2FJ7A

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7A00
3REHB 3AZNB 5DNNC 3B6FA 1P3BB 3W97C 1EQZC 5B33A 4WU8C 5B40C 1P3FA 3LZ0A 2HIOA 4LD9B 5AY8B 5JA4B 3MVDD 3R45B 5JRGD 5B31D 3AZGA 1P3GD 5BNVA 1ID3D 3AZLA 3W98C 4WNNA 3WA9D 1ZLAA 3AFAD 3B6FD 1P34D 3TU4D 4J8XB 3X1VC 3LZ0D 3AZGD 2AROC 3AZEA 3B0BA 4Z66D 2RVQD 5F99D 4JJNC 3AZLD 3AV2B 2CWEA 1KX4C 1ZLAD 4G92B 4ZBJC 4H9SA 1H3OB 5B1LD 4WU9A 1B67A 1P3IA 4KGCC 3LJAA 3MVDB 5JRGB 5B31B 3LELA 3AZED 1P3GB 1ID3B 3WA9B 3UTAA 3AZFA 4YS3A 3AFAB 3B6FB 4NE3A 5KDMA 1P34B 3TU4B 5GT0D 4LD9C 4WU9D 1P3ID 5DNMA 3AZGB 3LELD 4E45A 3B0DB 4YM6A 3AZLB 4Z66B 4HGAC 5F99B 3LZ1A 3AZFD 4YS3D 2CV5D 1P3AC 1ZLAB 1M1AD 4H9NA 1TZYA 1M18D 1AOIC 3W96D 3AZMD 5B31G 5AVBC 3NQJB 1KX5A 3KUYC 4XZQC 5B1LB 4E44A 5DNMD 5B0ZA 3AZEB 4G92C 3B6GA 5CHLB 3MGQA 4X23C 3AV1A 5GT0B 3C1BD 5GT3C 2F8NK 4ZUXD 4WU9B 1F1EA 3W98D 5JRGC 1P3IB 1P3GC 3LELB 2CV5B 3AZFB 4YS3B 3B6FC 1M1AB 4WU8D 5KDMB 1M18B 3X1VA 5B33C 3W96B 3AZMB 5B0YA 1P3FC 3LZ0C 2HIOC 4XUJB 3UT9B 5DNMB 3B0DC 2YFVA 3AZLC 2RVQC 1ZLAC 5CPKA 2BYMA 3X1VD 1B6WA 3B0CW 3C1BB 2AROD 2LY8A 3RELA 4JJND 1KX4D 1JFIA 4ZUXB 3W98B 3AZEC 5GXQA 4WU8B 4Z5TA 5B32A 4H9SC 3UTBA 5AVCA 1WWIA 1Q9CA 1P3IC 3LJAC 2NZDA 3LELC 3REIA 5G49A 3UTAC 4YS3C 5AV5A 3AZFC 5FUGA 1F66A 5B32D 3X1VB 1P3MA 3UTBD 5AVCD 4R8PA 2AROB 2F8NA 3V9RA 4JJNB 3MGRA 5DNMC 5BO0B 4J8UA 1P3AD 1KX4B 3REID 4YM6C 4ZBJB 1AOID 3LZ1C 4QLCA 5AVBD 3REKA 3X1SA 1TZYC 3KUYD 3X1UC 5GT3A 4XZQD 1P3OA 1P3MD 3VH5A 1KX5C 4R8PD 4H9OA 2F8ND 4J8VA 4NE5A 4UUZB 2BYKA 1JFIB 1S32A 5B0ZC 4WV4B 4X23D 4QLCD 3REKD 3B6GC 3MGQC 3WTPA 5GT3D 1ULYA 5B32B 3A6NA 3AV1C 3UTBB 5AVCB 5AV8A 4HGAB 1P3AB 3REIB 5BNXB 3WAAA 1AOIB 3NQUA 5E5AA 5B33D 3KXBA 5AVBB 2L5AA 2F8NH 1P3FD 3KUYB 3A6ND 5B0YC 2HIOD 4XZQB 3VH6T 3REJA 1P3MB 1P3LA 1M19A 5AV8D 4R8PB 3AN2A 3KWQA 4WZSB 5AV6A 1A7WA 5B32G 3VH5T 4KHAA 4X23B 5CPKC 5E5AD 4QLCB 2IO5C 3REKB 3O62A 5GT3B 3REJD 5B2JA 1M19D 4DRAA 3RELC 4H9OB 4EO5C 5AV6D 2BYKB 3AYWA 3MNNA 3AZIA 1N1JA 1P3KA 3W99A 5GXQC 5B33B 4Z5TC 1P3FB 5B32C 3LZ0B 2HIOB 3A6NB 3UTBC 5AVCC 3LJAD 5AV8B 5CPIA 5BNVB 4WNNB 3X1TA 3UTAD 2NZDC 3AYWD 3REIC 5GSUA 3AZID 1P3KD 3X1UA 5AV5C 5E5AB 1R4VA 1BH8A 1F66C 4KUDA 1P3MC 3REJB 4R8PC 5BT1C 1M19B 4YM6D 3LZ1D 3MGRC 4J8UC 5AV6B 5CP6A 4G91C 1TZYD 3WKJA 3X1UD 4KHAB 4QLCC 3REKC 3X1SC 1KX5D 4KUDD 5B24A 1P3OC 2FJ7A 5B0ZD 3LJAB 4J8VC 1S32C 3UTAB 5CP6D 1TAFA 3B6GD 2HUEC 3MGQD 3AZIB 1KX3A 1P3KB 3AV1D 1BH9A 5BS7A 3WTPC 3A6NC 5AV8C 4YM6B 4H9RA 3LZ1B 3WAAC 1KX3D 4H9NB 1TZYB 3X1UB 5E5AC 3KXBC 1BFMA 5B0YD 3AZHA 1KX5B 4KUDB 3REJC 1P3LC 1M19C 5B1MA 3AN2C 5B0ZB 3KWQC 5AV6C 4H9QA 5CPKD 3AZKA 5CP6B 3B6GB 3MGQB 3AV1B 4CAYA 3O62C 3RELD 5B2JC 2NQBA 5B1MD 5CPJA 4Z2MH 5GXQD 3AYWC 3MNNC 3AZJA 3AZIC 5AV9A 3W99C 1P3KC 4Z5TD 1KX3B 1U35A 4DRBA 5B0YB 1HQ3A 3REHA 1P3BA 3MGSA 4NE6A 3VH6W 2NQBD 2NZDD 5CPIC 2YFVB 3X1TC 5AV5D 5CPKB 5GSUC 3AZJD 2IO5B 5AY8A 1F66D 3R45A 2BYMB 5BT1D 4KUDC 3RELB 3MGSD 4EO5B 3MGRD 4J8UD 5B1MB 4J8XA 4Z2MG 5CP6C 5GXQB 3X1SD 3WKJC 5C3IC 4M6BA 4Z5TB 5B2IA 4AWLC 1P3OD 3AV2A 1KU5A 5B24C 2FJ7C 4J8VD 1S32D 2NQBB 2NZDB 3B0CT 1H3OA 5G49B 3WTPE 5AV5B 5FUGB 3AZJB 1KX3C 3WTPD 3MVDA 1F66B 5B31A 1ID3A 5BS7C 5B2ID 3WA9A 3AFAA 2F8NB 2YFWA 3V9RB 3MGSB 3MGRB 4J8UB 3MGPA 1P34A 3TU4A 3WAAD 4G91B 3KXBD 3X1SB 4Z66A 5F99A 3AZHC 1P3LD 1P3OB 3AN2D 3KWQD 4J8VB 5B1MC 3MGPD 4J8WA 1S32B 3NQJA 1P3PA 2HUEB 3C1CA 3AZKC 5B1LA 2F8NG 3O62D 3WTPB 5B2IB 5B2JD 2NQBC 4J8WD 5CPJC 3MNND 1P3PD 5GT0A 3C1CD 3W99D 3WAAB 3NQUB 3KXBB 3AZJC 5AV9C 1U35C 2CV5A 1HQ3C 1P3LB 3REHC 3AZNC 5CPID 3AN2B 1P3BC 1M1AA 3KWQB 3X1TD 3MGSC 2YFWB 3W96A 1M18A 3AZMA 3MGPB 5GSUD 2JSSA 4XUJA 3KSYA 5AY8C 2PYOA 3UT9A 3O62B 5B2JB 4NFTA 1WWSA 4J8WB 3AYWB 4J8XC 3MNNB 1P3PB 3WKJD 3C1CB 1N1JB 3C1BA 3W99B 4XUJD 1EQZA 2PYOD 4ZUXA 3W98A 3UT9D 5B24D 5B2IC 5DNNA 2FJ7D 3AV2C 3W97A 5CPIB 4WU8A 3X1TB 5B40A 4CSRA 5GSUB 1EQZD 4H9PA 3MVDC 1BH8B 5B31C 1ID3C 3WA9C 5DNND 3W97D 3AFAC 5B40D 1P34C 3MGPC 3TU4C 3WKJB 2AROA 5C3IB 4AWLB 3AZHD 4JJNA 1KX4A 5BO0A 3AZGC 2PYOB 5B24B 4Z66C 5F99C 2FJ7B 4J8WC 3AZKD 1TAFB 1P3PC 3C1CC 4KGCA 1BH9B 5B1LC 1EQZB 4UUZA 3AZNA 5DNNB 5CPJD 3W97B 4H9RB 5B40B 4CSRB 4LD9A 5GT0C 5JA4A 5AV9D 3VH5W 4KGCD 1U35D 1HTAA 4WU9C 1HQ3D 3AZHB 3REHD 4H9PB 3AZND 1P3AA 1P3BD 5BNXA 2CV5C 1AOIA 5AVBA 1M1AC 3KUYA 3W96C 1M18C 4H9QB 3AZMC 3AZKB 4XZQA 4LD9D 5AY8D 4XUJC 2PYOC 4CAYB 3UT9C 3VH6A 4X23A 5CPJB 4J8XD 5AV9B 3C1BC 5JRGA 4KGCB 1P3GA 1U35B 3AV2D 4ZUXC 1HQ3B
chains in the Genus database with same CATH superfamily
3REHB 3AZNB 5DNNC 3B6FA 1P3BB 3W97C 1EQZC 5B33A 4WU8C 5B40C 1P3FA 3LZ0A 2HIOA 4LD9B 5AY8B 5JA4B 3MVDD 3R45B 5JRGD 5B31D 3AZGA 1P3GD 5BNVA 1ID3D 3AZLA 3W98C 4WNNA 3WA9D 1ZLAA 3AFAD 3B6FD 1P34D 3TU4D 4J8XB 3X1VC 2W8SA 3LZ0D 3AZGD 2AROC 3AZEA 3B0BA 4Z66D 2RVQD 5F99D 4JJNC 3AZLD 3AV2B 2CWEA 1KX4C 1ZLAD 4G92B 4ZBJC 4H9SA 1H3OB 5B1LD 4WU9A 1B67A 1P3IA 4KGCC 3LJAA 3MVDB 5JRGB 5B31B 3LELA 3AZED 1P3GB 1ID3B 3WA9B 3UTAA 3AZFA 4YS3A 3AFAB 3B6FB 4NE3A 5KDMA 1P34B 3TU4B 5GT0D 2XD5A 4LD9C 4WU9D 2Y2NA 1P3ID 5DNMA 3AZGB 3LELD 4E45A 3B0DB 4YM6A 3AZLB 4Z66B 4HGAC 5F99B 3LZ1A 3AZFD 4YS3D 2CV5D 1P3AC 1ZLAB 1M1AD 4H9NA 1TZYA 1M18D 1AOIC 3W96D 2Y2QA 5B31G 5AVBC 3AZMD 3NQJB 1W2EA 1KX5A 2BG1A 3KUYC 1T3UA 3F6TA 4XZQC 5B1LB 4E44A 5DNMD 5B0ZA 3AZEB 4G92C 3B6GA 3KFUG 5CHLB 3MGQA 4X23C 3AV1A 5GT0B 3C1BD 5GT3C 2F8NK 4ZUXD 4WU9B 1F1EA 3W98D 5JRGC 1P3IB 1P3GC 3LELB 2CV5B 3AZFB 2G5IC 4YS3B 3B6FC 1M1AB 4WU8D 5KDMB 1M18B 3X1VA 5B33C 3W96B 3AZMB 5B0YA 1P3FC 3LZ0C 2HIOC 4XUJB 3UT9B 5DNMB 3B0DC 2YFVA 3AZLC 2RVQC 1ZLAC 5CPKA 4DQYB 2BYMA 3X1VD 1B6WA 2ZM5A 3B0CW 3C1BB 2AROD 2LY8A 3RELA 4JJND 1KX4D 1JFIA 4ZUXB 3W98B 3AZEC 5GXQA 4WU8B 4Z5TA 5B32A 4H9SC 3UTBA 5AVCA 1WWIA 1Q9CA 3AL0C 1P3IC 3LJAC 2NZDA 3LELC 3REIA 5G49A 3UTAC 4YS3C 5AV5A 3AZFC 5FUGA 1F66A 5B32D 3X1VB 1P3MA 3UTBD 3EPJA 5AVCD 1Z2CB 2XD1A 4R8PA 2JE5A 2AROB 2G5HC 2F8NA 2DQNC 3V9RA 3MGRA 5DNMC 5BO0B 4J8UA 4JJNB 1P3AD 1KX4B 3REID 4YM6C 4ZBJB 1AOID 3LZ1C 4QLCA 5AVBD 3REKA 3X1SA 3EPKA 1TZYC 3KUYD 3X1UC 5GT3A 4XZQD 1P3OA 1P3MD 3VH5A 2Y2OA 1KX5C 4R8PD 4H9OA 2F8ND 4J8VA 4NE5A 4UUZB 2BYKA 1JFIB 1S32A 5B0ZC 4WV4B 2ZY4A 4X23D 4QLCD 3REKD 3B6GC 3MGQC 3WTPA 5GT3D 1ULYA 5B32B 3A6NA 3AV1C 3UTBB 5AVCB 5AV8A 4HGAB 1P3AB 3REIB 5BNXB 3WAAA 1AOIB 3NQUA 5E5AA 5B33D 3KXBA 5AVBB 2L5AA 2F8NH 1P3FD 2F2AC 3KUYB 3A6ND 5B0YC 2HIOD 4XZQB 3VH6T 3REJA 1P3MB 1P3LA 1M19A 5AV8D 4R8PB 3AN2A 2Y2KA 3KWQA 4WZSB 5AV6A 1A7WA 5B32G 3VH5T 4KHAA 4X23B 5CPKC 5E5AD 3FDDA 2IO5C 4QLCB 3REKB 3O62A 5GT3B 3REJD 5B2JA 1M19D 4DRAA 2Y2JA 3RELC 4H9OB 4EO5C 5AV6D 2BYKB 3AYWA 3MNNA 3AZIA 1N1JA 1P3KA 3W99A 5GXQC 5B33B 4Z5TC 1P3FB 5B32C 3LZ0B 2HIOB 3A6NB 3UTBC 2ZY5A 5AVCC 3LJAD 5AV8B 5CPIA 5BNVB 4WNNB 3X1TA 3UTAD 2NZDC 3AYWD 3REIC 5GSUA 3AZID 1P3KD 3X1UA 5AV5C 5E5AB 1R4VA 1BH8A 1F66C 4KUDA 1P3MC 3REJB 4R8PC 5BT1C 1M19B 4YM6D 3LZ1D 3MGRC 4J8UC 2Y2MA 5CP6A 5AV6B 4G91C 1TZYD 3WKJA 3X1UD 4KHAB 4QLCC 3REKC 3X1SC 3IP4C 1KX5D 4KUDD 5B24A 3P5JB 2J8PA 1P3OC 2FJ7A 5B0ZD 3LJAB 4J8VC 1S32C 3UTAB 5CP6D 1TAFA 3B6GD 2HUEC 2Y2PA 3MGQD 3AZIB 1KX3A 1P3KB 3AV1D 1BH9A 5BS7A 3WTPC 3EPHA 3A6NC 3H0LC 5AV8C 2UWXA 4YM6B 4H9RA 3LZ1B 2Y2LA 3WAAC 1KX3D 4H9NB 1TZYB 3X1UB 5E5AC 3KXBC 1BFMA 5B0YD 3AZHA 1KX5B 4KUDB 3REJC 1P3LC 1M19C 5B1MA 3AN2C 5B0ZB 3KWQC 5AV6C 4H9QA 5CPKD 3AZKA 5CP6B 3B6GB 3MGQB 3AV1B 4CAYA 3O62C 3RELD 2JCHA 5B2JC 2NQBA 5B1MD 5CPJA 4Z2MH 2Y2GA 5GXQD 3AYWC 3MNNC 3AZJA 3AZIC 5AV9A 3W99C 1P3KC 4Z5TD 1KX3B 1U35A 4DRBA 5B0YB 1HQ3A 3REHA 1P3BA 3MGSA 4NE6A 3VH6W 2NQBD 2NZDD 5CPIC 2YFVB 3X1TC 5AV5D 3EG5B 2Y2HA 5CPKB 5GSUC 3AZJD 2IO5B 5AY8A 1F66D 3R45A 2BYMB 5BT1D 4KUDC 3RELB 3MGSD 4EO5B 3MGRD 4J8UD 5B1MB 4J8XA 4Z2MG 5CP6C 5GXQB 3X1SD 3WKJC 5C3IC 4M6BA 4Z5TB 5B2IA 4AWLC 1P3OD 3AV2A 1KU5A 5B24C 2FJ7C 4J8VD 1S32D 2NQBB 2NZDB 3B0CT 1H3OA 5G49B 3WTPE 5AV5B 5FUGB 3AZJB 1KX3C 3WTPD 3MVDA 1F66B 5B31A 1ID3A 5BS7C 5B2ID 3WA9A 3AFAA 2F8NB 3A1IA 2YFWA 3V9RB 3MGSB 3MGRB 4J8UB 3MGPA 1P34A 3TU4A 3WAAD 4G91B 3KXBD 3X1SB 4Z66A 5F99A 3AZHC 1P3LD 1P3OB 4WJ3C 2FFFB 3AN2D 3KWQD 4J8VB 5B1MC 3MGPD 4J8WA 1S32B 3NQJA 1P3PA 2HUEB 3C1CA 3AZKC 3H0MC 5B1LA 2F8NG 3O62D 3WTPB 5B2IB 3A1KA 5B2JD 2NQBC 4J8WD 5CPJC 3MNND 1P3PD 5GT0A 3C1CD 3W99D 3WAAB 3NQUB 3KXBB 3AZJC 5AV9C 1U35C 2VQRA 2Y2IA 2CV5A 1HQ3C 1P3LB 3REHC 3AZNC 5CPID 3AN2B 1P3BC 1M1AA 3KWQB 3X1TD 3MGSC 2YFWB 3W96A 1M18A 3AZMA 3MGPB 5GSUD 2JSSA 4XUJA 3KSYA 5AY8C 2PYOA 3UT9A 3O62B 5B2JB 4NFTA 3EPLA 1WWSA 4J8WB 3AYWB 4J8XC 3MNNB 1P3PB 3WKJD 3C1CB 1N1JB 3C1BA 3W99B 4XUJD 2RIQA 1EQZA 2PYOD 4ZUXA 3W98A 3UT9D 5B24D 5B2IC 5DNNA 2FJ7D 3AV2C 3W97A 1PZRA 5CPIB 4WU8A 3X1TB 5B40A 4CSRA 5GSUB 1EQZD 4H9PA 3MVDC 1BH8B 5B31C 1ID3C 3WA9C 5DNND 3W97D 3AFAC 5B40D 1P34C 3MGPC 3TU4C 3WKJB 2AROA 5C3IB 4AWLB 3AZHD 4JJNA 1KX4A 5BO0A 3AZGC 2PYOB 5B24B 4Z66C 5F99C 2FJ7B 4J8WC 3AZKD 1TAFB 1P3PC 3C1CC 4KGCA 1BH9B 5B1LC 1EQZB 4UUZA 3AZNA 2ZY3A 5DNNB 5CPJD 3W97B 4H9RB 5B40B 4CSRB 4LD9A 5GT0C 5JA4A 5AV9D 3VH5W 4KGCD 1U35D 1HTAA 4WU9C 1HQ3D 3AZHB 3REHD 4H9PB 3AZND 1P3AA 1P3BD 3H0RC 5BNXA 2CV5C 1AOIA 5AVBA 1M1AC 3KUYA 3W96C 1M18C 4H9QB 3AZMC 3AZKB 2DF4C 4XZQA 4LD9D 5AY8D 4XUJC 4UPKA 2PYOC 4CAYB 3UT9C 3VH6A 4X23A 5CPJB 4J8XD 2ZY2A 5AV9B 3C1BC 5JRGA 4KGCB 1P3GA 1U35B 3AV2D 4ZUXC 1HQ3B
chains in the Genus database with same CATH topology
3REHB 3AZNB 5DNNC 3B6FA 1P3BB 3W97C 1EQZC 5B33A 4WU8C 5B40C 1P3FA 3LZ0A 2HIOA 4LD9B 5AY8B 5JA4B 3MVDD 3R45B 5JRGD 5B31D 3AZGA 1P3GD 5BNVA 1ID3D 3AZLA 3W98C 4WNNA 3WA9D 1ZLAA 3AFAD 3B6FD 1P34D 3TU4D 4J8XB 3X1VC 2W8SA 3LZ0D 3AZGD 2AROC 3AZEA 3B0BA 4Z66D 2RVQD 5F99D 4JJNC 3AZLD 3AV2B 2CWEA 1KX4C 1ZLAD 4G92B 4ZBJC 4H9SA 1H3OB 5B1LD 4WU9A 1B67A 1P3IA 4KGCC 3LJAA 3MVDB 5JRGB 5B31B 3LELA 3AZED 1P3GB 1ID3B 3WA9B 3UTAA 3AZFA 4YS3A 3AFAB 3B6FB 4NE3A 5KDMA 1P34B 3TU4B 5GT0D 2XD5A 4LD9C 4WU9D 2Y2NA 1P3ID 5DNMA 3AZGB 3LELD 4E45A 3B0DB 4YM6A 3AZLB 4Z66B 4HGAC 5F99B 3LZ1A 3AZFD 4YS3D 2CV5D 1P3AC 1ZLAB 1M1AD 4H9NA 1TZYA 1M18D 1AOIC 3W96D 2Y2QA 5B31G 5AVBC 3AZMD 3NQJB 1W2EA 1KX5A 2BG1A 3KUYC 1T3UA 3F6TA 4XZQC 5B1LB 4E44A 5DNMD 5B0ZA 3AZEB 4G92C 3B6GA 3KFUG 5CHLB 3MGQA 4X23C 3AV1A 5GT0B 3C1BD 5GT3C 2F8NK 4ZUXD 4WU9B 1F1EA 3W98D 5JRGC 1P3IB 1P3GC 3LELB 2CV5B 3AZFB 2G5IC 4YS3B 3B6FC 1M1AB 4WU8D 5KDMB 1M18B 3X1VA 5B33C 3W96B 3AZMB 5B0YA 1P3FC 3LZ0C 2HIOC 4XUJB 3UT9B 5DNMB 3B0DC 2YFVA 3AZLC 2RVQC 1ZLAC 5CPKA 4DQYB 2BYMA 3X1VD 1B6WA 2ZM5A 3B0CW 3C1BB 2AROD 2LY8A 3RELA 4JJND 1KX4D 1JFIA 4ZUXB 3W98B 3AZEC 5GXQA 4WU8B 4Z5TA 5B32A 4H9SC 3UTBA 5AVCA 1WWIA 1Q9CA 3AL0C 1P3IC 3LJAC 2NZDA 3LELC 3REIA 5G49A 3UTAC 4YS3C 5AV5A 3AZFC 5FUGA 1F66A 5B32D 3X1VB 1P3MA 3UTBD 3EPJA 5AVCD 1Z2CB 2XD1A 4R8PA 2JE5A 2AROB 2G5HC 2F8NA 2DQNC 3V9RA 3MGRA 5DNMC 5BO0B 4J8UA 4JJNB 1P3AD 1KX4B 3REID 4YM6C 4ZBJB 1AOID 3LZ1C 4QLCA 5AVBD 3REKA 3X1SA 3EPKA 1TZYC 3KUYD 3X1UC 5GT3A 4XZQD 1P3OA 1P3MD 3VH5A 2Y2OA 1KX5C 4R8PD 4H9OA 2F8ND 4J8VA 4NE5A 4UUZB 2BYKA 1JFIB 1S32A 5B0ZC 4WV4B 2ZY4A 4X23D 4QLCD 3REKD 3B6GC 3MGQC 3WTPA 5GT3D 1ULYA 5B32B 3A6NA 3AV1C 3UTBB 5AVCB 5AV8A 4HGAB 1P3AB 3REIB 5BNXB 3WAAA 1AOIB 3NQUA 5E5AA 5B33D 3KXBA 5AVBB 2L5AA 2F8NH 1P3FD 2F2AC 3KUYB 3A6ND 5B0YC 2HIOD 4XZQB 3VH6T 3REJA 1P3MB 1P3LA 1M19A 5AV8D 4R8PB 3AN2A 2Y2KA 3KWQA 4WZSB 5AV6A 1A7WA 5B32G 3VH5T 4KHAA 4X23B 5CPKC 5E5AD 3FDDA 2IO5C 4QLCB 3REKB 3O62A 5GT3B 3REJD 5B2JA 1M19D 4DRAA 2Y2JA 3RELC 4H9OB 4EO5C 5AV6D 2BYKB 3AYWA 3MNNA 3AZIA 1N1JA 1P3KA 3W99A 5GXQC 5B33B 4Z5TC 1P3FB 5B32C 3LZ0B 2HIOB 3A6NB 3UTBC 2ZY5A 5AVCC 3LJAD 5AV8B 5CPIA 5BNVB 4WNNB 3X1TA 3UTAD 2NZDC 3AYWD 3REIC 5GSUA 3AZID 1P3KD 3X1UA 5AV5C 5E5AB 1R4VA 1BH8A 1F66C 4KUDA 1P3MC 3REJB 4R8PC 5BT1C 1M19B 4YM6D 3LZ1D 3MGRC 4J8UC 2Y2MA 5CP6A 5AV6B 4G91C 1TZYD 3WKJA 3X1UD 4KHAB 4QLCC 3REKC 3X1SC 3IP4C 1KX5D 4KUDD 5B24A 3P5JB 2J8PA 1P3OC 2FJ7A 5B0ZD 3LJAB 4J8VC 1S32C 3UTAB 5CP6D 1TAFA 3B6GD 2HUEC 2Y2PA 3MGQD 3AZIB 1KX3A 1P3KB 3AV1D 1BH9A 5BS7A 3WTPC 3EPHA 3A6NC 3H0LC 5AV8C 2UWXA 4YM6B 4H9RA 3LZ1B 2Y2LA 3WAAC 1KX3D 4H9NB 1TZYB 3X1UB 5E5AC 3KXBC 1BFMA 5B0YD 3AZHA 1KX5B 4KUDB 3REJC 1P3LC 1M19C 5B1MA 3AN2C 5B0ZB 3KWQC 5AV6C 4H9QA 5CPKD 3AZKA 5CP6B 3B6GB 3MGQB 3AV1B 4CAYA 3O62C 3RELD 2JCHA 5B2JC 2NQBA 5B1MD 5CPJA 4Z2MH 2Y2GA 5GXQD 3AYWC 3MNNC 3AZJA 3AZIC 5AV9A 3W99C 1P3KC 4Z5TD 1KX3B 1U35A 4DRBA 5B0YB 1HQ3A 3REHA 1P3BA 3MGSA 4NE6A 3VH6W 2NQBD 2NZDD 5CPIC 2YFVB 3X1TC 5AV5D 3EG5B 2Y2HA 5CPKB 5GSUC 3AZJD 2IO5B 5AY8A 1F66D 3R45A 2BYMB 5BT1D 4KUDC 3RELB 3MGSD 4EO5B 3MGRD 4J8UD 5B1MB 4J8XA 4Z2MG 5CP6C 5GXQB 3X1SD 3WKJC 5C3IC 4M6BA 4Z5TB 5B2IA 4AWLC 1P3OD 3AV2A 1KU5A 5B24C 2FJ7C 4J8VD 1S32D 2NQBB 2NZDB 3B0CT 1H3OA 5G49B 3WTPE 5AV5B 5FUGB 3AZJB 1KX3C 3WTPD 3MVDA 1F66B 5B31A 1ID3A 5BS7C 5B2ID 3WA9A 3AFAA 2F8NB 3A1IA 2YFWA 3V9RB 3MGSB 3MGRB 4J8UB 3MGPA 1P34A 3TU4A 3WAAD 4G91B 3KXBD 3X1SB 4Z66A 5F99A 3AZHC 1P3LD 1P3OB 4WJ3C 2FFFB 3AN2D 3KWQD 4J8VB 5B1MC 3MGPD 4J8WA 1S32B 3NQJA 1P3PA 2HUEB 3C1CA 3AZKC 3H0MC 5B1LA 2F8NG 3O62D 3WTPB 5B2IB 3A1KA 5B2JD 2NQBC 4J8WD 5CPJC 3MNND 1P3PD 5GT0A 3C1CD 3W99D 3WAAB 3NQUB 3KXBB 3AZJC 5AV9C 1U35C 2VQRA 2Y2IA 2CV5A 1HQ3C 1P3LB 3REHC 3AZNC 5CPID 3AN2B 1P3BC 1M1AA 3KWQB 3X1TD 3MGSC 2YFWB 3W96A 1M18A 3AZMA 3MGPB 5GSUD 2JSSA 4XUJA 3KSYA 5AY8C 2PYOA 3UT9A 3O62B 5B2JB 4NFTA 3EPLA 1WWSA 4J8WB 3AYWB 4J8XC 3MNNB 1P3PB 3WKJD 3C1CB 1N1JB 3C1BA 3W99B 4XUJD 2RIQA 1EQZA 2PYOD 4ZUXA 3W98A 3UT9D 5B24D 5B2IC 5DNNA 2FJ7D 3AV2C 3W97A 1PZRA 5CPIB 4WU8A 3X1TB 5B40A 4CSRA 5GSUB 1EQZD 4H9PA 3MVDC 1BH8B 5B31C 1ID3C 3WA9C 5DNND 3W97D 3AFAC 5B40D 1P34C 3MGPC 3TU4C 3WKJB 2AROA 5C3IB 4AWLB 3AZHD 4JJNA 1KX4A 5BO0A 3AZGC 2PYOB 5B24B 4Z66C 5F99C 2FJ7B 4J8WC 3AZKD 1TAFB 1P3PC 3C1CC 4KGCA 1BH9B 5B1LC 1EQZB 4UUZA 3AZNA 2ZY3A 5DNNB 5CPJD 3W97B 4H9RB 5B40B 4CSRB 4LD9A 5GT0C 5JA4A 5AV9D 3VH5W 4KGCD 1U35D 1HTAA 4WU9C 1HQ3D 3AZHB 3REHD 4H9PB 3AZND 1P3AA 1P3BD 3H0RC 5BNXA 2CV5C 1AOIA 5AVBA 1M1AC 3KUYA 3W96C 1M18C 4H9QB 3AZMC 3AZKB 2DF4C 4XZQA 4LD9D 5AY8D 4XUJC 4UPKA 2PYOC 4CAYB 3UT9C 3VH6A 4X23A 5CPJB 4J8XD 2ZY2A 5AV9B 3C1BC 5JRGA 4KGCB 1P3GA 1U35B 3AV2D 4ZUXC 1HQ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH B;  3AZN B;  5DNN C;  3B6F A;  1P3B B;  3W97 C;  1EQZ C;  5B33 A;  4WU8 C;  5B40 C;  1P3F A;  3LZ0 A;  2HIO A;  4LD9 B;  5AY8 B;  5JA4 B;  3MVD D;  3R45 B;  5JRG D;  5B31 D;  3AZG A;  1P3G D;  5BNV A;  1ID3 D;  3AZL A;  3W98 C;  4WNN A;  3WA9 D;  1ZLA A;  3AFA D;  3B6F D;  1P34 D;  3TU4 D;  4J8X B;  3X1V C;  3LZ0 D;  3AZG D;  2ARO C;  3AZE A;  3B0B A;  4Z66 D;  2RVQ D;  5F99 D;  4JJN C;  3AZL D;  3AV2 B;  2CWE A;  1KX4 C;  1ZLA D;  4G92 B;  4ZBJ C;  4H9S A;  1H3O B;  5B1L D;  4WU9 A;  1B67 A;  1P3I A;  4KGC C;  3LJA A;  3MVD B;  5JRG B;  5B31 B;  3LEL A;  3AZE D;  1P3G B;  1ID3 B;  3WA9 B;  3UTA A;  3AZF A;  4YS3 A;  3AFA B;  3B6F B;  4NE3 A;  5KDM A;  1P34 B;  3TU4 B;  5GT0 D;  4LD9 C;  4WU9 D;  1P3I D;  5DNM A;  3AZG B;  3LEL D;  4E45 A;  3B0D B;  4YM6 A;  3AZL B;  4Z66 B;  4HGA C;  5F99 B;  3LZ1 A;  3AZF D;  4YS3 D;  2CV5 D;  1P3A C;  1ZLA B;  1M1A D;  4H9N A;  1TZY A;  1M18 D;  1AOI C;  3W96 D;  3AZM D;  5B31 G;  5AVB C;  3NQJ B;  1KX5 A;  3KUY C;  4XZQ C;  5B1L B;  4E44 A;  5DNM D;  5B0Z A;  3AZE B;  4G92 C;  3B6G A;  5CHL B;  3MGQ A;  4X23 C;  3AV1 A;  5GT0 B;  3C1B D;  5GT3 C;  2F8N K;  4ZUX D;  4WU9 B;  1F1E A;  3W98 D;  5JRG C;  1P3I B;  1P3G C;  3LEL B;  2CV5 B;  3AZF B;  4YS3 B;  3B6F C;  1M1A B;  4WU8 D;  5KDM B;  1M18 B;  3X1V A;  5B33 C;  3W96 B;  3AZM B;  5B0Y A;  1P3F C;  3LZ0 C;  2HIO C;  4XUJ B;  3UT9 B;  5DNM B;  3B0D C;  2YFV A;  3AZL C;  2RVQ C;  1ZLA C;  5CPK A;  2BYM A;  3X1V D;  1B6W A;  3B0C W;  3C1B B;  2ARO D;  2LY8 A;  3REL A;  4JJN D;  1KX4 D;  1JFI A;  4ZUX B;  3W98 B;  3AZE C;  5GXQ A;  4WU8 B;  4Z5T A;  5B32 A;  4H9S C;  3UTB A;  5AVC A;  1WWI A;  1Q9C A;  1P3I C;  3LJA C;  2NZD A;  3LEL C;  3REI A;  5G49 A;  3UTA C;  4YS3 C;  5AV5 A;  3AZF C;  5FUG A;  1F66 A;  5B32 D;  3X1V B;  1P3M A;  3UTB D;  5AVC D;  4R8P A;  2ARO B;  2F8N A;  3V9R A;  4JJN B;  3MGR A;  5DNM C;  5BO0 B;  4J8U A;  1P3A D;  1KX4 B;  3REI D;  4YM6 C;  4ZBJ B;  1AOI D;  3LZ1 C;  4QLC A;  5AVB D;  3REK A;  3X1S A;  1TZY C;  3KUY D;  3X1U C;  5GT3 A;  4XZQ D;  1P3O A;  1P3M D;  3VH5 A;  1KX5 C;  4R8P D;  4H9O A;  2F8N D;  4J8V A;  4NE5 A;  4UUZ B;  2BYK A;  1JFI B;  1S32 A;  5B0Z C;  4WV4 B;  4X23 D;  4QLC D;  3REK D;  3B6G C;  3MGQ C;  3WTP A;  5GT3 D;  1ULY A;  5B32 B;  3A6N A;  3AV1 C;  3UTB B;  5AVC B;  5AV8 A;  4HGA B;  1P3A B;  3REI B;  5BNX B;  3WAA A;  1AOI B;  3NQU A;  5E5A A;  5B33 D;  3KXB A;  5AVB B;  2L5A A;  2F8N H;  1P3F D;  3KUY B;  3A6N D;  5B0Y C;  2HIO D;  4XZQ B;  3VH6 T;  3REJ A;  1P3M B;  1P3L A;  1M19 A;  5AV8 D;  4R8P B;  3AN2 A;  3KWQ A;  4WZS B;  5AV6 A;  1A7W A;  5B32 G;  3VH5 T;  4KHA A;  4X23 B;  5CPK C;  5E5A D;  4QLC B;  2IO5 C;  3REK B;  3O62 A;  5GT3 B;  3REJ D;  5B2J A;  1M19 D;  4DRA A;  3REL C;  4H9O B;  4EO5 C;  5AV6 D;  2BYK B;  3AYW A;  3MNN A;  3AZI A;  1N1J A;  1P3K A;  3W99 A;  5GXQ C;  5B33 B;  4Z5T C;  1P3F B;  5B32 C;  3LZ0 B;  2HIO B;  3A6N B;  3UTB C;  5AVC C;  3LJA D;  5AV8 B;  5CPI A;  5BNV B;  4WNN B;  3X1T A;  3UTA D;  2NZD C;  3AYW D;  3REI C;  5GSU A;  3AZI D;  1P3K D;  3X1U A;  5AV5 C;  5E5A B;  1R4V A;  1BH8 A;  1F66 C;  4KUD A;  1P3M C;  3REJ B;  4R8P C;  5BT1 C;  1M19 B;  4YM6 D;  3LZ1 D;  3MGR C;  4J8U C;  5AV6 B;  5CP6 A;  4G91 C;  1TZY D;  3WKJ A;  3X1U D;  4KHA B;  4QLC C;  3REK C;  3X1S C;  1KX5 D;  4KUD D;  5B24 A;  1P3O C;  2FJ7 A;  5B0Z D;  3LJA B;  4J8V C;  1S32 C;  3UTA B;  5CP6 D;  1TAF A;  3B6G D;  2HUE C;  3MGQ D;  3AZI B;  1KX3 A;  1P3K B;  3AV1 D;  1BH9 A;  5BS7 A;  3WTP C;  3A6N C;  5AV8 C;  4YM6 B;  4H9R A;  3LZ1 B;  3WAA C;  1KX3 D;  4H9N B;  1TZY B;  3X1U B;  5E5A C;  3KXB C;  1BFM A;  5B0Y D;  3AZH A;  1KX5 B;  4KUD B;  3REJ C;  1P3L C;  1M19 C;  5B1M A;  3AN2 C;  5B0Z B;  3KWQ C;  5AV6 C;  4H9Q A;  5CPK D;  3AZK A;  5CP6 B;  3B6G B;  3MGQ B;  3AV1 B;  4CAY A;  3O62 C;  3REL D;  5B2J C;  2NQB A;  5B1M D;  5CPJ A;  4Z2M H;  5GXQ D;  3AYW C;  3MNN C;  3AZJ A;  3AZI C;  5AV9 A;  3W99 C;  1P3K C;  4Z5T D;  1KX3 B;  1U35 A;  4DRB A;  5B0Y B;  1HQ3 A;  3REH A;  1P3B A;  3MGS A;  4NE6 A;  3VH6 W;  2NQB D;  2NZD D;  5CPI C;  2YFV B;  3X1T C;  5AV5 D;  5CPK B;  5GSU C;  3AZJ D;  2IO5 B;  5AY8 A;  1F66 D;  3R45 A;  2BYM B;  5BT1 D;  4KUD C;  3REL B;  3MGS D;  4EO5 B;  3MGR D;  4J8U D;  5B1M B;  4J8X A;  4Z2M G;  5CP6 C;  5GXQ B;  3X1S D;  3WKJ C;  5C3I C;  4M6B A;  4Z5T B;  5B2I A;  4AWL C;  1P3O D;  3AV2 A;  1KU5 A;  5B24 C;  2FJ7 C;  4J8V D;  1S32 D;  2NQB B;  2NZD B;  3B0C T;  1H3O A;  5G49 B;  3WTP E;  5AV5 B;  5FUG B;  3AZJ B;  1KX3 C;  3WTP D;  3MVD A;  1F66 B;  5B31 A;  1ID3 A;  5BS7 C;  5B2I D;  3WA9 A;  3AFA A;  2F8N B;  2YFW A;  3V9R B;  3MGS B;  3MGR B;  4J8U B;  3MGP A;  1P34 A;  3TU4 A;  3WAA D;  4G91 B;  3KXB D;  3X1S B;  4Z66 A;  5F99 A;  3AZH C;  1P3L D;  1P3O B;  3AN2 D;  3KWQ D;  4J8V B;  5B1M C;  3MGP D;  4J8W A;  1S32 B;  3NQJ A;  1P3P A;  2HUE B;  3C1C A;  3AZK C;  5B1L A;  2F8N G;  3O62 D;  3WTP B;  5B2I B;  5B2J D;  2NQB C;  4J8W D;  5CPJ C;  3MNN D;  1P3P D;  5GT0 A;  3C1C D;  3W99 D;  3WAA B;  3NQU B;  3KXB B;  3AZJ C;  5AV9 C;  1U35 C;  2CV5 A;  1HQ3 C;  1P3L B;  3REH C;  3AZN C;  5CPI D;  3AN2 B;  1P3B C;  1M1A A;  3KWQ B;  3X1T D;  3MGS C;  2YFW B;  3W96 A;  1M18 A;  3AZM A;  3MGP B;  5GSU D;  2JSS A;  4XUJ A;  3KSY A;  5AY8 C;  2PYO A;  3UT9 A;  3O62 B;  5B2J B;  4NFT A;  1WWS A;  4J8W B;  3AYW B;  4J8X C;  3MNN B;  1P3P B;  3WKJ D;  3C1C B;  1N1J B;  3C1B A;  3W99 B;  4XUJ D;  1EQZ A;  2PYO D;  4ZUX A;  3W98 A;  3UT9 D;  5B24 D;  5B2I C;  5DNN A;  2FJ7 D;  3AV2 C;  3W97 A;  5CPI B;  4WU8 A;  3X1T B;  5B40 A;  4CSR A;  5GSU B;  1EQZ D;  4H9P A;  3MVD C;  1BH8 B;  5B31 C;  1ID3 C;  3WA9 C;  5DNN D;  3W97 D;  3AFA C;  5B40 D;  1P34 C;  3MGP C;  3TU4 C;  3WKJ B;  2ARO A;  5C3I B;  4AWL B;  3AZH D;  4JJN A;  1KX4 A;  5BO0 A;  3AZG C;  2PYO B;  5B24 B;  4Z66 C;  5F99 C;  2FJ7 B;  4J8W C;  3AZK D;  1TAF B;  1P3P C;  3C1C C;  4KGC A;  1BH9 B;  5B1L C;  1EQZ B;  4UUZ A;  3AZN A;  5DNN B;  5CPJ D;  3W97 B;  4H9R B;  5B40 B;  4CSR B;  4LD9 A;  5GT0 C;  5JA4 A;  5AV9 D;  3VH5 W;  4KGC D;  1U35 D;  1HTA A;  4WU9 C;  1HQ3 D;  3AZH B;  3REH D;  4H9P B;  3AZN D;  1P3A A;  1P3B D;  5BNX A;  2CV5 C;  1AOI A;  5AVB A;  1M1A C;  3KUY A;  3W96 C;  1M18 C;  4H9Q B;  3AZM C;  3AZK B;  4XZQ A;  4LD9 D;  5AY8 D;  4XUJ C;  2PYO C;  4CAY B;  3UT9 C;  3VH6 A;  4X23 A;  5CPJ B;  4J8X D;  5AV9 B;  3C1B C;  5JRG A;  4KGC B;  1P3G A;  1U35 B;  3AV2 D;  4ZUX C;  1HQ3 B; 
#chains in the Genus database with same CATH topology
 3REH B;  3AZN B;  5DNN C;  3B6F A;  1P3B B;  3W97 C;  1EQZ C;  5B33 A;  4WU8 C;  5B40 C;  1P3F A;  3LZ0 A;  2HIO A;  4LD9 B;  5AY8 B;  5JA4 B;  3MVD D;  3R45 B;  5JRG D;  5B31 D;  3AZG A;  1P3G D;  5BNV A;  1ID3 D;  3AZL A;  3W98 C;  4WNN A;  3WA9 D;  1ZLA A;  3AFA D;  3B6F D;  1P34 D;  3TU4 D;  4J8X B;  3X1V C;  2W8S A;  3LZ0 D;  3AZG D;  2ARO C;  3AZE A;  3B0B A;  4Z66 D;  2RVQ D;  5F99 D;  4JJN C;  3AZL D;  3AV2 B;  2CWE A;  1KX4 C;  1ZLA D;  4G92 B;  4ZBJ C;  4H9S A;  1H3O B;  5B1L D;  4WU9 A;  1B67 A;  1P3I A;  4KGC C;  3LJA A;  3MVD B;  5JRG B;  5B31 B;  3LEL A;  3AZE D;  1P3G B;  1ID3 B;  3WA9 B;  3UTA A;  3AZF A;  4YS3 A;  3AFA B;  3B6F B;  4NE3 A;  5KDM A;  1P34 B;  3TU4 B;  5GT0 D;  2XD5 A;  4LD9 C;  4WU9 D;  2Y2N A;  1P3I D;  5DNM A;  3AZG B;  3LEL D;  4E45 A;  3B0D B;  4YM6 A;  3AZL B;  4Z66 B;  4HGA C;  5F99 B;  3LZ1 A;  3AZF D;  4YS3 D;  2CV5 D;  1P3A C;  1ZLA B;  1M1A D;  4H9N A;  1TZY A;  1M18 D;  1AOI C;  3W96 D;  2Y2Q A;  5B31 G;  5AVB C;  3AZM D;  3NQJ B;  1W2E A;  1KX5 A;  2BG1 A;  3KUY C;  1T3U A;  3F6T A;  4XZQ C;  5B1L B;  4E44 A;  5DNM D;  5B0Z A;  3AZE B;  4G92 C;  3B6G A;  3KFU G;  5CHL B;  3MGQ A;  4X23 C;  3AV1 A;  5GT0 B;  3C1B D;  5GT3 C;  2F8N K;  4ZUX D;  4WU9 B;  1F1E A;  3W98 D;  5JRG C;  1P3I B;  1P3G C;  3LEL B;  2CV5 B;  3AZF B;  2G5I C;  4YS3 B;  3B6F C;  1M1A B;  4WU8 D;  5KDM B;  1M18 B;  3X1V A;  5B33 C;  3W96 B;  3AZM B;  5B0Y A;  1P3F C;  3LZ0 C;  2HIO C;  4XUJ B;  3UT9 B;  5DNM B;  3B0D C;  2YFV A;  3AZL C;  2RVQ C;  1ZLA C;  5CPK A;  4DQY B;  2BYM A;  3X1V D;  1B6W A;  2ZM5 A;  3B0C W;  3C1B B;  2ARO D;  2LY8 A;  3REL A;  4JJN D;  1KX4 D;  1JFI A;  4ZUX B;  3W98 B;  3AZE C;  5GXQ A;  4WU8 B;  4Z5T A;  5B32 A;  4H9S C;  3UTB A;  5AVC A;  1WWI A;  1Q9C A;  3AL0 C;  1P3I C;  3LJA C;  2NZD A;  3LEL C;  3REI A;  5G49 A;  3UTA C;  4YS3 C;  5AV5 A;  3AZF C;  5FUG A;  1F66 A;  5B32 D;  3X1V B;  1P3M A;  3UTB D;  3EPJ A;  5AVC D;  1Z2C B;  2XD1 A;  4R8P A;  2JE5 A;  2ARO B;  2G5H C;  2F8N A;  2DQN C;  3V9R A;  3MGR A;  5DNM C;  5BO0 B;  4J8U A;  4JJN B;  1P3A D;  1KX4 B;  3REI D;  4YM6 C;  4ZBJ B;  1AOI D;  3LZ1 C;  4QLC A;  5AVB D;  3REK A;  3X1S A;  3EPK A;  1TZY C;  3KUY D;  3X1U C;  5GT3 A;  4XZQ D;  1P3O A;  1P3M D;  3VH5 A;  2Y2O A;  1KX5 C;  4R8P D;  4H9O A;  2F8N D;  4J8V A;  4NE5 A;  4UUZ B;  2BYK A;  1JFI B;  1S32 A;  5B0Z C;  4WV4 B;  2ZY4 A;  4X23 D;  4QLC D;  3REK D;  3B6G C;  3MGQ C;  3WTP A;  5GT3 D;  1ULY A;  5B32 B;  3A6N A;  3AV1 C;  3UTB B;  5AVC B;  5AV8 A;  4HGA B;  1P3A B;  3REI B;  5BNX B;  3WAA A;  1AOI B;  3NQU A;  5E5A A;  5B33 D;  3KXB A;  5AVB B;  2L5A A;  2F8N H;  1P3F D;  2F2A C;  3KUY B;  3A6N D;  5B0Y C;  2HIO D;  4XZQ B;  3VH6 T;  3REJ A;  1P3M B;  1P3L A;  1M19 A;  5AV8 D;  4R8P B;  3AN2 A;  2Y2K A;  3KWQ A;  4WZS B;  5AV6 A;  1A7W A;  5B32 G;  3VH5 T;  4KHA A;  4X23 B;  5CPK C;  5E5A D;  3FDD A;  2IO5 C;  4QLC B;  3REK B;  3O62 A;  5GT3 B;  3REJ D;  5B2J A;  1M19 D;  4DRA A;  2Y2J A;  3REL C;  4H9O B;  4EO5 C;  5AV6 D;  2BYK B;  3AYW A;  3MNN A;  3AZI A;  1N1J A;  1P3K A;  3W99 A;  5GXQ C;  5B33 B;  4Z5T C;  1P3F B;  5B32 C;  3LZ0 B;  2HIO B;  3A6N B;  3UTB C;  2ZY5 A;  5AVC C;  3LJA D;  5AV8 B;  5CPI A;  5BNV B;  4WNN B;  3X1T A;  3UTA D;  2NZD C;  3AYW D;  3REI C;  5GSU A;  3AZI D;  1P3K D;  3X1U A;  5AV5 C;  5E5A B;  1R4V A;  1BH8 A;  1F66 C;  4KUD A;  1P3M C;  3REJ B;  4R8P C;  5BT1 C;  1M19 B;  4YM6 D;  3LZ1 D;  3MGR C;  4J8U C;  2Y2M A;  5CP6 A;  5AV6 B;  4G91 C;  1TZY D;  3WKJ A;  3X1U D;  4KHA B;  4QLC C;  3REK C;  3X1S C;  3IP4 C;  1KX5 D;  4KUD D;  5B24 A;  3P5J B;  2J8P A;  1P3O C;  2FJ7 A;  5B0Z D;  3LJA B;  4J8V C;  1S32 C;  3UTA B;  5CP6 D;  1TAF A;  3B6G D;  2HUE C;  2Y2P A;  3MGQ D;  3AZI B;  1KX3 A;  1P3K B;  3AV1 D;  1BH9 A;  5BS7 A;  3WTP C;  3EPH A;  3A6N C;  3H0L C;  5AV8 C;  2UWX A;  4YM6 B;  4H9R A;  3LZ1 B;  2Y2L A;  3WAA C;  1KX3 D;  4H9N B;  1TZY B;  3X1U B;  5E5A C;  3KXB C;  1BFM A;  5B0Y D;  3AZH A;  1KX5 B;  4KUD B;  3REJ C;  1P3L C;  1M19 C;  5B1M A;  3AN2 C;  5B0Z B;  3KWQ C;  5AV6 C;  4H9Q A;  5CPK D;  3AZK A;  5CP6 B;  3B6G B;  3MGQ B;  3AV1 B;  4CAY A;  3O62 C;  3REL D;  2JCH A;  5B2J C;  2NQB A;  5B1M D;  5CPJ A;  4Z2M H;  2Y2G A;  5GXQ D;  3AYW C;  3MNN C;  3AZJ A;  3AZI C;  5AV9 A;  3W99 C;  1P3K C;  4Z5T D;  1KX3 B;  1U35 A;  4DRB A;  5B0Y B;  1HQ3 A;  3REH A;  1P3B A;  3MGS A;  4NE6 A;  3VH6 W;  2NQB D;  2NZD D;  5CPI C;  2YFV B;  3X1T C;  5AV5 D;  3EG5 B;  2Y2H A;  5CPK B;  5GSU C;  3AZJ D;  2IO5 B;  5AY8 A;  1F66 D;  3R45 A;  2BYM B;  5BT1 D;  4KUD C;  3REL B;  3MGS D;  4EO5 B;  3MGR D;  4J8U D;  5B1M B;  4J8X A;  4Z2M G;  5CP6 C;  5GXQ B;  3X1S D;  3WKJ C;  5C3I C;  4M6B A;  4Z5T B;  5B2I A;  4AWL C;  1P3O D;  3AV2 A;  1KU5 A;  5B24 C;  2FJ7 C;  4J8V D;  1S32 D;  2NQB B;  2NZD B;  3B0C T;  1H3O A;  5G49 B;  3WTP E;  5AV5 B;  5FUG B;  3AZJ B;  1KX3 C;  3WTP D;  3MVD A;  1F66 B;  5B31 A;  1ID3 A;  5BS7 C;  5B2I D;  3WA9 A;  3AFA A;  2F8N B;  3A1I A;  2YFW A;  3V9R B;  3MGS B;  3MGR B;  4J8U B;  3MGP A;  1P34 A;  3TU4 A;  3WAA D;  4G91 B;  3KXB D;  3X1S B;  4Z66 A;  5F99 A;  3AZH C;  1P3L D;  1P3O B;  4WJ3 C;  2FFF B;  3AN2 D;  3KWQ D;  4J8V B;  5B1M C;  3MGP D;  4J8W A;  1S32 B;  3NQJ A;  1P3P A;  2HUE B;  3C1C A;  3AZK C;  3H0M C;  5B1L A;  2F8N G;  3O62 D;  3WTP B;  5B2I B;  3A1K A;  5B2J D;  2NQB C;  4J8W D;  5CPJ C;  3MNN D;  1P3P D;  5GT0 A;  3C1C D;  3W99 D;  3WAA B;  3NQU B;  3KXB B;  3AZJ C;  5AV9 C;  1U35 C;  2VQR A;  2Y2I A;  2CV5 A;  1HQ3 C;  1P3L B;  3REH C;  3AZN C;  5CPI D;  3AN2 B;  1P3B C;  1M1A A;  3KWQ B;  3X1T D;  3MGS C;  2YFW B;  3W96 A;  1M18 A;  3AZM A;  3MGP B;  5GSU D;  2JSS A;  4XUJ A;  3KSY A;  5AY8 C;  2PYO A;  3UT9 A;  3O62 B;  5B2J B;  4NFT A;  3EPL A;  1WWS A;  4J8W B;  3AYW B;  4J8X C;  3MNN B;  1P3P B;  3WKJ D;  3C1C B;  1N1J B;  3C1B A;  3W99 B;  4XUJ D;  2RIQ A;  1EQZ A;  2PYO D;  4ZUX A;  3W98 A;  3UT9 D;  5B24 D;  5B2I C;  5DNN A;  2FJ7 D;  3AV2 C;  3W97 A;  1PZR A;  5CPI B;  4WU8 A;  3X1T B;  5B40 A;  4CSR A;  5GSU B;  1EQZ D;  4H9P A;  3MVD C;  1BH8 B;  5B31 C;  1ID3 C;  3WA9 C;  5DNN D;  3W97 D;  3AFA C;  5B40 D;  1P34 C;  3MGP C;  3TU4 C;  3WKJ B;  2ARO A;  5C3I B;  4AWL B;  3AZH D;  4JJN A;  1KX4 A;  5BO0 A;  3AZG C;  2PYO B;  5B24 B;  4Z66 C;  5F99 C;  2FJ7 B;  4J8W C;  3AZK D;  1TAF B;  1P3P C;  3C1C C;  4KGC A;  1BH9 B;  5B1L C;  1EQZ B;  4UUZ A;  3AZN A;  2ZY3 A;  5DNN B;  5CPJ D;  3W97 B;  4H9R B;  5B40 B;  4CSR B;  4LD9 A;  5GT0 C;  5JA4 A;  5AV9 D;  3VH5 W;  4KGC D;  1U35 D;  1HTA A;  4WU9 C;  1HQ3 D;  3AZH B;  3REH D;  4H9P B;  3AZN D;  1P3A A;  1P3B D;  3H0R C;  5BNX A;  2CV5 C;  1AOI A;  5AVB A;  1M1A C;  3KUY A;  3W96 C;  1M18 C;  4H9Q B;  3AZM C;  3AZK B;  2DF4 C;  4XZQ A;  4LD9 D;  5AY8 D;  4XUJ C;  4UPK A;  2PYO C;  4CAY B;  3UT9 C;  3VH6 A;  4X23 A;  5CPJ B;  4J8X D;  2ZY2 A;  5AV9 B;  3C1B C;  5JRG A;  4KGC B;  1P3G A;  1U35 B;  3AV2 D;  4ZUX C;  1HQ3 B; 
#chains in the Genus database with same CATH homology
 3REH B;  3AZN B;  5DNN C;  3B6F A;  1P3B B;  3W97 C;  1EQZ C;  5B33 A;  4WU8 C;  5B40 C;  1P3F A;  3LZ0 A;  2HIO A;  4LD9 B;  5AY8 B;  5JA4 B;  3MVD D;  3R45 B;  5JRG D;  5B31 D;  3AZG A;  1P3G D;  5BNV A;  1ID3 D;  3AZL A;  3W98 C;  4WNN A;  3WA9 D;  1ZLA A;  3AFA D;  3B6F D;  1P34 D;  3TU4 D;  4J8X B;  3X1V C;  2W8S A;  3LZ0 D;  3AZG D;  2ARO C;  3AZE A;  3B0B A;  4Z66 D;  2RVQ D;  5F99 D;  4JJN C;  3AZL D;  3AV2 B;  2CWE A;  1KX4 C;  1ZLA D;  4G92 B;  4ZBJ C;  4H9S A;  1H3O B;  5B1L D;  4WU9 A;  1B67 A;  1P3I A;  4KGC C;  3LJA A;  3MVD B;  5JRG B;  5B31 B;  3LEL A;  3AZE D;  1P3G B;  1ID3 B;  3WA9 B;  3UTA A;  3AZF A;  4YS3 A;  3AFA B;  3B6F B;  4NE3 A;  5KDM A;  1P34 B;  3TU4 B;  5GT0 D;  2XD5 A;  4LD9 C;  4WU9 D;  2Y2N A;  1P3I D;  5DNM A;  3AZG B;  3LEL D;  4E45 A;  3B0D B;  4YM6 A;  3AZL B;  4Z66 B;  4HGA C;  5F99 B;  3LZ1 A;  3AZF D;  4YS3 D;  2CV5 D;  1P3A C;  1ZLA B;  1M1A D;  4H9N A;  1TZY A;  1M18 D;  1AOI C;  3W96 D;  2Y2Q A;  5B31 G;  5AVB C;  3AZM D;  3NQJ B;  1W2E A;  1KX5 A;  2BG1 A;  3KUY C;  1T3U A;  3F6T A;  4XZQ C;  5B1L B;  4E44 A;  5DNM D;  5B0Z A;  3AZE B;  4G92 C;  3B6G A;  3KFU G;  5CHL B;  3MGQ A;  4X23 C;  3AV1 A;  5GT0 B;  3C1B D;  5GT3 C;  2F8N K;  4ZUX D;  4WU9 B;  1F1E A;  3W98 D;  5JRG C;  1P3I B;  1P3G C;  3LEL B;  2CV5 B;  3AZF B;  2G5I C;  4YS3 B;  3B6F C;  1M1A B;  4WU8 D;  5KDM B;  1M18 B;  3X1V A;  5B33 C;  3W96 B;  3AZM B;  5B0Y A;  1P3F C;  3LZ0 C;  2HIO C;  4XUJ B;  3UT9 B;  5DNM B;  3B0D C;  2YFV A;  3AZL C;  2RVQ C;  1ZLA C;  5CPK A;  4DQY B;  2BYM A;  3X1V D;  1B6W A;  2ZM5 A;  3B0C W;  3C1B B;  2ARO D;  2LY8 A;  3REL A;  4JJN D;  1KX4 D;  1JFI A;  4ZUX B;  3W98 B;  3AZE C;  5GXQ A;  4WU8 B;  4Z5T A;  5B32 A;  4H9S C;  3UTB A;  5AVC A;  1WWI A;  1Q9C A;  3AL0 C;  1P3I C;  3LJA C;  2NZD A;  3LEL C;  3REI A;  5G49 A;  3UTA C;  4YS3 C;  5AV5 A;  3AZF C;  5FUG A;  1F66 A;  5B32 D;  3X1V B;  1P3M A;  3UTB D;  3EPJ A;  5AVC D;  1Z2C B;  2XD1 A;  4R8P A;  2JE5 A;  2ARO B;  2G5H C;  2F8N A;  2DQN C;  3V9R A;  3MGR A;  5DNM C;  5BO0 B;  4J8U A;  4JJN B;  1P3A D;  1KX4 B;  3REI D;  4YM6 C;  4ZBJ B;  1AOI D;  3LZ1 C;  4QLC A;  5AVB D;  3REK A;  3X1S A;  3EPK A;  1TZY C;  3KUY D;  3X1U C;  5GT3 A;  4XZQ D;  1P3O A;  1P3M D;  3VH5 A;  2Y2O A;  1KX5 C;  4R8P D;  4H9O A;  2F8N D;  4J8V A;  4NE5 A;  4UUZ B;  2BYK A;  1JFI B;  1S32 A;  5B0Z C;  4WV4 B;  2ZY4 A;  4X23 D;  4QLC D;  3REK D;  3B6G C;  3MGQ C;  3WTP A;  5GT3 D;  1ULY A;  5B32 B;  3A6N A;  3AV1 C;  3UTB B;  5AVC B;  5AV8 A;  4HGA B;  1P3A B;  3REI B;  5BNX B;  3WAA A;  1AOI B;  3NQU A;  5E5A A;  5B33 D;  3KXB A;  5AVB B;  2L5A A;  2F8N H;  1P3F D;  2F2A C;  3KUY B;  3A6N D;  5B0Y C;  2HIO D;  4XZQ B;  3VH6 T;  3REJ A;  1P3M B;  1P3L A;  1M19 A;  5AV8 D;  4R8P B;  3AN2 A;  2Y2K A;  3KWQ A;  4WZS B;  5AV6 A;  1A7W A;  5B32 G;  3VH5 T;  4KHA A;  4X23 B;  5CPK C;  5E5A D;  3FDD A;  2IO5 C;  4QLC B;  3REK B;  3O62 A;  5GT3 B;  3REJ D;  5B2J A;  1M19 D;  4DRA A;  2Y2J A;  3REL C;  4H9O B;  4EO5 C;  5AV6 D;  2BYK B;  3AYW A;  3MNN A;  3AZI A;  1N1J A;  1P3K A;  3W99 A;  5GXQ C;  5B33 B;  4Z5T C;  1P3F B;  5B32 C;  3LZ0 B;  2HIO B;  3A6N B;  3UTB C;  2ZY5 A;  5AVC C;  3LJA D;  5AV8 B;  5CPI A;  5BNV B;  4WNN B;  3X1T A;  3UTA D;  2NZD C;  3AYW D;  3REI C;  5GSU A;  3AZI D;  1P3K D;  3X1U A;  5AV5 C;  5E5A B;  1R4V A;  1BH8 A;  1F66 C;  4KUD A;  1P3M C;  3REJ B;  4R8P C;  5BT1 C;  1M19 B;  4YM6 D;  3LZ1 D;  3MGR C;  4J8U C;  2Y2M A;  5CP6 A;  5AV6 B;  4G91 C;  1TZY D;  3WKJ A;  3X1U D;  4KHA B;  4QLC C;  3REK C;  3X1S C;  3IP4 C;  1KX5 D;  4KUD D;  5B24 A;  3P5J B;  2J8P A;  1P3O C;  2FJ7 A;  5B0Z D;  3LJA B;  4J8V C;  1S32 C;  3UTA B;  5CP6 D;  1TAF A;  3B6G D;  2HUE C;  2Y2P A;  3MGQ D;  3AZI B;  1KX3 A;  1P3K B;  3AV1 D;  1BH9 A;  5BS7 A;  3WTP C;  3EPH A;  3A6N C;  3H0L C;  5AV8 C;  2UWX A;  4YM6 B;  4H9R A;  3LZ1 B;  2Y2L A;  3WAA C;  1KX3 D;  4H9N B;  1TZY B;  3X1U B;  5E5A C;  3KXB C;  1BFM A;  5B0Y D;  3AZH A;  1KX5 B;  4KUD B;  3REJ C;  1P3L C;  1M19 C;  5B1M A;  3AN2 C;  5B0Z B;  3KWQ C;  5AV6 C;  4H9Q A;  5CPK D;  3AZK A;  5CP6 B;  3B6G B;  3MGQ B;  3AV1 B;  4CAY A;  3O62 C;  3REL D;  2JCH A;  5B2J C;  2NQB A;  5B1M D;  5CPJ A;  4Z2M H;  2Y2G A;  5GXQ D;  3AYW C;  3MNN C;  3AZJ A;  3AZI C;  5AV9 A;  3W99 C;  1P3K C;  4Z5T D;  1KX3 B;  1U35 A;  4DRB A;  5B0Y B;  1HQ3 A;  3REH A;  1P3B A;  3MGS A;  4NE6 A;  3VH6 W;  2NQB D;  2NZD D;  5CPI C;  2YFV B;  3X1T C;  5AV5 D;  3EG5 B;  2Y2H A;  5CPK B;  5GSU C;  3AZJ D;  2IO5 B;  5AY8 A;  1F66 D;  3R45 A;  2BYM B;  5BT1 D;  4KUD C;  3REL B;  3MGS D;  4EO5 B;  3MGR D;  4J8U D;  5B1M B;  4J8X A;  4Z2M G;  5CP6 C;  5GXQ B;  3X1S D;  3WKJ C;  5C3I C;  4M6B A;  4Z5T B;  5B2I A;  4AWL C;  1P3O D;  3AV2 A;  1KU5 A;  5B24 C;  2FJ7 C;  4J8V D;  1S32 D;  2NQB B;  2NZD B;  3B0C T;  1H3O A;  5G49 B;  3WTP E;  5AV5 B;  5FUG B;  3AZJ B;  1KX3 C;  3WTP D;  3MVD A;  1F66 B;  5B31 A;  1ID3 A;  5BS7 C;  5B2I D;  3WA9 A;  3AFA A;  2F8N B;  3A1I A;  2YFW A;  3V9R B;  3MGS B;  3MGR B;  4J8U B;  3MGP A;  1P34 A;  3TU4 A;  3WAA D;  4G91 B;  3KXB D;  3X1S B;  4Z66 A;  5F99 A;  3AZH C;  1P3L D;  1P3O B;  4WJ3 C;  2FFF B;  3AN2 D;  3KWQ D;  4J8V B;  5B1M C;  3MGP D;  4J8W A;  1S32 B;  3NQJ A;  1P3P A;  2HUE B;  3C1C A;  3AZK C;  3H0M C;  5B1L A;  2F8N G;  3O62 D;  3WTP B;  5B2I B;  3A1K A;  5B2J D;  2NQB C;  4J8W D;  5CPJ C;  3MNN D;  1P3P D;  5GT0 A;  3C1C D;  3W99 D;  3WAA B;  3NQU B;  3KXB B;  3AZJ C;  5AV9 C;  1U35 C;  2VQR A;  2Y2I A;  2CV5 A;  1HQ3 C;  1P3L B;  3REH C;  3AZN C;  5CPI D;  3AN2 B;  1P3B C;  1M1A A;  3KWQ B;  3X1T D;  3MGS C;  2YFW B;  3W96 A;  1M18 A;  3AZM A;  3MGP B;  5GSU D;  2JSS A;  4XUJ A;  3KSY A;  5AY8 C;  2PYO A;  3UT9 A;  3O62 B;  5B2J B;  4NFT A;  3EPL A;  1WWS A;  4J8W B;  3AYW B;  4J8X C;  3MNN B;  1P3P B;  3WKJ D;  3C1C B;  1N1J B;  3C1B A;  3W99 B;  4XUJ D;  2RIQ A;  1EQZ A;  2PYO D;  4ZUX A;  3W98 A;  3UT9 D;  5B24 D;  5B2I C;  5DNN A;  2FJ7 D;  3AV2 C;  3W97 A;  1PZR A;  5CPI B;  4WU8 A;  3X1T B;  5B40 A;  4CSR A;  5GSU B;  1EQZ D;  4H9P A;  3MVD C;  1BH8 B;  5B31 C;  1ID3 C;  3WA9 C;  5DNN D;  3W97 D;  3AFA C;  5B40 D;  1P34 C;  3MGP C;  3TU4 C;  3WKJ B;  2ARO A;  5C3I B;  4AWL B;  3AZH D;  4JJN A;  1KX4 A;  5BO0 A;  3AZG C;  2PYO B;  5B24 B;  4Z66 C;  5F99 C;  2FJ7 B;  4J8W C;  3AZK D;  1TAF B;  1P3P C;  3C1C C;  4KGC A;  1BH9 B;  5B1L C;  1EQZ B;  4UUZ A;  3AZN A;  2ZY3 A;  5DNN B;  5CPJ D;  3W97 B;  4H9R B;  5B40 B;  4CSR B;  4LD9 A;  5GT0 C;  5JA4 A;  5AV9 D;  3VH5 W;  4KGC D;  1U35 D;  1HTA A;  4WU9 C;  1HQ3 D;  3AZH B;  3REH D;  4H9P B;  3AZN D;  1P3A A;  1P3B D;  3H0R C;  5BNX A;  2CV5 C;  1AOI A;  5AVB A;  1M1A C;  3KUY A;  3W96 C;  1M18 C;  4H9Q B;  3AZM C;  3AZK B;  2DF4 C;  4XZQ A;  4LD9 D;  5AY8 D;  4XUJ C;  4UPK A;  2PYO C;  4CAY B;  3UT9 C;  3VH6 A;  4X23 A;  5CPJ B;  4J8X D;  2ZY2 A;  5AV9 B;  3C1B C;  5JRG A;  4KGC B;  1P3G A;  1U35 B;  3AV2 D;  4ZUX C;  1HQ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...