5B24A

The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Crystal structure of the nucleosome containing ultraviolet light-induced cyclobutane pyrimidine dimer
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b24A00
3LJAA 4X23A 3LZ0A 3WA9A 3B6FD 4J8WB 3UTBB 5G49B 4Z5TC 1KU5A 3C1CA 4J8UC 3UTAB 3B6GA 5KDMB 4Z66C 5E5AB 4KHAB 4H9SC 4Z5TD 4LD9A 4J8UD 4Z66D 4NE6A 3LJAB 4WU9A 4X23B 3LZ0B 1P3KA 4ZUXA 4J8XC 3WA9B 1S32C 3REHB 3C1CB 4KGCA 3REKA 4J8XD 4YS3A 4QLCC 1S32D 3REJB 3AYWA 3B6GB 3MGRA 2CWEA 3RELA 3AN2C 3B0CW 4LD9B 3AN2D 5BT1D 1ULYA 1KX5B 2PYOB 5BO0A 1BH9A 1P3PA 4WU9B 1R4VA 4ZUXB 1P3FC 1P34B 1P3AB 4JJNC 4NE3A 4E44A 4M6BA 4Z2MG 4KGCB 3REKB 3W98B 1P3FD 4YS3B 5B2JC 5DNNC 3KSYA 1M18C 3AYWB 5CPIC 3MGRB 3AZMC 3RELB 3VH6A 5AY8B 3MGQA 5B2JD 5DNND 1M18D 1AOIB 3AZMD 5CPID 4H9QA 1KX3C 1P3MA 1P3OB 3REIB 3MVDC 4YM6A 3AZGA 1P3GC 5B0YC 3KUYA 2NQBC 1KX3D 4XZQB 4NFTA 3X1VC 3MVDD 4H9OA 5AV6B 3AZFA 1P3GD 5B0YD 2NQBD 1TAFA 3W97A 3X1VD 3AZJA 1EQZC 3UT9C 1BFMA 2AROA 3LZ1A 3WAAC 4EO5B 4R8PA 1EQZD 4H9QB 3UT9D 3WTPA 5B1MB 3A6NA 3WAAD 3LELA 3AZHC 4YM6B 1F66A 5CP6B 3NQJA 5B2IA 3AZNC 5B33A 5B40D 5JRGC 3AFAA 3AZHD 3O62C 1TAFB 5AV8A 3AZND 3AV1C 5AV5C 3AV2C 3W97B 3W96B 1HQ3A 2YFWA 5JRGD 3KXBA 5AVCB 4J8VA 3O62D 3AV1D 3AV2D 2RVQC 1P3LB 5B0ZA 3C1BC 2HIOA 2FJ7B 4CAYA 1KX4A 1U35B 3WTPB 3A6NB 3AZKD 2RVQD 3C1BD 2YFVA 1F66B 3NQJB 5B2IB 4UUZA 5B33B 5FUGB 3VH5T 2IO5C 4WNNA 5GXQB 5GT3C 3V9RA 2YFWB 4J8VB 5GT0C 1ZLAA 5GT3D 5CPJB 1TZYC 5B0ZB 2HIOB 1P3BA 4CAYB 5GT0D 4AWLB 3B0DC 1TZYD 5B24A 3B0CT 3MGPC 4J8WA 3UTBA 5AV9B 3X1TB 5DNMA 4WNNB 3MGPD 3UTAA 5GSUB 1Q9CA 5E5AA 4KHAA 3V9RB 3B6GD 3WKJA 1M19B 1N1JA 1ZLAB 2NZDA 1P3BB 1P3KC 5B24B 1P3KD 2BYKA 3REHA 3AZLC 5AVBB 4KUDA 5DNMB 3REJA 4KGCD 3AZLD 1ID3A 3WKJB 4HGAB 3W99B 1N1JB 2F8ND 2NZDB 5C3IC 4DRBA 3AZEB 1P3PC 1KX5A 2PYOA 3X1SA 1P34A 1P3AA 1P3PD 2BYKB 5B32B 2CV5A 4KUDB 4E45A 3W98A 4G92C 5JA4A 3MGQC 3AZIC 4WU8A 1ID3B 5AY8A 4CSRB 5BT1C 1P3MC 3MGQD 1AOIA 5B32G 3AZID 3AZGC 3X1UB 3MGSA 3REIA 3KUYC 1P3OA 3KWQC 1P3MD 3VH6W 4XUJB 4XZQA 3AZGD 3AZFC 3X1SB 1P3IB 3KUYD 3KWQD 5AV6A 2CV5B 3MNNC 3AZJC 2JSSA 3AZFD 5JA4B 2AROC 3LZ1C 4R8PC 4WU8B 3MNND 3AZJD 4H9NA 2AROD 3LZ1D 4Z66A 1H3OA 4R8PD 3LELC 5F99B 5B1MA 3MGSB 4G91B 3WTPD 3A6ND 5CP6A 3LELD 3AFAC 5B2ID 2HUEC 3B6FB 5AV8C 1HQ3C 3KXBC 4NE5A 3AFAD 4ZBJC 3W96A 4J8XA 5AV8D 5AVCA 1HQ3D 3KXBD 4Z5TB 5BS7C 4H9NB 1P3LA 1KX4C 4QLCA 4J8UB 2FJ7A 5B31A 4Z66B 1H3OB 1U35A 1KX4D 5B40C 5CPKC 5B1LC 5FUGA 5CPKD 5B1LD 5GXQA 4J8XB 4JJNA 1S32B 3TU4C 3AZKC 5CPJA 5B2JA 5DNNA 4QLCB 1ZLAD 5B31B 3TU4D 3AN2B 4J8WC 3UTBC 1WWSA 3WTPE 3UTAC 5AV9A 4J8WD 3UTBD 3X1TA 1F1EA 5E5AC 5B0YA 3WKJC 5B31G 5GSUA 3UTAD 1P3FB 4JJNB 5E5AD 1M19A 3WKJD 2F8NH 5B2JB 5DNNB 1M18B 3LJAC 4X23C 3LZ0C 3AZMB 5CPIB 3WA9C 3REHC 3WAAA 3LJAD 4X23D 3LZ0D 3C1CC 3WA9D 5AVBA 3REJC 1M1AA 3REHD 3B6GC 3MVDB 3C1CD 1P3GB 5B0YB 3VH6T 2NQBB 4LD9C 3REJD 3X1VB 5JRGA 3W99A 1WWIA 4LD9D 1KX5C 5AV5A 3AV2A 2PYOC 3AZEA 2LY8A 4WU9C 1EQZB 4ZUXC 3UT9B 1P34C 1P3AC 1KX5D 2PYOD 3WAAB 3C1BA 5B32A 4WU9D 4KGCC 3REKC 4ZUXD 3W98C 3X1SD 4YS3C 1P34D 1P3AD 1BH8A 3AYWC 1M1AB 3MGRC 4H9RB 3RELC 3AZHB 5AY8C 3REKD 1B6WA 3W98D 4YS3D 3AZNB 3AYWD 1AOIC 4CSRA 5JRGB 3MGRD 3RELD 5AY8D 3O62B 1P3OC 3REIC 3AV1B 5AV5B 3AV2B 1AOID 3X1UA 5CHLB 4XZQC 1P3OD 3REID 4XUJA 5AV6C 1P3IA 3C1BB 4XZQD 2L5AA 3B0BA 1BH8B 5AV6D 4WZSB 3MGPA 4EO5C 2IO5B 1B67A 5B1MC 5BNVB 5GT3B 5F99A 5BNXB 4YM6C 5CP6C 3VH5W 5B1MD 5GT0B 1TZYB 4YM6D 5CP6D 3B6FA 3W97C 3W96C 3B0DB 5AVCC 3MGPB 3W97D 1P3LC 3AZLA 3W96D 2BYMA 3VH5A 1HTAA 5AVCD 2FJ7C 4Z5TA 5B31C 1A7WA 1U35C 4J8UA 3WTPC 3A6NC 1P3LD 4QLCD 2F8NA 2FJ7D 1F66C 4H9SA 5B31D 5B2IC 1U35D 5B33C 1F66D 5GXQC 1P3KB 5B33D 4J8VC 5GXQD 1S32A 5CPJC 3AZLB 3NQUA 5B0ZC 2BYMB 4JJND 4J8VD 2HIOC 4AWLC 5CPJD 4DRAA 5B0ZD 3AZIA 2F8NB 2HIOD 3AN2A 5AV9C 3X1TC 5BO0B 1BH9B 5C3IB 1P3PB 5GSUC 3KWQA 5AV9D 3X1TD 1M19C 2F8NG 1P3FA 1ZLAC 5GSUD 3NQUB 3MNNA 1P3BC 1M19D 4Z2MH 4G92B 1M18A 3MGQB 5B24C 3AZIB 3AZMA 5CPIA 1P3BD 5AVBC 1P3MB 1M1AC 5B24D 5DNMC 4H9PA 1KX3A 3AZGB 3KUYB 5AVBD 3MVDA 3KWQB 4WV4B 1M1AD 1P3GA 5DNMD 4HGAC 2NQBA 4H9OB 3W99C 3AZFB 3X1VA 2NZDC 3MNNB 3AZJB 3AZEC 3W99D 2NZDD 2AROB 5AV5D 3LZ1B 3R45A 1EQZA 4R8PB 3UT9A 3AZED 5B32C 5BS7A 4KUDC 3LELB 4H9PB 1KX3B 5B32D 5B40A 1ID3C 3AZHA 4H9RA 5CPKA 1JFIA 4KUDD 5B1LA 3AFAB 3AZNA 2HUEB 1ID3D 5AV8B 3X1UC 1HQ3B 3KXBB 3O62A 3AV1A 4ZBJB 4XUJC 3R45B 3X1UD 3TU4A 3X1SC 1P3IC 3AZKA 1KX4B 2CV5C 4XUJD 1P3ID 2YFVB 4UUZB 5B40B 2CV5D 4WU8C 5CPKB 1JFIB 5G49A 5B1LB 5KDMA 4WU8D 5F99C 5BNVA 3MGSC 4G91C 5GT3A 5BNXA 5F99D 3TU4B 5GT0A 3MGSD 3B6FC 3AZKB 2F8NK 1TZYA
chains in the Genus database with same CATH superfamily
3LJAA 4X23A 3LZ0A 3WA9A 3B6FD 3W98C 4J8WB 3UTBB 5G49B 4Z5TC 1KU5A 3C1CA 3P5JB 4J8UC 3UTAB 3B6GA 5KDMB 4Z66C 5E5AB 4KHAB 4H9SC 4Z5TD 4LD9A 2G5IC 4J8UD 4Z66D 1PZRA 4NE6A 3LJAB 4WU9A 4X23B 3LZ0B 1P3KA 4ZUXA 4J8XC 3WA9B 1S32C 2Y2JA 3REHB 3H0RC 3C1CB 4KGCA 3REKA 2ZM5A 4J8XD 4YS3A 4QLCC 1S32D 3REJB 3AYWA 3B6GB 3MGRA 2CWEA 3RELA 3AN2C 3B0CW 4LD9B 3AN2D 5BT1D 1ULYA 2W8SA 1KX5B 2PYOB 5BO0A 1BH9A 1P3PA 4WU9B 1R4VA 4ZUXB 1P3FC 1P34B 1P3AB 4JJNC 4NE3A 4E44A 4M6BA 4Z2MG 4KGCB 3REKB 3W98B 1P3FD 4YS3B 5B2JC 5DNNC 3KSYA 1M18C 3AYWB 5CPIC 3MGRB 3AZMC 3RELB 2Y2LA 3VH6A 5AY8B 3MGQA 5B2JD 5DNND 1M18D 1AOIB 3AZMD 5CPID 4H9QA 1KX3C 1P3MA 1P3OB 3REIB 3MVDC 2FFFB 4YM6A 3AZGA 1P3GC 5B0YC 3KUYA 2NQBC 1KX3D 4XZQB 4NFTA 3X1VC 3MVDD 4H9OA 5AV6B 3AZFA 1P3GD 5B0YD 2NQBD 1TAFA 3W97A 3X1VD 3AZJA 1EQZC 3UT9C 1BFMA 2AROA 3LZ1A 3WAAC 4EO5B 4R8PA 1EQZD 4H9QB 3UT9D 3WTPA 5B1MB 3A6NA 3WAAD 3LELA 3AZHC 4YM6B 1F66A 5CP6B 3NQJA 5B2IA 3AZNC 5B33A 5B40D 5JRGC 3AFAA 3AZHD 3O62C 1TAFB 5AV8A 3AZND 3AV1C 5AV5C 3AV2C 3W97B 3W96B 1HQ3A 2YFWA 5JRGD 3KXBA 5AVCB 4J8VA 3O62D 3AV1D 4DQYB 3AV2D 2RVQC 1P3LB 5B0ZA 3C1BC 2HIOA 2FJ7B 4CAYA 1KX4A 1U35B 3WTPB 3A6NB 3AZKD 2RVQD 3C1BD 2YFVA 1F66B 3NQJB 5B2IB 4UUZA 5B33B 5FUGB 3VH5T 2IO5C 4WNNA 5GXQB 2XD5A 5GT3C 2Y2HA 3V9RA 2YFWB 4J8VB 5GT0C 1ZLAA 5GT3D 5CPJB 1TZYC 5B0ZB 2HIOB 1P3BA 4CAYB 1Z2CB 5GT0D 4AWLB 3B0DC 2DF4C 1TZYD 5B24A 3B0CT 3MGPC 4J8WA 3UTBA 2Y2MA 5AV9B 3X1TB 5DNMA 4WNNB 2F2AC 3MGPD 3UTAA 5GSUB 1Q9CA 5E5AA 4KHAA 3V9RB 3B6GD 3WKJA 1M19B 1N1JA 1ZLAB 2NZDA 1P3BB 1P3KC 5B24B 2ZY3A 1P3KD 2BYKA 3REHA 3AZLC 5AVBB 2VQRA 4KUDA 5DNMB 3REJA 4KGCD 3AZLD 1ID3A 2Y2OA 3WKJB 4HGAB 3W99B 1N1JB 2F8ND 2NZDB 5C3IC 4DRBA 3AZEB 1P3PC 1KX5A 2PYOA 3F6TA 3X1SA 1P34A 1P3AA 1P3PD 2BYKB 5B32B 2CV5A 4KUDB 4E45A 3W98A 4G92C 5JA4A 3MGQC 3AZIC 4WU8A 1ID3B 5AY8A 4CSRB 5BT1C 1P3MC 3MGQD 1AOIA 5B32G 3AZID 2XD1A 3AZGC 3X1UB 3MGSA 3REIA 3KUYC 1P3OA 3KWQC 1P3MD 3VH6W 4XUJB 4XZQA 3AZGD 3AZFC 3X1SB 1P3IB 3KUYD 2ZY5A 3KWQD 5AV6A 2CV5B 3MNNC 3AZJC 2JSSA 3AZFD 5JA4B 4UPKA 2AROC 3LZ1C 4R8PC 4WU8B 3MNND 3AZJD 3AL0C 4H9NA 2AROD 3LZ1D 4KGCC 4Z66A 1H3OA 4R8PD 3LELC 5F99B 5B1MA 3MGSB 4G91B 3WTPD 3A6ND 5CP6A 3A1KA 3LELD 3AFAC 3EPLA 5B2ID 2HUEC 3B6FB 5AV8C 1HQ3C 3KXBC 4NE5A 3AFAD 4ZBJC 3W96A 4J8XA 3EPKA 5AV8D 5AVCA 1HQ3D 3KXBD 4Z5TB 5BS7C 4H9NB 1P3LA 1KX4C 4QLCA 4J8UB 2FJ7A 5B31A 4Z66B 1H3OB 1U35A 2ZY4A 1KX4D 5B40C 5CPKC 5B1LC 5FUGA 2Y2NA 5CPKD 5B1LD 5GXQA 1T3UA 4J8XB 4JJNA 1S32B 3TU4C 3AZKC 2BG1A 5CPJA 5B2JA 5DNNA 4QLCB 1ZLAD 5B31B 3TU4D 2J8PA 3AN2B 4J8WC 3UTBC 1WWSA 3WTPE 3UTAC 5AV9A 4J8WD 3UTBD 3X1TA 1F1EA 5E5AC 5B0YA 3WKJC 5B31G 5GSUA 3UTAD 1P3FB 4JJNB 5E5AD 1M19A 3WKJD 4WJ3C 2F8NH 5B2JB 5DNNB 2Y2QA 1M18B 3LJAC 4X23C 3LZ0C 3AZMB 5CPIB 3WA9C 3REHC 3WAAA 3LJAD 4X23D 3LZ0D 3C1CC 3WA9D 5AVBA 3REJC 1M1AA 3REHD 3B6GC 3MVDB 3C1CD 1P3GB 5B0YB 3VH6T 2NQBB 4LD9C 3REJD 3X1VB 5JRGA 2RIQA 3W99A 1WWIA 4LD9D 1KX5C 5AV5A 3AV2A 2PYOC 3AZEA 2LY8A 4WU9C 1EQZB 4ZUXC 3UT9B 1P34C 1P3AC 1KX5D 2JCHA 2PYOD 3WAAB 3C1BA 5B32A 2Y2GA 4WU9D 2Y2KA 2DQNC 3H0LC 4ZUXD 3X1SD 4YS3C 3REKC 1BH8A 1P34D 3AYWC 1P3AD 1M1AB 3MGRC 4H9RB 3RELC 3AZHB 2ZY2A 5AY8C 3REKD 1B6WA 3W98D 4YS3D 3AZNB 3AYWD 1AOIC 4CSRA 5JRGB 3MGRD 3RELD 5AY8D 3O62B 1P3OC 3REIC 3AV1B 5AV5B 3AV2B 1AOID 3X1UA 5CHLB 4XZQC 1P3OD 3REID 4XUJA 2G5HC 5AV6C 1P3IA 3C1BB 3IP4C 4XZQD 2L5AA 3B0BA 1BH8B 5AV6D 4WZSB 3MGPA 4EO5C 2IO5B 1B67A 5B1MC 5BNVB 5GT3B 5F99A 5BNXB 4YM6C 5CP6C 3VH5W 5B1MD 5GT0B 3EPJA 3H0MC 1TZYB 4YM6D 5CP6D 3B6FA 3W97C 3W96C 3B0DB 5AVCC 3MGPB 3W97D 1P3LC 3AZLA 3W96D 2BYMA 3VH5A 1HTAA 5AVCD 2FJ7C 4Z5TA 5B31C 1A7WA 1U35C 4J8UA 3WTPC 3A6NC 1P3LD 4QLCD 2F8NA 2FJ7D 1F66C 4H9SA 5B31D 5B2IC 1U35D 5B33C 1F66D 5GXQC 1P3KB 2UWXA 5B33D 4J8VC 5GXQD 1S32A 5CPJC 3AZLB 3NQUA 5B0ZC 2BYMB 4JJND 4J8VD 2HIOC 1W2EA 4AWLC 5CPJD 4DRAA 5B0ZD 3A1IA 3AZIA 2F8NB 2HIOD 3AN2A 5AV9C 3X1TC 5BO0B 1BH9B 5C3IB 1P3PB 5GSUC 3KWQA 5AV9D 3X1TD 1M19C 2F8NG 1P3FA 1ZLAC 5GSUD 3NQUB 3MNNA 1P3BC 1M19D 4Z2MH 4G92B 1M18A 3MGQB 5B24C 3AZIB 3AZMA 5CPIA 1P3BD 5AVBC 1P3MB 1M1AC 5B24D 5DNMC 4H9PA 1KX3A 3AZGB 3KUYB 5AVBD 3MVDA 3KWQB 4WV4B 1M1AD 1P3GA 5DNMD 4HGAC 2NQBA 4H9OB 3W99C 3AZFB 3X1VA 3FDDA 2NZDC 3MNNB 3AZJB 3AZEC 3W99D 3EPHA 2NZDD 2AROB 5AV5D 3LZ1B 3R45A 1EQZA 4R8PB 3UT9A 3AZED 5B32C 5BS7A 4KUDC 3LELB 4H9PB 1KX3B 5B32D 5B40A 1ID3C 3AZHA 4H9RA 5CPKA 1JFIA 4KUDD 5B1LA 3AFAB 3AZNA 2HUEB 1ID3D 5AV8B 3X1UC 1HQ3B 3KXBB 3O62A 3AV1A 3EG5B 4ZBJB 2Y2IA 4XUJC 3R45B 3X1UD 3TU4A 3X1SC 1P3IC 3AZKA 1KX4B 2CV5C 4XUJD 3KFUG 1P3ID 2YFVB 4UUZB 5B40B 2CV5D 4WU8C 5CPKB 1JFIB 5G49A 5B1LB 5KDMA 2Y2PA 4WU8D 5F99C 5BNVA 3MGSC 4G91C 5GT3A 5BNXA 2JE5A 5F99D 3TU4B 5GT0A 3MGSD 3B6FC 3AZKB 2F8NK 1TZYA
chains in the Genus database with same CATH topology
3LJAA 4X23A 3LZ0A 3WA9A 3B6FD 3W98C 4J8WB 3UTBB 5G49B 4Z5TC 1KU5A 3C1CA 3P5JB 4J8UC 3UTAB 3B6GA 5KDMB 4Z66C 5E5AB 4KHAB 4H9SC 4Z5TD 4LD9A 2G5IC 4J8UD 4Z66D 1PZRA 4NE6A 3LJAB 4WU9A 4X23B 3LZ0B 1P3KA 4ZUXA 4J8XC 3WA9B 1S32C 2Y2JA 3REHB 3H0RC 3C1CB 4KGCA 3REKA 2ZM5A 4J8XD 4YS3A 4QLCC 1S32D 3REJB 3AYWA 3B6GB 3MGRA 2CWEA 3RELA 3AN2C 3B0CW 4LD9B 3AN2D 5BT1D 1ULYA 2W8SA 1KX5B 2PYOB 5BO0A 1BH9A 1P3PA 4WU9B 1R4VA 4ZUXB 1P3FC 1P34B 1P3AB 4JJNC 4NE3A 4E44A 4M6BA 4Z2MG 4KGCB 3REKB 3W98B 1P3FD 4YS3B 5B2JC 5DNNC 3KSYA 1M18C 3AYWB 5CPIC 3MGRB 3AZMC 3RELB 2Y2LA 3VH6A 5AY8B 3MGQA 5B2JD 5DNND 1M18D 1AOIB 3AZMD 5CPID 4H9QA 1KX3C 1P3MA 1P3OB 3REIB 3MVDC 2FFFB 4YM6A 3AZGA 1P3GC 5B0YC 3KUYA 2NQBC 1KX3D 4XZQB 4NFTA 3X1VC 3MVDD 4H9OA 5AV6B 3AZFA 1P3GD 5B0YD 2NQBD 1TAFA 3W97A 3X1VD 3AZJA 1EQZC 3UT9C 1BFMA 2AROA 3LZ1A 3WAAC 4EO5B 4R8PA 1EQZD 4H9QB 3UT9D 3WTPA 5B1MB 3A6NA 3WAAD 3LELA 3AZHC 4YM6B 1F66A 5CP6B 3NQJA 5B2IA 3AZNC 5B33A 5B40D 5JRGC 3AFAA 3AZHD 3O62C 1TAFB 5AV8A 3AZND 3AV1C 5AV5C 3AV2C 3W97B 3W96B 1HQ3A 2YFWA 5JRGD 3KXBA 5AVCB 4J8VA 3O62D 3AV1D 4DQYB 3AV2D 2RVQC 1P3LB 5B0ZA 3C1BC 2HIOA 2FJ7B 4CAYA 1KX4A 1U35B 3WTPB 3A6NB 3AZKD 2RVQD 3C1BD 2YFVA 1F66B 3NQJB 5B2IB 4UUZA 5B33B 5FUGB 3VH5T 2IO5C 4WNNA 5GXQB 2XD5A 5GT3C 2Y2HA 3V9RA 2YFWB 4J8VB 5GT0C 1ZLAA 5GT3D 5CPJB 1TZYC 5B0ZB 2HIOB 1P3BA 4CAYB 1Z2CB 5GT0D 4AWLB 3B0DC 2DF4C 1TZYD 5B24A 3B0CT 3MGPC 4J8WA 3UTBA 2Y2MA 5AV9B 3X1TB 5DNMA 4WNNB 2F2AC 3MGPD 3UTAA 5GSUB 1Q9CA 5E5AA 4KHAA 3V9RB 3B6GD 3WKJA 1M19B 1N1JA 1ZLAB 2NZDA 1P3BB 1P3KC 5B24B 2ZY3A 1P3KD 2BYKA 3REHA 3AZLC 5AVBB 2VQRA 4KUDA 5DNMB 3REJA 4KGCD 3AZLD 1ID3A 2Y2OA 3WKJB 4HGAB 3W99B 1N1JB 2F8ND 2NZDB 5C3IC 4DRBA 3AZEB 1P3PC 1KX5A 2PYOA 3F6TA 3X1SA 1P34A 1P3AA 1P3PD 2BYKB 5B32B 2CV5A 4KUDB 4E45A 3W98A 4G92C 5JA4A 3MGQC 3AZIC 4WU8A 1ID3B 5AY8A 4CSRB 5BT1C 1P3MC 3MGQD 1AOIA 5B32G 3AZID 2XD1A 3AZGC 3X1UB 3MGSA 3REIA 3KUYC 1P3OA 3KWQC 1P3MD 3VH6W 4XUJB 4XZQA 3AZGD 3AZFC 3X1SB 1P3IB 3KUYD 2ZY5A 3KWQD 5AV6A 2CV5B 3MNNC 3AZJC 2JSSA 3AZFD 5JA4B 4UPKA 2AROC 3LZ1C 4R8PC 4WU8B 3MNND 3AZJD 3AL0C 4H9NA 2AROD 3LZ1D 4KGCC 4Z66A 1H3OA 4R8PD 3LELC 5F99B 5B1MA 3MGSB 4G91B 3WTPD 3A6ND 5CP6A 3A1KA 3LELD 3AFAC 3EPLA 5B2ID 2HUEC 3B6FB 5AV8C 1HQ3C 3KXBC 4NE5A 3AFAD 4ZBJC 3W96A 4J8XA 3EPKA 5AV8D 5AVCA 1HQ3D 3KXBD 4Z5TB 5BS7C 4H9NB 1P3LA 1KX4C 4QLCA 4J8UB 2FJ7A 5B31A 4Z66B 1H3OB 1U35A 2ZY4A 1KX4D 5B40C 5CPKC 5B1LC 5FUGA 2Y2NA 5CPKD 5B1LD 5GXQA 1T3UA 4J8XB 4JJNA 1S32B 3TU4C 3AZKC 2BG1A 5CPJA 5B2JA 5DNNA 4QLCB 1ZLAD 5B31B 3TU4D 2J8PA 3AN2B 4J8WC 3UTBC 1WWSA 3WTPE 3UTAC 5AV9A 4J8WD 3UTBD 3X1TA 1F1EA 5E5AC 5B0YA 3WKJC 5B31G 5GSUA 3UTAD 1P3FB 4JJNB 5E5AD 1M19A 3WKJD 4WJ3C 2F8NH 5B2JB 5DNNB 2Y2QA 1M18B 3LJAC 4X23C 3LZ0C 3AZMB 5CPIB 3WA9C 3REHC 3WAAA 3LJAD 4X23D 3LZ0D 3C1CC 3WA9D 5AVBA 3REJC 1M1AA 3REHD 3B6GC 3MVDB 3C1CD 1P3GB 5B0YB 3VH6T 2NQBB 4LD9C 3REJD 3X1VB 5JRGA 2RIQA 3W99A 1WWIA 4LD9D 1KX5C 5AV5A 3AV2A 2PYOC 3AZEA 2LY8A 4WU9C 1EQZB 4ZUXC 3UT9B 1P34C 1P3AC 1KX5D 2JCHA 2PYOD 3WAAB 3C1BA 5B32A 2Y2GA 4WU9D 2Y2KA 2DQNC 3H0LC 4ZUXD 3X1SD 4YS3C 3REKC 1BH8A 1P34D 3AYWC 1P3AD 1M1AB 3MGRC 4H9RB 3RELC 3AZHB 2ZY2A 5AY8C 3REKD 1B6WA 3W98D 4YS3D 3AZNB 3AYWD 1AOIC 4CSRA 5JRGB 3MGRD 3RELD 5AY8D 3O62B 1P3OC 3REIC 3AV1B 5AV5B 3AV2B 1AOID 3X1UA 5CHLB 4XZQC 1P3OD 3REID 4XUJA 2G5HC 5AV6C 1P3IA 3C1BB 3IP4C 4XZQD 2L5AA 3B0BA 1BH8B 5AV6D 4WZSB 3MGPA 4EO5C 2IO5B 1B67A 5B1MC 5BNVB 5GT3B 5F99A 5BNXB 4YM6C 5CP6C 3VH5W 5B1MD 5GT0B 3EPJA 3H0MC 1TZYB 4YM6D 5CP6D 3B6FA 3W97C 3W96C 3B0DB 5AVCC 3MGPB 3W97D 1P3LC 3AZLA 3W96D 2BYMA 3VH5A 1HTAA 5AVCD 2FJ7C 4Z5TA 5B31C 1A7WA 1U35C 4J8UA 3WTPC 3A6NC 1P3LD 4QLCD 2F8NA 2FJ7D 1F66C 4H9SA 5B31D 5B2IC 1U35D 5B33C 1F66D 5GXQC 1P3KB 2UWXA 5B33D 4J8VC 5GXQD 1S32A 5CPJC 3AZLB 3NQUA 5B0ZC 2BYMB 4JJND 4J8VD 2HIOC 1W2EA 4AWLC 5CPJD 4DRAA 5B0ZD 3A1IA 3AZIA 2F8NB 2HIOD 3AN2A 5AV9C 3X1TC 5BO0B 1BH9B 5C3IB 1P3PB 5GSUC 3KWQA 5AV9D 3X1TD 1M19C 2F8NG 1P3FA 1ZLAC 5GSUD 3NQUB 3MNNA 1P3BC 1M19D 4Z2MH 4G92B 1M18A 3MGQB 5B24C 3AZIB 3AZMA 5CPIA 1P3BD 5AVBC 1P3MB 1M1AC 5B24D 5DNMC 4H9PA 1KX3A 3AZGB 3KUYB 5AVBD 3MVDA 3KWQB 4WV4B 1M1AD 1P3GA 5DNMD 4HGAC 2NQBA 4H9OB 3W99C 3AZFB 3X1VA 3FDDA 2NZDC 3MNNB 3AZJB 3AZEC 3W99D 3EPHA 2NZDD 2AROB 5AV5D 3LZ1B 3R45A 1EQZA 4R8PB 3UT9A 3AZED 5B32C 5BS7A 4KUDC 3LELB 4H9PB 1KX3B 5B32D 5B40A 1ID3C 3AZHA 4H9RA 5CPKA 1JFIA 4KUDD 5B1LA 3AFAB 3AZNA 2HUEB 1ID3D 5AV8B 3X1UC 1HQ3B 3KXBB 3O62A 3AV1A 3EG5B 4ZBJB 2Y2IA 4XUJC 3R45B 3X1UD 3TU4A 3X1SC 1P3IC 3AZKA 1KX4B 2CV5C 4XUJD 3KFUG 1P3ID 2YFVB 4UUZB 5B40B 2CV5D 4WU8C 5CPKB 1JFIB 5G49A 5B1LB 5KDMA 2Y2PA 4WU8D 5F99C 5BNVA 3MGSC 4G91C 5GT3A 5BNXA 2JE5A 5F99D 3TU4B 5GT0A 3MGSD 3B6FC 3AZKB 2F8NK 1TZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA A;  4X23 A;  3LZ0 A;  3WA9 A;  3B6F D;  4J8W B;  3UTB B;  5G49 B;  4Z5T C;  1KU5 A;  3C1C A;  4J8U C;  3UTA B;  3B6G A;  5KDM B;  4Z66 C;  5E5A B;  4KHA B;  4H9S C;  4Z5T D;  4LD9 A;  4J8U D;  4Z66 D;  4NE6 A;  3LJA B;  4WU9 A;  4X23 B;  3LZ0 B;  1P3K A;  4ZUX A;  4J8X C;  3WA9 B;  1S32 C;  3REH B;  3C1C B;  4KGC A;  3REK A;  4J8X D;  4YS3 A;  4QLC C;  1S32 D;  3REJ B;  3AYW A;  3B6G B;  3MGR A;  2CWE A;  3REL A;  3AN2 C;  3B0C W;  4LD9 B;  3AN2 D;  5BT1 D;  1ULY A;  1KX5 B;  2PYO B;  5BO0 A;  1BH9 A;  1P3P A;  4WU9 B;  1R4V A;  4ZUX B;  1P3F C;  1P34 B;  1P3A B;  4JJN C;  4NE3 A;  4E44 A;  4M6B A;  4Z2M G;  4KGC B;  3REK B;  3W98 B;  1P3F D;  4YS3 B;  5B2J C;  5DNN C;  3KSY A;  1M18 C;  3AYW B;  5CPI C;  3MGR B;  3AZM C;  3REL B;  3VH6 A;  5AY8 B;  3MGQ A;  5B2J D;  5DNN D;  1M18 D;  1AOI B;  3AZM D;  5CPI D;  4H9Q A;  1KX3 C;  1P3M A;  1P3O B;  3REI B;  3MVD C;  4YM6 A;  3AZG A;  1P3G C;  5B0Y C;  3KUY A;  2NQB C;  1KX3 D;  4XZQ B;  4NFT A;  3X1V C;  3MVD D;  4H9O A;  5AV6 B;  3AZF A;  1P3G D;  5B0Y D;  2NQB D;  1TAF A;  3W97 A;  3X1V D;  3AZJ A;  1EQZ C;  3UT9 C;  1BFM A;  2ARO A;  3LZ1 A;  3WAA C;  4EO5 B;  4R8P A;  1EQZ D;  4H9Q B;  3UT9 D;  3WTP A;  5B1M B;  3A6N A;  3WAA D;  3LEL A;  3AZH C;  4YM6 B;  1F66 A;  5CP6 B;  3NQJ A;  5B2I A;  3AZN C;  5B33 A;  5B40 D;  5JRG C;  3AFA A;  3AZH D;  3O62 C;  1TAF B;  5AV8 A;  3AZN D;  3AV1 C;  5AV5 C;  3AV2 C;  3W97 B;  3W96 B;  1HQ3 A;  2YFW A;  5JRG D;  3KXB A;  5AVC B;  4J8V A;  3O62 D;  3AV1 D;  3AV2 D;  2RVQ C;  1P3L B;  5B0Z A;  3C1B C;  2HIO A;  2FJ7 B;  4CAY A;  1KX4 A;  1U35 B;  3WTP B;  3A6N B;  3AZK D;  2RVQ D;  3C1B D;  2YFV A;  1F66 B;  3NQJ B;  5B2I B;  4UUZ A;  5B33 B;  5FUG B;  3VH5 T;  2IO5 C;  4WNN A;  5GXQ B;  5GT3 C;  3V9R A;  2YFW B;  4J8V B;  5GT0 C;  1ZLA A;  5GT3 D;  5CPJ B;  1TZY C;  5B0Z B;  2HIO B;  1P3B A;  4CAY B;  5GT0 D;  4AWL B;  3B0D C;  1TZY D;  5B24 A;  3B0C T;  3MGP C;  4J8W A;  3UTB A;  5AV9 B;  3X1T B;  5DNM A;  4WNN B;  3MGP D;  3UTA A;  5GSU B;  1Q9C A;  5E5A A;  4KHA A;  3V9R B;  3B6G D;  3WKJ A;  1M19 B;  1N1J A;  1ZLA B;  2NZD A;  1P3B B;  1P3K C;  5B24 B;  1P3K D;  2BYK A;  3REH A;  3AZL C;  5AVB B;  4KUD A;  5DNM B;  3REJ A;  4KGC D;  3AZL D;  1ID3 A;  3WKJ B;  4HGA B;  3W99 B;  1N1J B;  2F8N D;  2NZD B;  5C3I C;  4DRB A;  3AZE B;  1P3P C;  1KX5 A;  2PYO A;  3X1S A;  1P34 A;  1P3A A;  1P3P D;  2BYK B;  5B32 B;  2CV5 A;  4KUD B;  4E45 A;  3W98 A;  4G92 C;  5JA4 A;  3MGQ C;  3AZI C;  4WU8 A;  1ID3 B;  5AY8 A;  4CSR B;  5BT1 C;  1P3M C;  3MGQ D;  1AOI A;  5B32 G;  3AZI D;  3AZG C;  3X1U B;  3MGS A;  3REI A;  3KUY C;  1P3O A;  3KWQ C;  1P3M D;  3VH6 W;  4XUJ B;  4XZQ A;  3AZG D;  3AZF C;  3X1S B;  1P3I B;  3KUY D;  3KWQ D;  5AV6 A;  2CV5 B;  3MNN C;  3AZJ C;  2JSS A;  3AZF D;  5JA4 B;  2ARO C;  3LZ1 C;  4R8P C;  4WU8 B;  3MNN D;  3AZJ D;  4H9N A;  2ARO D;  3LZ1 D;  4Z66 A;  1H3O A;  4R8P D;  3LEL C;  5F99 B;  5B1M A;  3MGS B;  4G91 B;  3WTP D;  3A6N D;  5CP6 A;  3LEL D;  3AFA C;  5B2I D;  2HUE C;  3B6F B;  5AV8 C;  1HQ3 C;  3KXB C;  4NE5 A;  3AFA D;  4ZBJ C;  3W96 A;  4J8X A;  5AV8 D;  5AVC A;  1HQ3 D;  3KXB D;  4Z5T B;  5BS7 C;  4H9N B;  1P3L A;  1KX4 C;  4QLC A;  4J8U B;  2FJ7 A;  5B31 A;  4Z66 B;  1H3O B;  1U35 A;  1KX4 D;  5B40 C;  5CPK C;  5B1L C;  5FUG A;  5CPK D;  5B1L D;  5GXQ A;  4J8X B;  4JJN A;  1S32 B;  3TU4 C;  3AZK C;  5CPJ A;  5B2J A;  5DNN A;  4QLC B;  1ZLA D;  5B31 B;  3TU4 D;  3AN2 B;  4J8W C;  3UTB C;  1WWS A;  3WTP E;  3UTA C;  5AV9 A;  4J8W D;  3UTB D;  3X1T A;  1F1E A;  5E5A C;  5B0Y A;  3WKJ C;  5B31 G;  5GSU A;  3UTA D;  1P3F B;  4JJN B;  5E5A D;  1M19 A;  3WKJ D;  2F8N H;  5B2J B;  5DNN B;  1M18 B;  3LJA C;  4X23 C;  3LZ0 C;  3AZM B;  5CPI B;  3WA9 C;  3REH C;  3WAA A;  3LJA D;  4X23 D;  3LZ0 D;  3C1C C;  3WA9 D;  5AVB A;  3REJ C;  1M1A A;  3REH D;  3B6G C;  3MVD B;  3C1C D;  1P3G B;  5B0Y B;  3VH6 T;  2NQB B;  4LD9 C;  3REJ D;  3X1V B;  5JRG A;  3W99 A;  1WWI A;  4LD9 D;  1KX5 C;  5AV5 A;  3AV2 A;  2PYO C;  3AZE A;  2LY8 A;  4WU9 C;  1EQZ B;  4ZUX C;  3UT9 B;  1P34 C;  1P3A C;  1KX5 D;  2PYO D;  3WAA B;  3C1B A;  5B32 A;  4WU9 D;  4KGC C;  3REK C;  4ZUX D;  3W98 C;  3X1S D;  4YS3 C;  1P34 D;  1P3A D;  1BH8 A;  3AYW C;  1M1A B;  3MGR C;  4H9R B;  3REL C;  3AZH B;  5AY8 C;  3REK D;  1B6W A;  3W98 D;  4YS3 D;  3AZN B;  3AYW D;  1AOI C;  4CSR A;  5JRG B;  3MGR D;  3REL D;  5AY8 D;  3O62 B;  1P3O C;  3REI C;  3AV1 B;  5AV5 B;  3AV2 B;  1AOI D;  3X1U A;  5CHL B;  4XZQ C;  1P3O D;  3REI D;  4XUJ A;  5AV6 C;  1P3I A;  3C1B B;  4XZQ D;  2L5A A;  3B0B A;  1BH8 B;  5AV6 D;  4WZS B;  3MGP A;  4EO5 C;  2IO5 B;  1B67 A;  5B1M C;  5BNV B;  5GT3 B;  5F99 A;  5BNX B;  4YM6 C;  5CP6 C;  3VH5 W;  5B1M D;  5GT0 B;  1TZY B;  4YM6 D;  5CP6 D;  3B6F A;  3W97 C;  3W96 C;  3B0D B;  5AVC C;  3MGP B;  3W97 D;  1P3L C;  3AZL A;  3W96 D;  2BYM A;  3VH5 A;  1HTA A;  5AVC D;  2FJ7 C;  4Z5T A;  5B31 C;  1A7W A;  1U35 C;  4J8U A;  3WTP C;  3A6N C;  1P3L D;  4QLC D;  2F8N A;  2FJ7 D;  1F66 C;  4H9S A;  5B31 D;  5B2I C;  1U35 D;  5B33 C;  1F66 D;  5GXQ C;  1P3K B;  5B33 D;  4J8V C;  5GXQ D;  1S32 A;  5CPJ C;  3AZL B;  3NQU A;  5B0Z C;  2BYM B;  4JJN D;  4J8V D;  2HIO C;  4AWL C;  5CPJ D;  4DRA A;  5B0Z D;  3AZI A;  2F8N B;  2HIO D;  3AN2 A;  5AV9 C;  3X1T C;  5BO0 B;  1BH9 B;  5C3I B;  1P3P B;  5GSU C;  3KWQ A;  5AV9 D;  3X1T D;  1M19 C;  2F8N G;  1P3F A;  1ZLA C;  5GSU D;  3NQU B;  3MNN A;  1P3B C;  1M19 D;  4Z2M H;  4G92 B;  1M18 A;  3MGQ B;  5B24 C;  3AZI B;  3AZM A;  5CPI A;  1P3B D;  5AVB C;  1P3M B;  1M1A C;  5B24 D;  5DNM C;  4H9P A;  1KX3 A;  3AZG B;  3KUY B;  5AVB D;  3MVD A;  3KWQ B;  4WV4 B;  1M1A D;  1P3G A;  5DNM D;  4HGA C;  2NQB A;  4H9O B;  3W99 C;  3AZF B;  3X1V A;  2NZD C;  3MNN B;  3AZJ B;  3AZE C;  3W99 D;  2NZD D;  2ARO B;  5AV5 D;  3LZ1 B;  3R45 A;  1EQZ A;  4R8P B;  3UT9 A;  3AZE D;  5B32 C;  5BS7 A;  4KUD C;  3LEL B;  4H9P B;  1KX3 B;  5B32 D;  5B40 A;  1ID3 C;  3AZH A;  4H9R A;  5CPK A;  1JFI A;  4KUD D;  5B1L A;  3AFA B;  3AZN A;  2HUE B;  1ID3 D;  5AV8 B;  3X1U C;  1HQ3 B;  3KXB B;  3O62 A;  3AV1 A;  4ZBJ B;  4XUJ C;  3R45 B;  3X1U D;  3TU4 A;  3X1S C;  1P3I C;  3AZK A;  1KX4 B;  2CV5 C;  4XUJ D;  1P3I D;  2YFV B;  4UUZ B;  5B40 B;  2CV5 D;  4WU8 C;  5CPK B;  1JFI B;  5G49 A;  5B1L B;  5KDM A;  4WU8 D;  5F99 C;  5BNV A;  3MGS C;  4G91 C;  5GT3 A;  5BNX A;  5F99 D;  3TU4 B;  5GT0 A;  3MGS D;  3B6F C;  3AZK B;  2F8N K;  1TZY A; 
#chains in the Genus database with same CATH topology
 3LJA A;  4X23 A;  3LZ0 A;  3WA9 A;  3B6F D;  3W98 C;  4J8W B;  3UTB B;  5G49 B;  4Z5T C;  1KU5 A;  3C1C A;  3P5J B;  4J8U C;  3UTA B;  3B6G A;  5KDM B;  4Z66 C;  5E5A B;  4KHA B;  4H9S C;  4Z5T D;  4LD9 A;  2G5I C;  4J8U D;  4Z66 D;  1PZR A;  4NE6 A;  3LJA B;  4WU9 A;  4X23 B;  3LZ0 B;  1P3K A;  4ZUX A;  4J8X C;  3WA9 B;  1S32 C;  2Y2J A;  3REH B;  3H0R C;  3C1C B;  4KGC A;  3REK A;  2ZM5 A;  4J8X D;  4YS3 A;  4QLC C;  1S32 D;  3REJ B;  3AYW A;  3B6G B;  3MGR A;  2CWE A;  3REL A;  3AN2 C;  3B0C W;  4LD9 B;  3AN2 D;  5BT1 D;  1ULY A;  2W8S A;  1KX5 B;  2PYO B;  5BO0 A;  1BH9 A;  1P3P A;  4WU9 B;  1R4V A;  4ZUX B;  1P3F C;  1P34 B;  1P3A B;  4JJN C;  4NE3 A;  4E44 A;  4M6B A;  4Z2M G;  4KGC B;  3REK B;  3W98 B;  1P3F D;  4YS3 B;  5B2J C;  5DNN C;  3KSY A;  1M18 C;  3AYW B;  5CPI C;  3MGR B;  3AZM C;  3REL B;  2Y2L A;  3VH6 A;  5AY8 B;  3MGQ A;  5B2J D;  5DNN D;  1M18 D;  1AOI B;  3AZM D;  5CPI D;  4H9Q A;  1KX3 C;  1P3M A;  1P3O B;  3REI B;  3MVD C;  2FFF B;  4YM6 A;  3AZG A;  1P3G C;  5B0Y C;  3KUY A;  2NQB C;  1KX3 D;  4XZQ B;  4NFT A;  3X1V C;  3MVD D;  4H9O A;  5AV6 B;  3AZF A;  1P3G D;  5B0Y D;  2NQB D;  1TAF A;  3W97 A;  3X1V D;  3AZJ A;  1EQZ C;  3UT9 C;  1BFM A;  2ARO A;  3LZ1 A;  3WAA C;  4EO5 B;  4R8P A;  1EQZ D;  4H9Q B;  3UT9 D;  3WTP A;  5B1M B;  3A6N A;  3WAA D;  3LEL A;  3AZH C;  4YM6 B;  1F66 A;  5CP6 B;  3NQJ A;  5B2I A;  3AZN C;  5B33 A;  5B40 D;  5JRG C;  3AFA A;  3AZH D;  3O62 C;  1TAF B;  5AV8 A;  3AZN D;  3AV1 C;  5AV5 C;  3AV2 C;  3W97 B;  3W96 B;  1HQ3 A;  2YFW A;  5JRG D;  3KXB A;  5AVC B;  4J8V A;  3O62 D;  3AV1 D;  4DQY B;  3AV2 D;  2RVQ C;  1P3L B;  5B0Z A;  3C1B C;  2HIO A;  2FJ7 B;  4CAY A;  1KX4 A;  1U35 B;  3WTP B;  3A6N B;  3AZK D;  2RVQ D;  3C1B D;  2YFV A;  1F66 B;  3NQJ B;  5B2I B;  4UUZ A;  5B33 B;  5FUG B;  3VH5 T;  2IO5 C;  4WNN A;  5GXQ B;  2XD5 A;  5GT3 C;  2Y2H A;  3V9R A;  2YFW B;  4J8V B;  5GT0 C;  1ZLA A;  5GT3 D;  5CPJ B;  1TZY C;  5B0Z B;  2HIO B;  1P3B A;  4CAY B;  1Z2C B;  5GT0 D;  4AWL B;  3B0D C;  2DF4 C;  1TZY D;  5B24 A;  3B0C T;  3MGP C;  4J8W A;  3UTB A;  2Y2M A;  5AV9 B;  3X1T B;  5DNM A;  4WNN B;  2F2A C;  3MGP D;  3UTA A;  5GSU B;  1Q9C A;  5E5A A;  4KHA A;  3V9R B;  3B6G D;  3WKJ A;  1M19 B;  1N1J A;  1ZLA B;  2NZD A;  1P3B B;  1P3K C;  5B24 B;  2ZY3 A;  1P3K D;  2BYK A;  3REH A;  3AZL C;  5AVB B;  2VQR A;  4KUD A;  5DNM B;  3REJ A;  4KGC D;  3AZL D;  1ID3 A;  2Y2O A;  3WKJ B;  4HGA B;  3W99 B;  1N1J B;  2F8N D;  2NZD B;  5C3I C;  4DRB A;  3AZE B;  1P3P C;  1KX5 A;  2PYO A;  3F6T A;  3X1S A;  1P34 A;  1P3A A;  1P3P D;  2BYK B;  5B32 B;  2CV5 A;  4KUD B;  4E45 A;  3W98 A;  4G92 C;  5JA4 A;  3MGQ C;  3AZI C;  4WU8 A;  1ID3 B;  5AY8 A;  4CSR B;  5BT1 C;  1P3M C;  3MGQ D;  1AOI A;  5B32 G;  3AZI D;  2XD1 A;  3AZG C;  3X1U B;  3MGS A;  3REI A;  3KUY C;  1P3O A;  3KWQ C;  1P3M D;  3VH6 W;  4XUJ B;  4XZQ A;  3AZG D;  3AZF C;  3X1S B;  1P3I B;  3KUY D;  2ZY5 A;  3KWQ D;  5AV6 A;  2CV5 B;  3MNN C;  3AZJ C;  2JSS A;  3AZF D;  5JA4 B;  4UPK A;  2ARO C;  3LZ1 C;  4R8P C;  4WU8 B;  3MNN D;  3AZJ D;  3AL0 C;  4H9N A;  2ARO D;  3LZ1 D;  4KGC C;  4Z66 A;  1H3O A;  4R8P D;  3LEL C;  5F99 B;  5B1M A;  3MGS B;  4G91 B;  3WTP D;  3A6N D;  5CP6 A;  3A1K A;  3LEL D;  3AFA C;  3EPL A;  5B2I D;  2HUE C;  3B6F B;  5AV8 C;  1HQ3 C;  3KXB C;  4NE5 A;  3AFA D;  4ZBJ C;  3W96 A;  4J8X A;  3EPK A;  5AV8 D;  5AVC A;  1HQ3 D;  3KXB D;  4Z5T B;  5BS7 C;  4H9N B;  1P3L A;  1KX4 C;  4QLC A;  4J8U B;  2FJ7 A;  5B31 A;  4Z66 B;  1H3O B;  1U35 A;  2ZY4 A;  1KX4 D;  5B40 C;  5CPK C;  5B1L C;  5FUG A;  2Y2N A;  5CPK D;  5B1L D;  5GXQ A;  1T3U A;  4J8X B;  4JJN A;  1S32 B;  3TU4 C;  3AZK C;  2BG1 A;  5CPJ A;  5B2J A;  5DNN A;  4QLC B;  1ZLA D;  5B31 B;  3TU4 D;  2J8P A;  3AN2 B;  4J8W C;  3UTB C;  1WWS A;  3WTP E;  3UTA C;  5AV9 A;  4J8W D;  3UTB D;  3X1T A;  1F1E A;  5E5A C;  5B0Y A;  3WKJ C;  5B31 G;  5GSU A;  3UTA D;  1P3F B;  4JJN B;  5E5A D;  1M19 A;  3WKJ D;  4WJ3 C;  2F8N H;  5B2J B;  5DNN B;  2Y2Q A;  1M18 B;  3LJA C;  4X23 C;  3LZ0 C;  3AZM B;  5CPI B;  3WA9 C;  3REH C;  3WAA A;  3LJA D;  4X23 D;  3LZ0 D;  3C1C C;  3WA9 D;  5AVB A;  3REJ C;  1M1A A;  3REH D;  3B6G C;  3MVD B;  3C1C D;  1P3G B;  5B0Y B;  3VH6 T;  2NQB B;  4LD9 C;  3REJ D;  3X1V B;  5JRG A;  2RIQ A;  3W99 A;  1WWI A;  4LD9 D;  1KX5 C;  5AV5 A;  3AV2 A;  2PYO C;  3AZE A;  2LY8 A;  4WU9 C;  1EQZ B;  4ZUX C;  3UT9 B;  1P34 C;  1P3A C;  1KX5 D;  2JCH A;  2PYO D;  3WAA B;  3C1B A;  5B32 A;  2Y2G A;  4WU9 D;  2Y2K A;  2DQN C;  3H0L C;  4ZUX D;  3X1S D;  4YS3 C;  3REK C;  1BH8 A;  1P34 D;  3AYW C;  1P3A D;  1M1A B;  3MGR C;  4H9R B;  3REL C;  3AZH B;  2ZY2 A;  5AY8 C;  3REK D;  1B6W A;  3W98 D;  4YS3 D;  3AZN B;  3AYW D;  1AOI C;  4CSR A;  5JRG B;  3MGR D;  3REL D;  5AY8 D;  3O62 B;  1P3O C;  3REI C;  3AV1 B;  5AV5 B;  3AV2 B;  1AOI D;  3X1U A;  5CHL B;  4XZQ C;  1P3O D;  3REI D;  4XUJ A;  2G5H C;  5AV6 C;  1P3I A;  3C1B B;  3IP4 C;  4XZQ D;  2L5A A;  3B0B A;  1BH8 B;  5AV6 D;  4WZS B;  3MGP A;  4EO5 C;  2IO5 B;  1B67 A;  5B1M C;  5BNV B;  5GT3 B;  5F99 A;  5BNX B;  4YM6 C;  5CP6 C;  3VH5 W;  5B1M D;  5GT0 B;  3EPJ A;  3H0M C;  1TZY B;  4YM6 D;  5CP6 D;  3B6F A;  3W97 C;  3W96 C;  3B0D B;  5AVC C;  3MGP B;  3W97 D;  1P3L C;  3AZL A;  3W96 D;  2BYM A;  3VH5 A;  1HTA A;  5AVC D;  2FJ7 C;  4Z5T A;  5B31 C;  1A7W A;  1U35 C;  4J8U A;  3WTP C;  3A6N C;  1P3L D;  4QLC D;  2F8N A;  2FJ7 D;  1F66 C;  4H9S A;  5B31 D;  5B2I C;  1U35 D;  5B33 C;  1F66 D;  5GXQ C;  1P3K B;  2UWX A;  5B33 D;  4J8V C;  5GXQ D;  1S32 A;  5CPJ C;  3AZL B;  3NQU A;  5B0Z C;  2BYM B;  4JJN D;  4J8V D;  2HIO C;  1W2E A;  4AWL C;  5CPJ D;  4DRA A;  5B0Z D;  3A1I A;  3AZI A;  2F8N B;  2HIO D;  3AN2 A;  5AV9 C;  3X1T C;  5BO0 B;  1BH9 B;  5C3I B;  1P3P B;  5GSU C;  3KWQ A;  5AV9 D;  3X1T D;  1M19 C;  2F8N G;  1P3F A;  1ZLA C;  5GSU D;  3NQU B;  3MNN A;  1P3B C;  1M19 D;  4Z2M H;  4G92 B;  1M18 A;  3MGQ B;  5B24 C;  3AZI B;  3AZM A;  5CPI A;  1P3B D;  5AVB C;  1P3M B;  1M1A C;  5B24 D;  5DNM C;  4H9P A;  1KX3 A;  3AZG B;  3KUY B;  5AVB D;  3MVD A;  3KWQ B;  4WV4 B;  1M1A D;  1P3G A;  5DNM D;  4HGA C;  2NQB A;  4H9O B;  3W99 C;  3AZF B;  3X1V A;  3FDD A;  2NZD C;  3MNN B;  3AZJ B;  3AZE C;  3W99 D;  3EPH A;  2NZD D;  2ARO B;  5AV5 D;  3LZ1 B;  3R45 A;  1EQZ A;  4R8P B;  3UT9 A;  3AZE D;  5B32 C;  5BS7 A;  4KUD C;  3LEL B;  4H9P B;  1KX3 B;  5B32 D;  5B40 A;  1ID3 C;  3AZH A;  4H9R A;  5CPK A;  1JFI A;  4KUD D;  5B1L A;  3AFA B;  3AZN A;  2HUE B;  1ID3 D;  5AV8 B;  3X1U C;  1HQ3 B;  3KXB B;  3O62 A;  3AV1 A;  3EG5 B;  4ZBJ B;  2Y2I A;  4XUJ C;  3R45 B;  3X1U D;  3TU4 A;  3X1S C;  1P3I C;  3AZK A;  1KX4 B;  2CV5 C;  4XUJ D;  3KFU G;  1P3I D;  2YFV B;  4UUZ B;  5B40 B;  2CV5 D;  4WU8 C;  5CPK B;  1JFI B;  5G49 A;  5B1L B;  5KDM A;  2Y2P A;  4WU8 D;  5F99 C;  5BNV A;  3MGS C;  4G91 C;  5GT3 A;  5BNX A;  2JE5 A;  5F99 D;  3TU4 B;  5GT0 A;  3MGS D;  3B6F C;  3AZK B;  2F8N K;  1TZY A; 
#chains in the Genus database with same CATH homology
 3LJA A;  4X23 A;  3LZ0 A;  3WA9 A;  3B6F D;  3W98 C;  4J8W B;  3UTB B;  5G49 B;  4Z5T C;  1KU5 A;  3C1C A;  3P5J B;  4J8U C;  3UTA B;  3B6G A;  5KDM B;  4Z66 C;  5E5A B;  4KHA B;  4H9S C;  4Z5T D;  4LD9 A;  2G5I C;  4J8U D;  4Z66 D;  1PZR A;  4NE6 A;  3LJA B;  4WU9 A;  4X23 B;  3LZ0 B;  1P3K A;  4ZUX A;  4J8X C;  3WA9 B;  1S32 C;  2Y2J A;  3REH B;  3H0R C;  3C1C B;  4KGC A;  3REK A;  2ZM5 A;  4J8X D;  4YS3 A;  4QLC C;  1S32 D;  3REJ B;  3AYW A;  3B6G B;  3MGR A;  2CWE A;  3REL A;  3AN2 C;  3B0C W;  4LD9 B;  3AN2 D;  5BT1 D;  1ULY A;  2W8S A;  1KX5 B;  2PYO B;  5BO0 A;  1BH9 A;  1P3P A;  4WU9 B;  1R4V A;  4ZUX B;  1P3F C;  1P34 B;  1P3A B;  4JJN C;  4NE3 A;  4E44 A;  4M6B A;  4Z2M G;  4KGC B;  3REK B;  3W98 B;  1P3F D;  4YS3 B;  5B2J C;  5DNN C;  3KSY A;  1M18 C;  3AYW B;  5CPI C;  3MGR B;  3AZM C;  3REL B;  2Y2L A;  3VH6 A;  5AY8 B;  3MGQ A;  5B2J D;  5DNN D;  1M18 D;  1AOI B;  3AZM D;  5CPI D;  4H9Q A;  1KX3 C;  1P3M A;  1P3O B;  3REI B;  3MVD C;  2FFF B;  4YM6 A;  3AZG A;  1P3G C;  5B0Y C;  3KUY A;  2NQB C;  1KX3 D;  4XZQ B;  4NFT A;  3X1V C;  3MVD D;  4H9O A;  5AV6 B;  3AZF A;  1P3G D;  5B0Y D;  2NQB D;  1TAF A;  3W97 A;  3X1V D;  3AZJ A;  1EQZ C;  3UT9 C;  1BFM A;  2ARO A;  3LZ1 A;  3WAA C;  4EO5 B;  4R8P A;  1EQZ D;  4H9Q B;  3UT9 D;  3WTP A;  5B1M B;  3A6N A;  3WAA D;  3LEL A;  3AZH C;  4YM6 B;  1F66 A;  5CP6 B;  3NQJ A;  5B2I A;  3AZN C;  5B33 A;  5B40 D;  5JRG C;  3AFA A;  3AZH D;  3O62 C;  1TAF B;  5AV8 A;  3AZN D;  3AV1 C;  5AV5 C;  3AV2 C;  3W97 B;  3W96 B;  1HQ3 A;  2YFW A;  5JRG D;  3KXB A;  5AVC B;  4J8V A;  3O62 D;  3AV1 D;  4DQY B;  3AV2 D;  2RVQ C;  1P3L B;  5B0Z A;  3C1B C;  2HIO A;  2FJ7 B;  4CAY A;  1KX4 A;  1U35 B;  3WTP B;  3A6N B;  3AZK D;  2RVQ D;  3C1B D;  2YFV A;  1F66 B;  3NQJ B;  5B2I B;  4UUZ A;  5B33 B;  5FUG B;  3VH5 T;  2IO5 C;  4WNN A;  5GXQ B;  2XD5 A;  5GT3 C;  2Y2H A;  3V9R A;  2YFW B;  4J8V B;  5GT0 C;  1ZLA A;  5GT3 D;  5CPJ B;  1TZY C;  5B0Z B;  2HIO B;  1P3B A;  4CAY B;  1Z2C B;  5GT0 D;  4AWL B;  3B0D C;  2DF4 C;  1TZY D;  5B24 A;  3B0C T;  3MGP C;  4J8W A;  3UTB A;  2Y2M A;  5AV9 B;  3X1T B;  5DNM A;  4WNN B;  2F2A C;  3MGP D;  3UTA A;  5GSU B;  1Q9C A;  5E5A A;  4KHA A;  3V9R B;  3B6G D;  3WKJ A;  1M19 B;  1N1J A;  1ZLA B;  2NZD A;  1P3B B;  1P3K C;  5B24 B;  2ZY3 A;  1P3K D;  2BYK A;  3REH A;  3AZL C;  5AVB B;  2VQR A;  4KUD A;  5DNM B;  3REJ A;  4KGC D;  3AZL D;  1ID3 A;  2Y2O A;  3WKJ B;  4HGA B;  3W99 B;  1N1J B;  2F8N D;  2NZD B;  5C3I C;  4DRB A;  3AZE B;  1P3P C;  1KX5 A;  2PYO A;  3F6T A;  3X1S A;  1P34 A;  1P3A A;  1P3P D;  2BYK B;  5B32 B;  2CV5 A;  4KUD B;  4E45 A;  3W98 A;  4G92 C;  5JA4 A;  3MGQ C;  3AZI C;  4WU8 A;  1ID3 B;  5AY8 A;  4CSR B;  5BT1 C;  1P3M C;  3MGQ D;  1AOI A;  5B32 G;  3AZI D;  2XD1 A;  3AZG C;  3X1U B;  3MGS A;  3REI A;  3KUY C;  1P3O A;  3KWQ C;  1P3M D;  3VH6 W;  4XUJ B;  4XZQ A;  3AZG D;  3AZF C;  3X1S B;  1P3I B;  3KUY D;  2ZY5 A;  3KWQ D;  5AV6 A;  2CV5 B;  3MNN C;  3AZJ C;  2JSS A;  3AZF D;  5JA4 B;  4UPK A;  2ARO C;  3LZ1 C;  4R8P C;  4WU8 B;  3MNN D;  3AZJ D;  3AL0 C;  4H9N A;  2ARO D;  3LZ1 D;  4KGC C;  4Z66 A;  1H3O A;  4R8P D;  3LEL C;  5F99 B;  5B1M A;  3MGS B;  4G91 B;  3WTP D;  3A6N D;  5CP6 A;  3A1K A;  3LEL D;  3AFA C;  3EPL A;  5B2I D;  2HUE C;  3B6F B;  5AV8 C;  1HQ3 C;  3KXB C;  4NE5 A;  3AFA D;  4ZBJ C;  3W96 A;  4J8X A;  3EPK A;  5AV8 D;  5AVC A;  1HQ3 D;  3KXB D;  4Z5T B;  5BS7 C;  4H9N B;  1P3L A;  1KX4 C;  4QLC A;  4J8U B;  2FJ7 A;  5B31 A;  4Z66 B;  1H3O B;  1U35 A;  2ZY4 A;  1KX4 D;  5B40 C;  5CPK C;  5B1L C;  5FUG A;  2Y2N A;  5CPK D;  5B1L D;  5GXQ A;  1T3U A;  4J8X B;  4JJN A;  1S32 B;  3TU4 C;  3AZK C;  2BG1 A;  5CPJ A;  5B2J A;  5DNN A;  4QLC B;  1ZLA D;  5B31 B;  3TU4 D;  2J8P A;  3AN2 B;  4J8W C;  3UTB C;  1WWS A;  3WTP E;  3UTA C;  5AV9 A;  4J8W D;  3UTB D;  3X1T A;  1F1E A;  5E5A C;  5B0Y A;  3WKJ C;  5B31 G;  5GSU A;  3UTA D;  1P3F B;  4JJN B;  5E5A D;  1M19 A;  3WKJ D;  4WJ3 C;  2F8N H;  5B2J B;  5DNN B;  2Y2Q A;  1M18 B;  3LJA C;  4X23 C;  3LZ0 C;  3AZM B;  5CPI B;  3WA9 C;  3REH C;  3WAA A;  3LJA D;  4X23 D;  3LZ0 D;  3C1C C;  3WA9 D;  5AVB A;  3REJ C;  1M1A A;  3REH D;  3B6G C;  3MVD B;  3C1C D;  1P3G B;  5B0Y B;  3VH6 T;  2NQB B;  4LD9 C;  3REJ D;  3X1V B;  5JRG A;  2RIQ A;  3W99 A;  1WWI A;  4LD9 D;  1KX5 C;  5AV5 A;  3AV2 A;  2PYO C;  3AZE A;  2LY8 A;  4WU9 C;  1EQZ B;  4ZUX C;  3UT9 B;  1P34 C;  1P3A C;  1KX5 D;  2JCH A;  2PYO D;  3WAA B;  3C1B A;  5B32 A;  2Y2G A;  4WU9 D;  2Y2K A;  2DQN C;  3H0L C;  4ZUX D;  3X1S D;  4YS3 C;  3REK C;  1BH8 A;  1P34 D;  3AYW C;  1P3A D;  1M1A B;  3MGR C;  4H9R B;  3REL C;  3AZH B;  2ZY2 A;  5AY8 C;  3REK D;  1B6W A;  3W98 D;  4YS3 D;  3AZN B;  3AYW D;  1AOI C;  4CSR A;  5JRG B;  3MGR D;  3REL D;  5AY8 D;  3O62 B;  1P3O C;  3REI C;  3AV1 B;  5AV5 B;  3AV2 B;  1AOI D;  3X1U A;  5CHL B;  4XZQ C;  1P3O D;  3REI D;  4XUJ A;  2G5H C;  5AV6 C;  1P3I A;  3C1B B;  3IP4 C;  4XZQ D;  2L5A A;  3B0B A;  1BH8 B;  5AV6 D;  4WZS B;  3MGP A;  4EO5 C;  2IO5 B;  1B67 A;  5B1M C;  5BNV B;  5GT3 B;  5F99 A;  5BNX B;  4YM6 C;  5CP6 C;  3VH5 W;  5B1M D;  5GT0 B;  3EPJ A;  3H0M C;  1TZY B;  4YM6 D;  5CP6 D;  3B6F A;  3W97 C;  3W96 C;  3B0D B;  5AVC C;  3MGP B;  3W97 D;  1P3L C;  3AZL A;  3W96 D;  2BYM A;  3VH5 A;  1HTA A;  5AVC D;  2FJ7 C;  4Z5T A;  5B31 C;  1A7W A;  1U35 C;  4J8U A;  3WTP C;  3A6N C;  1P3L D;  4QLC D;  2F8N A;  2FJ7 D;  1F66 C;  4H9S A;  5B31 D;  5B2I C;  1U35 D;  5B33 C;  1F66 D;  5GXQ C;  1P3K B;  2UWX A;  5B33 D;  4J8V C;  5GXQ D;  1S32 A;  5CPJ C;  3AZL B;  3NQU A;  5B0Z C;  2BYM B;  4JJN D;  4J8V D;  2HIO C;  1W2E A;  4AWL C;  5CPJ D;  4DRA A;  5B0Z D;  3A1I A;  3AZI A;  2F8N B;  2HIO D;  3AN2 A;  5AV9 C;  3X1T C;  5BO0 B;  1BH9 B;  5C3I B;  1P3P B;  5GSU C;  3KWQ A;  5AV9 D;  3X1T D;  1M19 C;  2F8N G;  1P3F A;  1ZLA C;  5GSU D;  3NQU B;  3MNN A;  1P3B C;  1M19 D;  4Z2M H;  4G92 B;  1M18 A;  3MGQ B;  5B24 C;  3AZI B;  3AZM A;  5CPI A;  1P3B D;  5AVB C;  1P3M B;  1M1A C;  5B24 D;  5DNM C;  4H9P A;  1KX3 A;  3AZG B;  3KUY B;  5AVB D;  3MVD A;  3KWQ B;  4WV4 B;  1M1A D;  1P3G A;  5DNM D;  4HGA C;  2NQB A;  4H9O B;  3W99 C;  3AZF B;  3X1V A;  3FDD A;  2NZD C;  3MNN B;  3AZJ B;  3AZE C;  3W99 D;  3EPH A;  2NZD D;  2ARO B;  5AV5 D;  3LZ1 B;  3R45 A;  1EQZ A;  4R8P B;  3UT9 A;  3AZE D;  5B32 C;  5BS7 A;  4KUD C;  3LEL B;  4H9P B;  1KX3 B;  5B32 D;  5B40 A;  1ID3 C;  3AZH A;  4H9R A;  5CPK A;  1JFI A;  4KUD D;  5B1L A;  3AFA B;  3AZN A;  2HUE B;  1ID3 D;  5AV8 B;  3X1U C;  1HQ3 B;  3KXB B;  3O62 A;  3AV1 A;  3EG5 B;  4ZBJ B;  2Y2I A;  4XUJ C;  3R45 B;  3X1U D;  3TU4 A;  3X1S C;  1P3I C;  3AZK A;  1KX4 B;  2CV5 C;  4XUJ D;  3KFU G;  1P3I D;  2YFV B;  4UUZ B;  5B40 B;  2CV5 D;  4WU8 C;  5CPK B;  1JFI B;  5G49 A;  5B1L B;  5KDM A;  2Y2P A;  4WU8 D;  5F99 C;  5BNV A;  3MGS C;  4G91 C;  5GT3 A;  5BNX A;  2JE5 A;  5F99 D;  3TU4 B;  5GT0 A;  3MGS D;  3B6F C;  3AZK B;  2F8N K;  1TZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...