  4J8X D;  3KXB C;  1HQ3 A;  5B0Z B;  2HIO C;  3UTA D;  3AN2 B;  3MGQ D;  3B6G C;  3KWQ C;  1P3L A;  5CPJ B;  3WTP A;  1JFI A;  3B0D B;  4G91 B;  4YM6 B;  3AN2 C;  3R45 A;  4ZUX A;  3AFA B;  3AV2 A;  4G91 C;  3B0C W;  4YM6 C;  1M19 C;  1A7W A;  3AZH C;  4DRB A;  5AVB C;  5E5A A;  4KGC A;  3WA9 C;  5B40 C;  5JRG D;  3AZN D;  3NQU A;  4Z5T B;  3O62 C;  4J8V C;  1EQZ B;  3LEL B;  1ID3 C;  3X1U A;  2HUE B;  3UTB D;  1EQZ C;  3WAA A;  1KX4 C;  4H9P A;  3LEL C;  3REK C;  4YS3 B;  5B24 B;  1M1A D;  2FJ7 B;  4X23 D;  2ARO D;  5JA4 B;  5G49 A;  1P34 D;  1ZLA A;  5BS7 C;  2PYO D;  4XZQ D;  5AV9 B;  2RVQ C;  5B32 C;  4EO5 B;  3AZM A;  4JJN B;  1P3O D;  1F66 D;  3W97 D;  3C1B A;  5AVC B;  5CPK B;  3KXB D;  3W98 A;  4EO5 C;  2HIO D;  3KWQ D;  1KX5 A;  2F8N K;  4KUD D;  5AV5 D;  3MGS D;  3MNN B;  3AZK B;  4XUJ B;  3MGP A;  2CV5 A;  3REJ A;  1P3P B;  3LJA A;  1AOI B;  3REH B;  1P3A A;  3KUY B;  1M19 D;  4J8W C;  1P3P C;  1AOI C;  3LZ0 D;  4Z66 B;  3KUY C;  3WKJ B;  3WA9 D;  5B40 D;  1KU5 A;  5B0Y C;  2JSS A;  5B0Z A;  3AN2 A;  5GT3 C;  3O62 D;  4J8V D;  3WKJ C;  5B2J B;  5CPJ A;  4QLC B;  1ID3 D;  1U35 D;  4YM6 A;  1P3I B;  1TZY D;  3AYW D;  5F99 C;  5DNN C;  3AZE D;  1P3B D;  3AFA A;  3REK D;  1HQ3 C;  1P3F D;  4ZUX B;  3WTP C;  4E45 A;  4LD9 D;  4M6B A;  1ULY A;  2RVQ D;  4DRA A;  5B32 D;  4ZUX C;  4Z5T A;  5AV8 D;  2NQB B;  4Z2M H;  3AV2 C;  1EQZ A;  3LEL A;  4ZBJ C;  3X1V D;  2NQB C;  5AV6 B;  1P3G B;  1B6W A;  4H9S A;  5B1L D;  1HTA A;  4KGC C;  4R8P B;  4YS3 A;  4CSR B;  5B24 A;  2FJ7 A;  3W96 B;  5JA4 A;  5AV9 A;  3X1U C;  2LY8 A;  3W96 C;  4G92 B;  4JJN A;  3AZL B;  1P3M D;  1WWI A;  3WAA C;  4WNN B;  5AVC A;  3C1C B;  5CPK A;  5B0Y D;  2BYK B;  4WU8 B;  5GT3 D;  3UTA B;  3MGQ B;  2NZD A;  3AZM B;  3AZF B;  1ZLA C;  3MNN A;  3AZK A;  3B6F B;  4XUJ A;  3REI D;  5C3I B;  3A6N A;  3AZM C;  5B31 G;  1P3P A;  1AOI A;  3REH A;  3C1B C;  4Z2M G;  4H9N B;  1KX5 B;  3KUY A;  3W98 C;  1HQ3 D;  4NE5 A;  3AZJ B;  4KHA B;  4Z66 A;  3REJ B;  1KX5 C;  1P3L D;  3AV1 D;  3VH6 W;  3WKJ A;  5GT0 B;  5GXQ D;  3AZJ C;  3MGP C;  3REJ C;  3LJA C;  5DNM D;  5GT0 C;  5B2J A;  1P3A C;  4QLC A;  3TU4 B;  3MVD A;  1P3I A;  2BYM B;  5E5A D;  2F8N H;  3VH5 T;  3TU4 C;  3NQJ B;  3WTP E;  5B0Z C;  2ARO B;  5CPJ C;  5BO0 B;  3B0D C;  4WU9 D;  5B2I D;  3X1U D;  3W99 B;  1P3O B;  3MGR D;  3W97 B;  3WAA D;  3AFA C;  2NQB A;  2L5A A;  5AV6 A;  1P3G A;  5B31 B;  1ZLA D;  4KUD B;  5AV5 B;  4R8P A;  4J8U D;  4CSR A;  4Z5T C;  5B1M D;  3AZG B;  3W96 A;  3C1B D;  4CAY A;  3AZG C;  2HUE C;  1H3O B;  3LZ0 B;  3AZL A;  4H9S C;  2F8N G;  4WNN A;  3C1C A;  4YS3 C;  2CV5 D;  2BYK A;  5BNV B;  5B24 C;  3X1S D;  4WU8 A;  3UTA A;  1P3K B;  3MGQ A;  2FJ7 C;  3AZF A;  3B6F A;  5AV9 C;  1TZY B;  1N1J B;  4JJN C;  3B6G D;  4H9N A;  2NZD B;  5AVC C;  5CPK C;  5CP6 B;  5B0Z D;  3AZJ A;  4KHA A;  3AN2 D;  1R4V A;  1P3F B;  2NZD C;  3A6N B;  5CP6 C;  5GT0 A;  3MNN C;  3AZK C;  4LD9 B;  4XUJ C;  4YM6 D;  3AZN A;  3A6N C;  3AZI B;  5FUG B;  3REH C;  3AZH D;  5AVB D;  3UT9 B;  3AZI C;  3TU4 A;  3X1V B;  1S32 B;  3LZ1 B;  3B0C T;  3UTB A;  2YFW B;  4Z66 C;  3UT9 C;  2BYM A;  3NQJ A;  1M18 B;  3B0B A;  3X1T B;  3MVD B;  4UUZ B;  5GSU B;  5B2J C;  1EQZ D;  2ARO A;  2F8N B;  4QLC C;  1KX4 D;  3LEL D;  5BO0 A;  4XZQ A;  3X1T C;  3MVD C;  1P3I C;  2YFV B;  1KX3 B;  3W99 A;  5CPI B;  1P3O A;  1P3M B;  3W97 A;  5B33 B;  5B24 D;  5B31 A;  4KUD A;  5AV5 A;  1Q9C A;  5AV9 D;  3REI B;  4JJN D;  5AY8 B;  3AZG A;  5CPK D;  5AV6 C;  1H3O A;  4E44 A;  3LZ0 A;  1P3G C;  3VH6 A;  4H9Q B;  4R8P C;  3AV1 B;  3AZK D;  5GXQ B;  1BH8 B;  5BNV A;  4J8W D;  2IO5 B;  4CAY B;  4WZS B;  3REL B;  1P3K A;  1P3P D;  1AOI D;  5DNM B;  3KUY D;  5BT1 C;  2IO5 C;  3REL C;  4J8X B;  4AWL B;  5CHL B;  4G92 C;  1TZY A;  1N1J A;  3AZL C;  3WKJ D;  3C1C C;  5CP6 A;  4J8X C;  4AWL C;  3UTA C;  4WU8 C;  1P3F A;  3MGQ C;  5B2J D;  3AZF C;  5F99 D;  5DNN D;  4QLC D;  3B6F C;  4LD9 A;  4WU9 B;  5B2I B;  5C3I C;  3AZI A;  5FUG A;  3UT9 A;  3WTP D;  1S32 A;  3X1V A;  3LZ1 A;  5JRG B;  3AZN B;  4ZUX D;  2YFW A;  3AV2 D;  3AZN C;  1M18 A;  3X1T A;  4UUZ A;  5B1M B;  5GSU A;  2NQB D;  3UTB B;  2F8N A;  4KGC D;  2YFV A;  1KX3 A;  5CPI A;  3UTB C;  1P3M A;  1F1E A;  1M1A B;  4X23 B;  5B33 A;  1P34 B;  2PYO B;  4XZQ B;  3X1S B;  3W96 D;  1M1A C;  2CWE A;  1BH9 B;  2ARO C;  1F66 B;  1P34 C;  4XZQ C;  3REI A;  3W99 C;  5B32 G;  3KXB B;  3AZL D;  1P3O C;  2HIO B;  5AY8 A;  3W97 C;  3B6G B;  3KWQ B;  3MGS B;  4WU8 D;  5B31 C;  3AZM D;  3AZF D;  4H9Q A;  4KUD C;  5AV5 C;  3AV1 A;  3MGS C;  3B6F D;  5GXQ A;  1BH8 A;  1M19 B;  3W98 D;  3REL A;  1TAF B;  5DNM A;  3AZH B;  1KX5 D;  5AVB B;  4NE6 A;  3WA9 B;  5B40 B;  3AZJ D;  3MGP D;  4J8X A;  3LZ0 C;  3REJ D;  3LJA D;  3O62 B;  5GT0 D;  4J8V B;  1P3A D;  3VH6 T;  1ID3 B;  1U35 B;  1P3K C;  3AYW B;  3V9R B;  3AZE B;  1P3B B;  1KX4 B;  3REK B;  3TU4 D;  4WU9 A;  5B2I A;  1U35 C;  1BFM A;  3KSY A;  4H9R A;  1TZY C;  3AYW C;  5BNX B;  3MGR A;  3AZE C;  1P3B C;  5CPJ D;  1B67 A;  5JRG A; 
#chains in the Genus database with same CATH topology
 5B32 B;  1P3F C;  5AV8 B;  3AFA D;  4J8U A;  4LD9 C;  3W99 D;  5B1M A;  5AV8 C;  5B1L B;  4H9O B;  1S32 C;  3X1V C;  3LZ1 C;  5KDM B;  3H0L C;  4Z5T D;  5B31 D;  5B1L C;  3IP4 C;  2JCH A;  1M1A A;  2Y2I A;  4X23 A;  1PZR A;  1P34 A;  2PYO A;  4J8W B;  1M18 C;  3X1S A;  5GSU C;  3AZG D;  1BH9 A;  1F66 A;  3VH5 A;  5B0Y B;  1KX3 C;  4YS3 D;  3KXB A;  5CPI C;  1P3M C;  2HIO A;  5GT3 B;  2FJ7 D;  3B6G A;  3KWQ A;  5B33 C;  3MGS A;  1P3K D;  5F99 B;  5DNN B;  4HGA B;  5AVC D;  4WV4 B;  3REI C;  1M19 A;  2Y2P A;  1TAF A;  1HQ3 B;  2RIQ A;  5AY8 C;  4HGA C;  3AZH A;  2NZD D;  5AVB A;  5CP6 D;  1P3L B;  3WTP B;  3MNN D;  1JFI B;  5B40 A;  4XUJ D;  3WA9 A;  1W2E A;  3R45 B;  3A6N D;  1P3L C;  2Y2J A;  3O62 A;  3REH D;  4J8V A;  3AV1 C;  3AV2 B;  5GXQ C;  4ZBJ B;  3AZI D;  1ID3 A;  1U35 A;  5DNM C;  3VH5 W;  4NFT A;  4Z66 D;  3UT9 D;  3AYW A;  3V9R A;  5E5A B;  3AZE A;  1P3B A;  1KX4 A;  4KGC B;  3REK A;  1S32 D;  3LZ1 D;  3NQU B;  5BNX A;  5E5A C;  5BS7 A;  1M18 D;  3X1T D;  3X1U B;  3MVD D;  5GSU D;  5B32 A;  1P3I D;  4H9R B;  3F6T A;  2F8N D;  3MGR B;  5AV8 A;  2ZY2 A;  3WAA B;  4H9P B;  4WU9 C;  5B2I C;  1KX3 D;  5CPI D;  3H0R C;  2Y2N A;  3MGR C;  3AL0 C;  5B1L A;  5B33 D;  1ZLA B;  4H9O A;  5G49 B;  4J8U B;  5JRG C;  5KDM A;  3C1B B;  4J8U C;  2JE5 A;  4J8W A;  3W98 B;  5B1M C;  5AY8 D;  4NE3 A;  5AV6 D;  1P3G D;  1T3U A;  2ZY4 A;  4R8P D;  5B0Y A;  3MGP B;  2CV5 B;  3LJA B;  5GT3 A;  4X23 C;  1P3A B;  5BT1 D;  2CV5 C;  2PYO C;  3REL D;  1WWS A;  3X1S C;  5F99 A;  5DNN A;  1F66 C;  3C1C D;  4J8X D;  3KXB C;  1HQ3 A;  5B0Z B;  2HIO C;  2BG1 A;  3UTA D;  3AN2 B;  3MGQ D;  3B6G C;  3KWQ C;  4DQY B;  1P3L A;  5CPJ B;  3WTP A;  1JFI A;  3B0D B;  4G91 B;  4YM6 B;  3AN2 C;  3R45 A;  4ZUX A;  3AFA B;  3AV2 A;  4G91 C;  3B0C W;  4YM6 C;  3KFU G;  1M19 C;  1A7W A;  3AZH C;  4DRB A;  5AVB C;  5E5A A;  4KGC A;  3WA9 C;  5B40 C;  5JRG D;  3AZN D;  3NQU A;  4Z5T B;  3O62 C;  4J8V C;  1EQZ B;  3LEL B;  1ID3 C;  3X1U A;  2HUE B;  1Z2C B;  3UTB D;  1EQZ C;  3WAA A;  1KX4 C;  4H9P A;  3LEL C;  3REK C;  4YS3 B;  5B24 B;  1M1A D;  2FJ7 B;  4X23 D;  2ARO D;  5JA4 B;  5G49 A;  1P34 D;  1ZLA A;  5BS7 C;  2PYO D;  4XZQ D;  5AV9 B;  2RVQ C;  5B32 C;  4EO5 B;  3AZM A;  4JJN B;  1P3O D;  1F66 D;  3W97 D;  3C1B A;  5AVC B;  5CPK B;  3KXB D;  3W98 A;  4EO5 C;  2HIO D;  3KWQ D;  1KX5 A;  2F8N K;  2ZY3 A;  4KUD D;  5AV5 D;  3MGS D;  3MNN B;  2FFF B;  3AZK B;  4XUJ B;  3MGP A;  2CV5 A;  3REJ A;  1P3P B;  3LJA A;  1AOI B;  3REH B;  1P3A A;  3KUY B;  1M19 D;  4J8W C;  1P3P C;  1AOI C;  3EPK A;  3LZ0 D;  4Z66 B;  3KUY C;  3WKJ B;  3WA9 D;  5B40 D;  1KU5 A;  5B0Y C;  2F2A C;  2JSS A;  5B0Z A;  3AN2 A;  5GT3 C;  3O62 D;  4J8V D;  3WKJ C;  5B2J B;  5CPJ A;  4QLC B;  1ID3 D;  1U35 D;  4YM6 A;  1P3I B;  1TZY D;  3AYW D;  5F99 C;  5DNN C;  3AZE D;  1P3B D;  3AFA A;  3REK D;  1HQ3 C;  3EPL A;  1P3F D;  4ZUX B;  3WTP C;  4E45 A;  4LD9 D;  4M6B A;  1ULY A;  2RVQ D;  4DRA A;  5B32 D;  4ZUX C;  4Z5T A;  5AV8 D;  2NQB B;  4Z2M H;  3AV2 C;  1EQZ A;  3LEL A;  4ZBJ C;  3X1V D;  2J8P A;  3A1I A;  5AV6 B;  1B6W A;  1P3G B;  2NQB C;  4H9S A;  5B1L D;  1HTA A;  4KGC C;  4R8P B;  2Y2Q A;  4YS3 A;  4CSR B;  5B24 A;  2FJ7 A;  3W96 B;  5JA4 A;  5AV9 A;  3X1U C;  2LY8 A;  3W96 C;  4G92 B;  4JJN A;  3AZL B;  1P3M D;  1WWI A;  3WAA C;  4WNN B;  5AVC A;  3C1C B;  5CPK A;  5B0Y D;  2BYK B;  4WU8 B;  5GT3 D;  3UTA B;  3MGQ B;  2NZD A;  3AZM B;  3AZF B;  1ZLA C;  3MNN A;  3AZK A;  3B6F B;  4XUJ A;  3REI D;  5C3I B;  3A6N A;  3AZM C;  5B31 G;  1P3P A;  1AOI A;  3REH A;  3C1B C;  4Z2M G;  4H9N B;  1KX5 B;  3KUY A;  3W98 C;  1HQ3 D;  4NE5 A;  3AZJ B;  4KHA B;  4Z66 A;  3REJ B;  1KX5 C;  1P3L D;  3AV1 D;  3VH6 W;  3WKJ A;  5GT0 B;  5GXQ D;  3AZJ C;  3MGP C;  2XD1 A;  3REJ C;  3LJA C;  5DNM D;  5GT0 C;  5B2J A;  1P3A C;  4QLC A;  3TU4 B;  3MVD A;  1P3I A;  2BYM B;  5E5A D;  2F8N H;  3VH5 T;  3TU4 C;  3NQJ B;  3WTP E;  5B0Z C;  2ARO B;  5CPJ C;  5BO0 B;  3B0D C;  4WU9 D;  5B2I D;  3X1U D;  3W99 B;  1P3O B;  3MGR D;  3W97 B;  3WAA D;  3AFA C;  2NQB A;  2DQN C;  3A1K A;  2L5A A;  5AV6 A;  1P3G A;  5B31 B;  1ZLA D;  4KUD B;  5AV5 B;  4R8P A;  4J8U D;  4CSR A;  4Z5T C;  5B1M D;  3AZG B;  3W96 A;  3C1B D;  4CAY A;  3AZG C;  2HUE C;  1H3O B;  3LZ0 B;  3AZL A;  4H9S C;  2F8N G;  4WNN A;  3C1C A;  4YS3 C;  2CV5 D;  2BYK A;  5BNV B;  5B24 C;  3X1S D;  4WU8 A;  3UTA A;  1P3K B;  3MGQ A;  2FJ7 C;  3AZF A;  2Y2L A;  3B6F A;  5AV9 C;  1TZY B;  1N1J B;  4JJN C;  3B6G D;  4H9N A;  2NZD B;  5AVC C;  5CPK C;  5CP6 B;  5B0Z D;  3AZJ A;  4KHA A;  3AN2 D;  1R4V A;  1P3F B;  2NZD C;  3A6N B;  4WJ3 C;  5CP6 C;  5GT0 A;  3MNN C;  3AZK C;  4LD9 B;  4XUJ C;  4YM6 D;  3H0M C;  3AZN A;  3A6N C;  3AZI B;  5FUG B;  3REH C;  3AZH D;  5AVB D;  3UT9 B;  2Y2H A;  3TU4 A;  3AZI C;  3X1V B;  1S32 B;  3LZ1 B;  3B0C T;  3UTB A;  2YFW B;  4Z66 C;  3UT9 C;  2BYM A;  3FDD A;  2G5H C;  3NQJ A;  1M18 B;  3B0B A;  3X1T B;  3MVD B;  4UUZ B;  5GSU B;  5B2J C;  1EQZ D;  2ARO A;  2F8N B;  4QLC C;  1KX4 D;  3LEL D;  5BO0 A;  4XZQ A;  3X1T C;  2Y2M A;  3MVD C;  2YFV B;  1P3I C;  3EG5 B;  1KX3 B;  5CPI B;  3W99 A;  1P3O A;  1P3M B;  3W97 A;  2UWX A;  5B33 B;  2ZM5 A;  5B24 D;  5B31 A;  4KUD A;  5AV5 A;  4UPK A;  1Q9C A;  2ZY5 A;  5AV9 D;  3REI B;  3P5J B;  4JJN D;  5AY8 B;  3AZG A;  5CPK D;  2Y2O A;  5AV6 C;  1H3O A;  4E44 A;  3LZ0 A;  1P3G C;  3VH6 A;  4H9Q B;  4R8P C;  3AV1 B;  3AZK D;  2XD5 A;  5GXQ B;  2W8S A;  1BH8 B;  5BNV A;  4J8W D;  2IO5 B;  4CAY B;  4WZS B;  3REL B;  1P3K A;  1P3P D;  1AOI D;  5DNM B;  3KUY D;  5BT1 C;  3EPJ A;  2IO5 C;  2G5I C;  3REL C;  4J8X B;  4AWL B;  5CHL B;  4G92 C;  1TZY A;  1N1J A;  3AZL C;  3WKJ D;  3C1C C;  5CP6 A;  4J8X C;  4AWL C;  3UTA C;  4WU8 C;  1P3F A;  3MGQ C;  5B2J D;  3AZF C;  5F99 D;  5DNN D;  4QLC D;  3B6F C;  4LD9 A;  4WU9 B;  5B2I B;  5C3I C;  3AZI A;  5FUG A;  3UT9 A;  3WTP D;  1S32 A;  3X1V A;  3LZ1 A;  5JRG B;  3AZN B;  2DF4 C;  4ZUX D;  2YFW A;  2VQR A;  3AV2 D;  3AZN C;  1M18 A;  3X1T A;  4UUZ A;  5B1M B;  5GSU A;  2NQB D;  3UTB B;  2F8N A;  4KGC D;  2YFV A;  1KX3 A;  5CPI A;  3UTB C;  1P3M A;  1F1E A;  1M1A B;  4X23 B;  2Y2G A;  5B33 A;  1P34 B;  2PYO B;  4XZQ B;  3X1S B;  3W96 D;  1M1A C;  2CWE A;  1BH9 B;  2ARO C;  1F66 B;  1P34 C;  4XZQ C;  2Y2K A;  3REI A;  3W99 C;  5B32 G;  3KXB B;  3AZL D;  1P3O C;  2HIO B;  5AY8 A;  3W97 C;  3B6G B;  3KWQ B;  3MGS B;  4WU8 D;  5B31 C;  3AZM D;  3AZF D;  4H9Q A;  4KUD C;  5AV5 C;  3AV1 A;  3MGS C;  3B6F D;  5GXQ A;  1BH8 A;  1M19 B;  3W98 D;  3REL A;  1TAF B;  5DNM A;  3AZH B;  1KX5 D;  5AVB B;  4NE6 A;  3WA9 B;  5B40 B;  3AZJ D;  3MGP D;  4J8X A;  3EPH A;  3LZ0 C;  3REJ D;  3LJA D;  3O62 B;  5GT0 D;  4J8V B;  1P3A D;  3VH6 T;  1ID3 B;  1U35 B;  1P3K C;  3AYW B;  3V9R B;  3AZE B;  1P3B B;  1KX4 B;  3REK B;  3TU4 D;  4WU9 A;  5B2I A;  1U35 C;  1BFM A;  3KSY A;  4H9R A;  1TZY C;  3AYW C;  5BNX B;  3MGR A;  3AZE C;  1P3B C;  5CPJ D;  1B67 A;  5JRG A; 
#chains in the Genus database with same CATH homology
 5B32 B;  1P3F C;  5AV8 B;  3AFA D;  4J8U A;  4LD9 C;  3W99 D;  5B1M A;  5AV8 C;  5B1L B;  4H9O B;  1S32 C;  3X1V C;  3LZ1 C;  5KDM B;  3H0L C;  4Z5T D;  5B31 D;  5B1L C;  3IP4 C;  2JCH A;  1M1A A;  2Y2I A;  4X23 A;  1PZR A;  1P34 A;  2PYO A;  4J8W B;  1M18 C;  3X1S A;  5GSU C;  3AZG D;  1BH9 A;  1F66 A;  3VH5 A;  5B0Y B;  1KX3 C;  4YS3 D;  3KXB A;  5CPI C;  1P3M C;  2HIO A;  5GT3 B;  2FJ7 D;  3B6G A;  3KWQ A;  5B33 C;  3MGS A;  1P3K D;  5F99 B;  5DNN B;  4HGA B;  5AVC D;  4WV4 B;  3REI C;  1M19 A;  2Y2P A;  1TAF A;  1HQ3 B;  2RIQ A;  5AY8 C;  4HGA C;  3AZH A;  2NZD D;  5AVB A;  5CP6 D;  1P3L B;  3WTP B;  3MNN D;  1JFI B;  5B40 A;  4XUJ D;  3WA9 A;  1W2E A;  3R45 B;  3A6N D;  1P3L C;  2Y2J A;  3O62 A;  3REH D;  4J8V A;  3AV1 C;  3AV2 B;  5GXQ C;  4ZBJ B;  3AZI D;  1ID3 A;  1U35 A;  5DNM C;  3VH5 W;  4NFT A;  4Z66 D;  3UT9 D;  3AYW A;  3V9R A;  5E5A B;  3AZE A;  1P3B A;  1KX4 A;  4KGC B;  3REK A;  1S32 D;  3LZ1 D;  3NQU B;  5BNX A;  5E5A C;  5BS7 A;  1M18 D;  3X1T D;  3X1U B;  3MVD D;  5GSU D;  5B32 A;  1P3I D;  4H9R B;  3F6T A;  2F8N D;  3MGR B;  5AV8 A;  2ZY2 A;  3WAA B;  4H9P B;  4WU9 C;  5B2I C;  1KX3 D;  5CPI D;  3H0R C;  2Y2N A;  3MGR C;  3AL0 C;  5B1L A;  5B33 D;  1ZLA B;  4H9O A;  5G49 B;  4J8U B;  5JRG C;  5KDM A;  3C1B B;  4J8U C;  2JE5 A;  4J8W A;  3W98 B;  5B1M C;  5AY8 D;  4NE3 A;  5AV6 D;  1P3G D;  1T3U A;  2ZY4 A;  4R8P D;  5B0Y A;  3MGP B;  2CV5 B;  3LJA B;  5GT3 A;  4X23 C;  1P3A B;  5BT1 D;  2CV5 C;  2PYO C;  3REL D;  1WWS A;  3X1S C;  5F99 A;  5DNN A;  1F66 C;  3C1C D;  4J8X D;  3KXB C;  1HQ3 A;  5B0Z B;  2HIO C;  2BG1 A;  3UTA D;  3AN2 B;  3MGQ D;  3B6G C;  3KWQ C;  4DQY B;  1P3L A;  5CPJ B;  3WTP A;  1JFI A;  3B0D B;  4G91 B;  4YM6 B;  3AN2 C;  3R45 A;  4ZUX A;  3AFA B;  3AV2 A;  4G91 C;  3B0C W;  4YM6 C;  3KFU G;  1M19 C;  1A7W A;  3AZH C;  4DRB A;  5AVB C;  5E5A A;  4KGC A;  3WA9 C;  5B40 C;  5JRG D;  3AZN D;  3NQU A;  4Z5T B;  3O62 C;  4J8V C;  1EQZ B;  3LEL B;  1ID3 C;  3X1U A;  2HUE B;  1Z2C B;  3UTB D;  1EQZ C;  3WAA A;  1KX4 C;  4H9P A;  3LEL C;  3REK C;  4YS3 B;  5B24 B;  1M1A D;  2FJ7 B;  4X23 D;  2ARO D;  5JA4 B;  5G49 A;  1P34 D;  1ZLA A;  5BS7 C;  2PYO D;  4XZQ D;  5AV9 B;  2RVQ C;  5B32 C;  4EO5 B;  3AZM A;  4JJN B;  1P3O D;  1F66 D;  3W97 D;  3C1B A;  5AVC B;  5CPK B;  3KXB D;  3W98 A;  4EO5 C;  2HIO D;  3KWQ D;  1KX5 A;  2F8N K;  2ZY3 A;  4KUD D;  5AV5 D;  3MGS D;  3MNN B;  2FFF B;  3AZK B;  4XUJ B;  3MGP A;  2CV5 A;  3REJ A;  1P3P B;  3LJA A;  1AOI B;  3REH B;  1P3A A;  3KUY B;  1M19 D;  4J8W C;  1P3P C;  1AOI C;  3EPK A;  3LZ0 D;  4Z66 B;  3KUY C;  3WKJ B;  3WA9 D;  5B40 D;  1KU5 A;  5B0Y C;  2F2A C;  2JSS A;  5B0Z A;  3AN2 A;  5GT3 C;  3O62 D;  4J8V D;  3WKJ C;  5B2J B;  5CPJ A;  4QLC B;  1ID3 D;  1U35 D;  4YM6 A;  1P3I B;  1TZY D;  3AYW D;  5F99 C;  5DNN C;  3AZE D;  1P3B D;  3AFA A;  3REK D;  1HQ3 C;  3EPL A;  1P3F D;  4ZUX B;  3WTP C;  4E45 A;  4LD9 D;  4M6B A;  1ULY A;  2RVQ D;  4DRA A;  5B32 D;  4ZUX C;  4Z5T A;  5AV8 D;  2NQB B;  4Z2M H;  3AV2 C;  1EQZ A;  3LEL A;  4ZBJ C;  3X1V D;  2J8P A;  3A1I A;  5AV6 B;  1B6W A;  1P3G B;  2NQB C;  4H9S A;  5B1L D;  1HTA A;  4KGC C;  4R8P B;  2Y2Q A;  4YS3 A;  4CSR B;  5B24 A;  2FJ7 A;  3W96 B;  5JA4 A;  5AV9 A;  3X1U C;  2LY8 A;  3W96 C;  4G92 B;  4JJN A;  3AZL B;  1P3M D;  1WWI A;  3WAA C;  4WNN B;  5AVC A;  3C1C B;  5CPK A;  5B0Y D;  2BYK B;  4WU8 B;  5GT3 D;  3UTA B;  3MGQ B;  2NZD A;  3AZM B;  3AZF B;  1ZLA C;  3MNN A;  3AZK A;  3B6F B;  4XUJ A;  3REI D;  5C3I B;  3A6N A;  3AZM C;  5B31 G;  1P3P A;  1AOI A;  3REH A;  3C1B C;  4Z2M G;  4H9N B;  1KX5 B;  3KUY A;  3W98 C;  1HQ3 D;  4NE5 A;  3AZJ B;  4KHA B;  4Z66 A;  3REJ B;  1KX5 C;  1P3L D;  3AV1 D;  3VH6 W;  3WKJ A;  5GT0 B;  5GXQ D;  3AZJ C;  3MGP C;  2XD1 A;  3REJ C;  3LJA C;  5DNM D;  5GT0 C;  5B2J A;  1P3A C;  4QLC A;  3TU4 B;  3MVD A;  1P3I A;  2BYM B;  5E5A D;  2F8N H;  3VH5 T;  3TU4 C;  3NQJ B;  3WTP E;  5B0Z C;  2ARO B;  5CPJ C;  5BO0 B;  3B0D C;  4WU9 D;  5B2I D;  3X1U D;  3W99 B;  1P3O B;  3MGR D;  3W97 B;  3WAA D;  3AFA C;  2NQB A;  2DQN C;  3A1K A;  2L5A A;  5AV6 A;  1P3G A;  5B31 B;  1ZLA D;  4KUD B;  5AV5 B;  4R8P A;  4J8U D;  4CSR A;  4Z5T C;  5B1M D;  3AZG B;  3W96 A;  3C1B D;  4CAY A;  3AZG C;  2HUE C;  1H3O B;  3LZ0 B;  3AZL A;  4H9S C;  2F8N G;  4WNN A;  3C1C A;  4YS3 C;  2CV5 D;  2BYK A;  5BNV B;  5B24 C;  3X1S D;  4WU8 A;  3UTA A;  1P3K B;  3MGQ A;  2FJ7 C;  3AZF A;  2Y2L A;  3B6F A;  5AV9 C;  1TZY B;  1N1J B;  4JJN C;  3B6G D;  4H9N A;  2NZD B;  5AVC C;  5CPK C;  5CP6 B;  5B0Z D;  3AZJ A;  4KHA A;  3AN2 D;  1R4V A;  1P3F B;  2NZD C;  3A6N B;  4WJ3 C;  5CP6 C;  5GT0 A;  3MNN C;  3AZK C;  4LD9 B;  4XUJ C;  4YM6 D;  3H0M C;  3AZN A;  3A6N C;  3AZI B;  5FUG B;  3REH C;  3AZH D;  5AVB D;  3UT9 B;  2Y2H A;  3TU4 A;  3AZI C;  3X1V B;  1S32 B;  3LZ1 B;  3B0C T;  3UTB A;  2YFW B;  4Z66 C;  3UT9 C;  2BYM A;  3FDD A;  2G5H C;  3NQJ A;  1M18 B;  3B0B A;  3X1T B;  3MVD B;  4UUZ B;  5GSU B;  5B2J C;  1EQZ D;  2ARO A;  2F8N B;  4QLC C;  1KX4 D;  3LEL D;  5BO0 A;  4XZQ A;  3X1T C;  2Y2M A;  3MVD C;  2YFV B;  1P3I C;  3EG5 B;  1KX3 B;  5CPI B;  3W99 A;  1P3O A;  1P3M B;  3W97 A;  2UWX A;  5B33 B;  2ZM5 A;  5B24 D;  5B31 A;  4KUD A;  5AV5 A;  4UPK A;  1Q9C A;  2ZY5 A;  5AV9 D;  3REI B;  3P5J B;  4JJN D;  5AY8 B;  3AZG A;  5CPK D;  2Y2O A;  5AV6 C;  1H3O A;  4E44 A;  3LZ0 A;  1P3G C;  3VH6 A;  4H9Q B;  4R8P C;  3AV1 B;  3AZK D;  2XD5 A;  5GXQ B;  2W8S A;  1BH8 B;  5BNV A;  4J8W D;  2IO5 B;  4CAY B;  4WZS B;  3REL B;  1P3K A;  1P3P D;  1AOI D;  5DNM B;  3KUY D;  5BT1 C;  3EPJ A;  2IO5 C;  2G5I C;  3REL C;  4J8X B;  4AWL B;  5CHL B;  4G92 C;  1TZY A;  1N1J A;  3AZL C;  3WKJ D;  3C1C C;  5CP6 A;  4J8X C;  4AWL C;  3UTA C;  4WU8 C;  1P3F A;  3MGQ C;  5B2J D;  3AZF C;  5F99 D;  5DNN D;  4QLC D;  3B6F C;  4LD9 A;  4WU9 B;  5B2I B;  5C3I C;  3AZI A;  5FUG A;  3UT9 A;  3WTP D;  1S32 A;  3X1V A;  3LZ1 A;  5JRG B;  3AZN B;  2DF4 C;  4ZUX D;  2YFW A;  2VQR A;  3AV2 D;  3AZN C;  1M18 A;  3X1T A;  4UUZ A;  5B1M B;  5GSU A;  2NQB D;  3UTB B;  2F8N A;  4KGC D;  2YFV A;  1KX3 A;  5CPI A;  3UTB C;  1P3M A;  1F1E A;  1M1A B;  4X23 B;  2Y2G A;  5B33 A;  1P34 B;  2PYO B;  4XZQ B;  3X1S B;  3W96 D;  1M1A C;  2CWE A;  1BH9 B;  2ARO C;  1F66 B;  1P34 C;  4XZQ C;  2Y2K A;  3REI A;  3W99 C;  5B32 G;  3KXB B;  3AZL D;  1P3O C;  2HIO B;  5AY8 A;  3W97 C;  3B6G B;  3KWQ B;  3MGS B;  4WU8 D;  5B31 C;  3AZM D;  3AZF D;  4H9Q A;  4KUD C;  5AV5 C;  3AV1 A;  3MGS C;  3B6F D;  5GXQ A;  1BH8 A;  1M19 B;  3W98 D;  3REL A;  1TAF B;  5DNM A;  3AZH B;  1KX5 D;  5AVB B;  4NE6 A;  3WA9 B;  5B40 B;  3AZJ D;  3MGP D;  4J8X A;  3EPH A;  3LZ0 C;  3REJ D;  3LJA D;  3O62 B;  5GT0 D;  4J8V B;  1P3A D;  3VH6 T;  1ID3 B;  1U35 B;  1P3K C;  3AYW B;  3V9R B;  3AZE B;  1P3B B;  1KX4 B;  3REK B;  3TU4 D;  4WU9 A;  5B2I A;  1U35 C;  1BFM A;  3KSY A;  4H9R A;  1TZY C;  3AYW C;  5BNX B;  3MGR A;  3AZE C;  1P3B C;  5CPJ D;  1B67 A;  5JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...