4YS3B

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3B00
4X23A 4H9SA 3WTPA 3KUYA 3W97B 3WTPE 5B33D 3AV1C 1F66C 4WU8B 5B1LB 1M19D 5F99B 5GXQC 3VH5W 1M18C 3REJB 5DNNC 3WKJC 2RVQC 5GT3D 4KUDA 5GT0D 3REKB 2CV5B 3AYWD 1Q9CA 3AZGC 2LY8A 1M1AB 3AZLA 3X1SB 4R8PC 3W99D 4X23B 3VH5A 4G92B 3AZFD 5CPKC 5BT1D 3AZNB 1P3PD 2PYOD 4QLCC 5B0YD 3MGRD 3O62D 4KHAA 1ID3C 3R45A 2AROB 5JA4A 1P3AC 3KXBB 5B24D 3X1VD 3REHA 2F8NK 1P34D 3X1TC 2NZDA 4KGCD 1F1EA 4XUJD 3UT9C 1BH8A 1N1JA 4KUDB 5B31C 2F8NA 1P3FB 3A6NC 1HQ3C 5B2JD 1P3LC 3AZLB 3MNNA 4WNNA 3WAAA 3B0BA 1B6WA 3MGQC 2NQBB 4HGAB 4XZQB 3AV2D 4ZUXB 3UTBD 4ZBJC 5B40D 1S32A 5B33C 1HTAA 3R45B 5JA4B 5AVCD 1M19C 3NQUA 1P3MA 3C1BD 1P3GD 3B0DB 3KWQB 4J8UA 1AOIA 2BYMA 3B6FD 2IO5B 4LD9A 3AN2D 5GSUA 5AV5D 1N1JB 5GT3C 2F8NB 4CSRA 4AWLB 3C1CA 5E5AA 5GT0C 3AYWC 3REIB 4J8XB 1ZLAC 3MNNB 3WAAB 3W97D 4NFTA 4WU8D 5B1LD 3W99C 2YFVB 5F99D 3AZFC 5BT1C 1P3PC 2PYOC 3REJD 5B0YC 3MGRC 5CPJA 5B1MA 3O62C 1S32B 3NQUB 1P3MB 5B24C 3X1VC 3REKD 2CV5D 1P34C 4J8UB 4LD9B 4KGCC 5GSUB 4XUJC 1M1AD 5BO0A 4CSRB 3X1SD 5E5AB 4JJNA 1R4VA 4Z66A 4X23D 5B2JC 3AFAB 1TZYA 3AZND 3VH6W 5B32A 1P3OA 2CWEA 4WZSB 2AROD 3KXBD 1KX3A 1KX4A 3AV2C 5CPJB 5B1MB 5C3IC 3LJAA 3UTBC 1KX5A 5B40C 5AV9A 3AZEA 4KUDD 5AVCC 1P3FD 3C1BC 1P3GC 3B6FC 3AZKB 3VH6A 2F8NG 4NE6A 3AZLD 3AN2C 5AV5C 5AV6A 3B0CT 4Z66B 2NQBD 2JSSA 4XZQD 4WU9A 3W98B 3WA9A 4ZUXD 2BYKB 3W97C 4H9QA 4H9NB 4WU8C 5B1LC 1KX3B 1KX4B 5F99C 1U35A 3KWQD 5B0ZA 4DRBA 3REJC 3LJAB 4YM6A 5AV9B 3AZEB 3AZIA 3AZMA 2F8ND 1WWIA 3REKC 2CV5C 1F66A 4EO5B 3REID 4J8XD 3MNND 5GXQA 3WAAD 5AV6B 1M1AC 1ULYA 5DNMA 3NQJA 4H9OA 2L5AA 5DNNA 3X1SC 5G49B 4X23C 4CAYA 5JRGA 3AZJB 4G91B 3WA9B 4G92C 4UUZA 3AZNC 3MGSA 4J8WB 3UTAA 5CPIB 4H9QB 1S32D 5B2IA 3AZGA 2AROC 1BFMA 1P3MD 3KXBC 3LELC 3WTPB 4J8UD 3KUYB 4LD9D 4YM6B 3AZHA 5GSUD 3AZIB 3AZMB 4KUDC 5E5AD 1P3FC 2FJ7A 1P3AA 3AFAD 4YS3A 1EQZA 1KU5A 3AZLC 3X1TA 5DNMB 4J8VA 5AV8A 2NQBC 4CAYB 4HGAC 5JRGB 4XZQC 4UUZB 3MGSB 3UTAB 4ZUXC 5CPJD 5B1MD 2F8NH 5B2IB 3TU4A 3B6GA 3B0DC 3KWQC 3MGQA 3AZKD 2IO5C 3AZHB 4KHAB 4AWLC 4Z66D 3REHB 3RELA 2FJ7B 1P3KA 5B33A 4YS3B 3W98D 2NZDB 1EQZB 3REIC 4J8XC 3MNNC 3WAAC 1BH8B 5FUGA 5CHLB 4J8VB 5AV8B 1KX3D 1KX4D 5GT3A 3LJAD 4WNNB 3VH5T 5AV9D 3AZED 1S32C 3AYWA 5AY8A 1ZLAA 1A7WA 3TU4B 1P3MC 3B6GB 4J8UC 4LD9C 5AV6D 3AZFA 1P3PA 3KSYA 2PYOA 5E5AC 5B0YA 3MGRA 3RELB 4ZBJB 5CP6A 1P3KB 3AZJD 3W96A 1AOIB 1H3OA 3WA9D 2BYMB 2HIOA 5AVBA 3AFAC 5B24A 4J8WD 3X1VA 5CPID 3C1CB 4XUJA 3WTPD 3KUYD 4YM6D 5BS7C 5CPJC 5B1MC 3AZID 5AY8B 3AZMD 1ZLAB 1P3IA 3AZKC 1P3BA 5DNMD 5BNVA 5CP6B 4Z66C 3UTBA 4Z5TA 5JRGD 5B40A 3LZ1A 1H3OB 3W96B 2HIOB 5AVBB 3W98C 1JFIA 2YFWA 3MGSD 3UTAD 5BO0B 5B2ID 4JJNB 5BNXA 3MVDA 3AN2A 1KX3C 1KX4C 1TZYB 3X1UA 3AZHD 3LJAC 3MGPA 5B32B 5AV9C 3AZEC 1P3OB 3LZ0A 1P3IB 2FJ7D 3REHD 4YS3D 4WU8A 2NZDD 1EQZD 4EO5C 1P3BB 1KX5B 5AV6C 3V9RA 5AV8D 4J8VD 3REJA 4Z5TB 4E45A 3LZ1B 3AZJC 3AV1A 4G91C 3WA9C 4J8WC 4H9PA 5CPIC 3REKA 1M18A 2CV5A 2HUEB 3MVDB 3WKJA 3TU4D 4WU9B 1M1AA 4H9SC 3B6GD 3X1UB 3WTPC 3KUYC 4YM6C 3MGPB 1B67A 3LZ0B 3AZMC 3AZNA 3AZIC 3RELD 1U35B 1P3KD 1AOID 5B0ZB 2AROA 4R8PA 3KXBA 3LELA 4NE3A 5CPKA 5DNMC 3VH6T 3V9RB 3C1CD 4QLCA 5JRGC 3AV1B 1ID3A 1F66B 1P3FA 3MGSC 4H9PB 5GXQB 3UTAC 1M18B 1TAFA 3NQJB 4H9OB 5AY8D 5DNNB 5B2IC 1ZLAD 3WKJB 3UT9A 5B31A 2NQBA 5B32G 3A6NA 3AZHC 1HQ3A 4XZQA 3AZGB 1P3LA 4ZUXA 5CP6D 2FJ7C 3REHC 4E44A 3W96D 4Z2MG 2HIOD 5AVBD 4R8PB 4YS3C 2NZDC 1EQZC 3LELB 5CPKB 4DRAA 3KWQA 4QLCB 4J8VC 5AV8C 4JJND 1ID3B 1P3AB 1TZYD 1M19A 1TAFB 3X1TB 5B32D 1P3OD 3REIA 4J8XA 1P3ID 3UT9B 3TU4C 3B6GC 1BH9A 5B31B 5GT0A 3A6NB 1HQ3B 2YFVA 1P3BD 1KX5D 1P3LB 3B0CW 3RELC 4Z5TD 3LZ1D 1P3KC 1AOIC 3MGQB 3W99A 5GSUC 3C1CC 3MVDD 3O62A 5B33B 4WU9D 3X1UD 1WWSA 1M19B 3MGPD 5FUGB 1P34A 3LZ0D 5AY8C 3AFAA 4H9RA 4KGCA 5GT3B 1U35D 1BH9B 5B0ZD 5GT0B 5B2JA 3AYWB 5BS7A 5CP6C 3AV1D 3W96C 1F66D 4M6BA 2HIOC 5AVBC 3W99B 4NE5A 5GXQD 3AZFB 1M18D 5KDMA 3AV2A 4WV4B 1P3PB 2PYOB 5DNND 5B0YB 3MGRB 3AZKA 3WKJD 4JJNC 2RVQD 3O62B 1TZYC 5AVCA 4Z2MH 5B24B 3X1VB 3C1BA 1P34B 1P3GA 3B6FA 5B32C 4H9RB 3AZGD 1P3OC 3W98A 4KGCB 5B31G 4XUJB 1P3IC 2BYKA 5AV5A 4H9NA 4R8PD 3LELD 1P3BC 5B2JB 5CPKD 1KX5C 4QLCD 4Z5TC 3W97A 3LZ1C 1ID3D 1P3AD 5B1LA 5F99A 5KDMB 3X1TD 3AV2B 5BNVB 2HUEC 5C3IB 3UTBB 3MVDC 5B40B 3UT9D 4WU9C 5B31D 5AVCB 1JFIB 3X1UC 2YFWB 3A6ND 5G49A 1HQ3D 3C1BB 1P3GB 3MGPC 3AZJA 3B6FB 1P3LD 3LZ0C 5BNXB 3AN2B 4J8WA 5AV5B 5CPIA 1U35C 3X1SA 5B0ZC 3MGQD
chains in the Genus database with same CATH superfamily
4X23A 4H9SA 3WTPA 3KUYA 3W97B 3WTPE 5B33D 3AV1C 1F66C 4WU8B 5B1LB 1M19D 2ZY3A 5F99B 5GXQC 3VH5W 1M18C 2Y2IA 3REJB 5DNNC 3WKJC 2RVQC 5GT3D 4KUDA 5GT0D 3REKB 2CV5B 3AYWD 1Q9CA 3AZGC 2LY8A 1M1AB 3AZLA 3X1SB 4R8PC 3W99D 4X23B 3VH5A 4G92B 3AZFD 5CPKC 5BT1D 3AZNB 1P3PD 2PYOD 4QLCC 5B0YD 3MGRD 3O62D 4KHAA 1ID3C 3R45A 2AROB 5JA4A 1P3AC 3KXBB 5B24D 1PZRA 2Y2MA 3REHA 3X1VD 2F8NK 1P34D 2JE5A 3X1TC 2NZDA 4KGCD 1F1EA 4XUJD 3UT9C 1BH8A 1N1JA 4KUDB 5B31C 2F8NA 1P3FB 3A6NC 1HQ3C 4DQYB 5B2JD 1P3LC 3AZLB 3MNNA 4WNNA 3WAAA 1T3UA 3B0BA 1B6WA 3MGQC 2NQBB 4HGAB 4XZQB 3AV2D 4ZUXB 3UTBD 4ZBJC 5B40D 1S32A 5B33C 1HTAA 3R45B 5JA4B 5AVCD 1M19C 3NQUA 1P3MA 3C1BD 1P3GD 3B0DB 3KWQB 4J8UA 1AOIA 2BYMA 3B6FD 2IO5B 4LD9A 3AN2D 5GSUA 5AV5D 1N1JB 5GT3C 2F8NB 4CSRA 4AWLB 3C1CA 5E5AA 5GT0C 3AYWC 3H0LC 4J8XB 3REIB 1ZLAC 3MNNB 3WAAB 3W97D 4NFTA 4WU8D 5B1LD 3W99C 2YFVB 5F99D 2DF4C 3AZFC 5BT1C 1P3PC 2PYOC 3REJD 5B0YC 3MGRC 5CPJA 5B1MA 3O62C 2Y2HA 1S32B 2Y2QA 3NQUB 2G5HC 1P3MB 5B24C 3X1VC 3REKD 2CV5D 1P34C 4J8UB 3EPHA 4LD9B 4KGCC 5GSUB 4XUJC 1M1AD 5BO0A 4CSRB 3X1SD 5E5AB 4JJNA 1R4VA 4Z66A 4X23D 5B2JC 3AFAB 1TZYA 3AZND 3VH6W 2ZY5A 5B32A 1P3OA 2CWEA 4WZSB 2AROD 3KXBD 1KX3A 1KX4A 3AV2C 5CPJB 2Y2PA 5B1MB 5C3IC 2Y2OA 3LJAA 3UTBC 5B40C 1KX5A 5AV9A 3AZEA 4KUDD 5AVCC 1P3FD 3C1BC 1P3GC 2Y2LA 3B6FC 3AZKB 3VH6A 2XD5A 2F8NG 4NE6A 3AZLD 3AN2C 5AV5C 5AV6A 3H0MC 3EPKA 3B0CT 4Z66B 2NQBD 2JSSA 4XZQD 4WU9A 3W98B 3WA9A 3A1KA 4ZUXD 2BYKB 3W97C 4H9QA 4H9NB 4WU8C 5B1LC 2Y2JA 1KX3B 1KX4B 5F99C 1U35A 3KWQD 5B0ZA 4DRBA 3REJC 3LJAB 4YM6A 5AV9B 3AZEB 3AL0C 3AZIA 3AZMA 2F8ND 1WWIA 3REKC 2CV5C 1F66A 4EO5B 3REID 4J8XD 3MNND 5GXQA 3WAAD 5AV6B 1M1AC 1ULYA 5DNMA 3NQJA 4H9OA 2L5AA 5DNNA 3X1SC 5G49B 4X23C 4CAYA 5JRGA 3AZJB 4G91B 3WA9B 4G92C 4UUZA 3AZNC 3MGSA 4J8WB 3UTAA 5CPIB 4H9QB 1S32D 5B2IA 3AZGA 2AROC 1BFMA 1P3MD 3KXBC 3LELC 3WTPB 4J8UD 3KUYB 2F2AC 4LD9D 4YM6B 3AZHA 5GSUD 3AZIB 3AZMB 4KUDC 5E5AD 1P3FC 2FJ7A 1P3AA 3AFAD 4YS3A 1EQZA 1KU5A 3AZLC 3EPLA 3X1TA 5DNMB 4J8VA 5AV8A 2NQBC 4CAYB 4HGAC 5JRGB 4XZQC 4UUZB 3EG5B 2J8PA 3MGSB 3UTAB 4ZUXC 5CPJD 5B1MD 2F8NH 5B2IB 3TU4A 3B6GA 3B0DC 3KWQC 3MGQA 3AZKD 2IO5C 3AZHB 4KHAB 4AWLC 4Z66D 3REHB 3RELA 2FJ7B 1P3KA 2ZM5A 5B33A 4YS3B 3W98D 2NZDB 1EQZB 3REIC 4J8XC 3MNNC 3WAAC 1BH8B 5FUGA 1Z2CB 5CHLB 5AV8B 4J8VB 3A1IA 1KX3D 1KX4D 5GT3A 3LJAD 4WNNB 3VH5T 5AV9D 3AZED 1S32C 3AYWA 5AY8A 1ZLAA 1A7WA 3TU4B 1P3MC 3B6GB 4J8UC 4LD9C 5AV6D 3AZFA 1P3PA 3FDDA 3KSYA 2PYOA 5E5AC 5B0YA 3MGRA 3RELB 4ZBJB 5CP6A 1P3KB 3AZJD 3W96A 1AOIB 1H3OA 3WA9D 2BYMB 2HIOA 5AVBA 3AFAC 5B24A 4J8WD 3X1VA 5CPID 3C1CB 4XUJA 2FFFB 3WTPD 3KUYD 4YM6D 5BS7C 5CPJC 5B1MC 3AZID 5AY8B 3AZMD 1ZLAB 2W8SA 1P3IA 3F6TA 3AZKC 2DQNC 1P3BA 5DNMD 5BNVA 5CP6B 4Z66C 3UTBA 4Z5TA 5JRGD 5B40A 3LZ1A 1H3OB 3W96B 2HIOB 5AVBB 3W98C 1JFIA 2YFWA 3MGSD 3UTAD 5BO0B 5B2ID 2BG1A 4JJNB 5BNXA 3MVDA 3AN2A 1KX3C 1KX4C 1TZYB 3X1UA 3AZHD 3LJAC 3MGPA 5B32B 5AV9C 3AZEC 1P3OB 3LZ0A 1P3IB 2FJ7D 3REHD 4WU8A 4YS3D 2NZDD 1EQZD 4EO5C 1P3BB 1KX5B 5AV6C 4UPKA 3V9RA 5AV8D 4J8VD 3REJA 4Z5TB 4E45A 3LZ1B 3H0RC 3AZJC 3AV1A 4G91C 3WA9C 4J8WC 4H9PA 5CPIC 3REKA 1M18A 2CV5A 2HUEB 3MVDB 3WKJA 3TU4D 4WU9B 1M1AA 4H9SC 3B6GD 3X1UB 3WTPC 3KUYC 4YM6C 3MGPB 1B67A 3LZ0B 3AZMC 3AZNA 3AZIC 3RELD 1U35B 1P3KD 1AOID 5B0ZB 2AROA 4R8PA 3KXBA 3LELA 4NE3A 3IP4C 5CPKA 5DNMC 3VH6T 3V9RB 3C1CD 4QLCA 5JRGC 3AV1B 1ID3A 1F66B 1P3FA 3MGSC 4H9PB 5GXQB 3UTAC 1M18B 1TAFA 3NQJB 4H9OB 5AY8D 5DNNB 5B2IC 1ZLAD 3WKJB 3UT9A 5B31A 2NQBA 5B32G 3A6NA 3AZHC 1HQ3A 4XZQA 2UWXA 2XD1A 3AZGB 1P3LA 4ZUXA 5CP6D 2FJ7C 3REHC 4E44A 3W96D 4Z2MG 2HIOD 5AVBD 4R8PB 4YS3C 2NZDC 3EPJA 1EQZC 3KFUG 3LELB 5CPKB 4DRAA 3KWQA 4QLCB 4J8VC 5AV8C 4JJND 1ID3B 1P3AB 1TZYD 1M19A 2Y2GA 1TAFB 3X1TB 5B32D 1P3OD 3REIA 4J8XA 1P3ID 3UT9B 3TU4C 3B6GC 1BH9A 5B31B 5GT0A 3A6NB 1HQ3B 2YFVA 1P3BD 1KX5D 1P3LB 3B0CW 3RELC 4Z5TD 3LZ1D 1P3KC 1AOIC 3MGQB 3W99A 5GSUC 3C1CC 3MVDD 2Y2NA 3O62A 5B33B 4WU9D 3X1UD 1WWSA 1M19B 2ZY4A 3MGPD 5FUGB 1P34A 4WJ3C 3LZ0D 5AY8C 3AFAA 4H9RA 4KGCA 5GT3B 1U35D 1BH9B 5B0ZD 5GT0B 2Y2KA 3P5JB 5B2JA 3AYWB 5BS7A 5CP6C 3AV1D 3W96C 1F66D 4M6BA 2HIOC 5AVBC 3W99B 4NE5A 5GXQD 1W2EA 3AZFB 1M18D 5KDMA 3AV2A 4WV4B 1P3PB 2PYOB 5DNND 5B0YB 3MGRB 3AZKA 3WKJD 4JJNC 2RVQD 3O62B 2G5IC 1TZYC 5AVCA 4Z2MH 5B24B 3X1VB 3C1BA 1P34B 1P3GA 3B6FA 5B32C 4H9RB 3AZGD 1P3OC 3W98A 4KGCB 5B31G 4XUJB 1P3IC 2BYKA 5AV5A 2JCHA 4H9NA 4R8PD 3LELD 1P3BC 5B2JB 5CPKD 1KX5C 4QLCD 2ZY2A 4Z5TC 3W97A 3LZ1C 1ID3D 1P3AD 2RIQA 5B1LA 5F99A 5KDMB 3X1TD 3AV2B 5BNVB 2HUEC 5C3IB 3UTBB 3MVDC 5B40B 3UT9D 2VQRA 4WU9C 5B31D 5AVCB 1JFIB 2YFWB 3X1UC 3A6ND 5G49A 1HQ3D 3C1BB 1P3GB 3MGPC 3AZJA 3B6FB 1P3LD 3LZ0C 5BNXB 3AN2B 4J8WA 5AV5B 5CPIA 1U35C 3X1SA 5B0ZC 3MGQD
chains in the Genus database with same CATH topology
4X23A 4H9SA 3WTPA 3KUYA 3W97B 3WTPE 5B33D 3AV1C 1F66C 4WU8B 5B1LB 1M19D 2ZY3A 5F99B 5GXQC 3VH5W 1M18C 2Y2IA 3REJB 5DNNC 3WKJC 2RVQC 5GT3D 4KUDA 5GT0D 3REKB 2CV5B 3AYWD 1Q9CA 3AZGC 2LY8A 1M1AB 3AZLA 3X1SB 4R8PC 3W99D 4X23B 3VH5A 4G92B 3AZFD 5CPKC 5BT1D 3AZNB 1P3PD 2PYOD 4QLCC 5B0YD 3MGRD 3O62D 4KHAA 1ID3C 3R45A 2AROB 5JA4A 1P3AC 3KXBB 5B24D 1PZRA 2Y2MA 3REHA 3X1VD 2F8NK 1P34D 2JE5A 3X1TC 2NZDA 4KGCD 1F1EA 4XUJD 3UT9C 1BH8A 1N1JA 4KUDB 5B31C 2F8NA 1P3FB 3A6NC 1HQ3C 4DQYB 5B2JD 1P3LC 3AZLB 3MNNA 4WNNA 3WAAA 1T3UA 3B0BA 1B6WA 3MGQC 2NQBB 4HGAB 4XZQB 3AV2D 4ZUXB 3UTBD 4ZBJC 5B40D 1S32A 5B33C 1HTAA 3R45B 5JA4B 5AVCD 1M19C 3NQUA 1P3MA 3C1BD 1P3GD 3B0DB 3KWQB 4J8UA 1AOIA 2BYMA 3B6FD 2IO5B 4LD9A 3AN2D 5GSUA 5AV5D 1N1JB 5GT3C 2F8NB 4CSRA 4AWLB 3C1CA 5E5AA 5GT0C 3AYWC 3H0LC 4J8XB 3REIB 1ZLAC 3MNNB 3WAAB 3W97D 4NFTA 4WU8D 5B1LD 3W99C 2YFVB 5F99D 2DF4C 3AZFC 5BT1C 1P3PC 2PYOC 3REJD 5B0YC 3MGRC 5CPJA 5B1MA 3O62C 2Y2HA 1S32B 2Y2QA 3NQUB 2G5HC 1P3MB 5B24C 3X1VC 3REKD 2CV5D 1P34C 4J8UB 3EPHA 4LD9B 4KGCC 5GSUB 4XUJC 1M1AD 5BO0A 4CSRB 3X1SD 5E5AB 4JJNA 1R4VA 4Z66A 4X23D 5B2JC 3AFAB 1TZYA 3AZND 3VH6W 2ZY5A 5B32A 1P3OA 2CWEA 4WZSB 2AROD 3KXBD 1KX3A 1KX4A 3AV2C 5CPJB 2Y2PA 5B1MB 5C3IC 2Y2OA 3LJAA 3UTBC 5B40C 1KX5A 5AV9A 3AZEA 4KUDD 5AVCC 1P3FD 3C1BC 1P3GC 2Y2LA 3B6FC 3AZKB 3VH6A 2XD5A 2F8NG 4NE6A 3AZLD 3AN2C 5AV5C 5AV6A 3H0MC 3EPKA 3B0CT 4Z66B 2NQBD 2JSSA 4XZQD 4WU9A 3W98B 3WA9A 3A1KA 4ZUXD 2BYKB 3W97C 4H9QA 4H9NB 4WU8C 5B1LC 2Y2JA 1KX3B 1KX4B 5F99C 1U35A 3KWQD 5B0ZA 4DRBA 3REJC 3LJAB 4YM6A 5AV9B 3AZEB 3AL0C 3AZIA 3AZMA 2F8ND 1WWIA 3REKC 2CV5C 1F66A 4EO5B 3REID 4J8XD 3MNND 5GXQA 3WAAD 5AV6B 1M1AC 1ULYA 5DNMA 3NQJA 4H9OA 2L5AA 5DNNA 3X1SC 5G49B 4X23C 4CAYA 5JRGA 3AZJB 4G91B 3WA9B 4G92C 4UUZA 3AZNC 3MGSA 4J8WB 3UTAA 5CPIB 4H9QB 1S32D 5B2IA 3AZGA 2AROC 1BFMA 1P3MD 3KXBC 3LELC 3WTPB 4J8UD 3KUYB 2F2AC 4LD9D 4YM6B 3AZHA 5GSUD 3AZIB 3AZMB 4KUDC 5E5AD 1P3FC 2FJ7A 1P3AA 3AFAD 4YS3A 1EQZA 1KU5A 3AZLC 3EPLA 3X1TA 5DNMB 4J8VA 5AV8A 2NQBC 4CAYB 4HGAC 5JRGB 4XZQC 4UUZB 3EG5B 2J8PA 3MGSB 3UTAB 4ZUXC 5CPJD 5B1MD 2F8NH 5B2IB 3TU4A 3B6GA 3B0DC 3KWQC 3MGQA 3AZKD 2IO5C 3AZHB 4KHAB 4AWLC 4Z66D 3REHB 3RELA 2FJ7B 1P3KA 2ZM5A 5B33A 4YS3B 3W98D 2NZDB 1EQZB 3REIC 4J8XC 3MNNC 3WAAC 1BH8B 5FUGA 1Z2CB 5CHLB 5AV8B 4J8VB 3A1IA 1KX3D 1KX4D 5GT3A 3LJAD 4WNNB 3VH5T 5AV9D 3AZED 1S32C 3AYWA 5AY8A 1ZLAA 1A7WA 3TU4B 1P3MC 3B6GB 4J8UC 4LD9C 5AV6D 3AZFA 1P3PA 3FDDA 3KSYA 2PYOA 5E5AC 5B0YA 3MGRA 3RELB 4ZBJB 5CP6A 1P3KB 3AZJD 3W96A 1AOIB 1H3OA 3WA9D 2BYMB 2HIOA 5AVBA 3AFAC 5B24A 4J8WD 3X1VA 5CPID 3C1CB 4XUJA 2FFFB 3WTPD 3KUYD 4YM6D 5BS7C 5CPJC 5B1MC 3AZID 5AY8B 3AZMD 1ZLAB 2W8SA 1P3IA 3F6TA 3AZKC 2DQNC 1P3BA 5DNMD 5BNVA 5CP6B 4Z66C 3UTBA 4Z5TA 5JRGD 5B40A 3LZ1A 1H3OB 3W96B 2HIOB 5AVBB 3W98C 1JFIA 2YFWA 3MGSD 3UTAD 5BO0B 5B2ID 2BG1A 4JJNB 5BNXA 3MVDA 3AN2A 1KX3C 1KX4C 1TZYB 3X1UA 3AZHD 3LJAC 3MGPA 5B32B 5AV9C 3AZEC 1P3OB 3LZ0A 1P3IB 2FJ7D 3REHD 4WU8A 4YS3D 2NZDD 1EQZD 4EO5C 1P3BB 1KX5B 5AV6C 4UPKA 3V9RA 5AV8D 4J8VD 3REJA 4Z5TB 4E45A 3LZ1B 3H0RC 3AZJC 3AV1A 4G91C 3WA9C 4J8WC 4H9PA 5CPIC 3REKA 1M18A 2CV5A 2HUEB 3MVDB 3WKJA 3TU4D 4WU9B 1M1AA 4H9SC 3B6GD 3X1UB 3WTPC 3KUYC 4YM6C 3MGPB 1B67A 3LZ0B 3AZMC 3AZNA 3AZIC 3RELD 1U35B 1P3KD 1AOID 5B0ZB 2AROA 4R8PA 3KXBA 3LELA 4NE3A 3IP4C 5CPKA 5DNMC 3VH6T 3V9RB 3C1CD 4QLCA 5JRGC 3AV1B 1ID3A 1F66B 1P3FA 3MGSC 4H9PB 5GXQB 3UTAC 1M18B 1TAFA 3NQJB 4H9OB 5AY8D 5DNNB 5B2IC 1ZLAD 3WKJB 3UT9A 5B31A 2NQBA 5B32G 3A6NA 3AZHC 1HQ3A 4XZQA 2UWXA 2XD1A 3AZGB 1P3LA 4ZUXA 5CP6D 2FJ7C 3REHC 4E44A 3W96D 4Z2MG 2HIOD 5AVBD 4R8PB 4YS3C 2NZDC 3EPJA 1EQZC 3KFUG 3LELB 5CPKB 4DRAA 3KWQA 4QLCB 4J8VC 5AV8C 4JJND 1ID3B 1P3AB 1TZYD 1M19A 2Y2GA 1TAFB 3X1TB 5B32D 1P3OD 3REIA 4J8XA 1P3ID 3UT9B 3TU4C 3B6GC 1BH9A 5B31B 5GT0A 3A6NB 1HQ3B 2YFVA 1P3BD 1KX5D 1P3LB 3B0CW 3RELC 4Z5TD 3LZ1D 1P3KC 1AOIC 3MGQB 3W99A 5GSUC 3C1CC 3MVDD 2Y2NA 3O62A 5B33B 4WU9D 3X1UD 1WWSA 1M19B 2ZY4A 3MGPD 5FUGB 1P34A 4WJ3C 3LZ0D 5AY8C 3AFAA 4H9RA 4KGCA 5GT3B 1U35D 1BH9B 5B0ZD 5GT0B 2Y2KA 3P5JB 5B2JA 3AYWB 5BS7A 5CP6C 3AV1D 3W96C 1F66D 4M6BA 2HIOC 5AVBC 3W99B 4NE5A 5GXQD 1W2EA 3AZFB 1M18D 5KDMA 3AV2A 4WV4B 1P3PB 2PYOB 5DNND 5B0YB 3MGRB 3AZKA 3WKJD 4JJNC 2RVQD 3O62B 2G5IC 1TZYC 5AVCA 4Z2MH 5B24B 3X1VB 3C1BA 1P34B 1P3GA 3B6FA 5B32C 4H9RB 3AZGD 1P3OC 3W98A 4KGCB 5B31G 4XUJB 1P3IC 2BYKA 5AV5A 2JCHA 4H9NA 4R8PD 3LELD 1P3BC 5B2JB 5CPKD 1KX5C 4QLCD 2ZY2A 4Z5TC 3W97A 3LZ1C 1ID3D 1P3AD 2RIQA 5B1LA 5F99A 5KDMB 3X1TD 3AV2B 5BNVB 2HUEC 5C3IB 3UTBB 3MVDC 5B40B 3UT9D 2VQRA 4WU9C 5B31D 5AVCB 1JFIB 2YFWB 3X1UC 3A6ND 5G49A 1HQ3D 3C1BB 1P3GB 3MGPC 3AZJA 3B6FB 1P3LD 3LZ0C 5BNXB 3AN2B 4J8WA 5AV5B 5CPIA 1U35C 3X1SA 5B0ZC 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 A;  4H9S A;  3WTP A;  3KUY A;  3W97 B;  3WTP E;  5B33 D;  3AV1 C;  1F66 C;  4WU8 B;  5B1L B;  1M19 D;  5F99 B;  5GXQ C;  3VH5 W;  1M18 C;  3REJ B;  5DNN C;  3WKJ C;  2RVQ C;  5GT3 D;  4KUD A;  5GT0 D;  3REK B;  2CV5 B;  3AYW D;  1Q9C A;  3AZG C;  2LY8 A;  1M1A B;  3AZL A;  3X1S B;  4R8P C;  3W99 D;  4X23 B;  3VH5 A;  4G92 B;  3AZF D;  5CPK C;  5BT1 D;  3AZN B;  1P3P D;  2PYO D;  4QLC C;  5B0Y D;  3MGR D;  3O62 D;  4KHA A;  1ID3 C;  3R45 A;  2ARO B;  5JA4 A;  1P3A C;  3KXB B;  5B24 D;  3X1V D;  3REH A;  2F8N K;  1P34 D;  3X1T C;  2NZD A;  4KGC D;  1F1E A;  4XUJ D;  3UT9 C;  1BH8 A;  1N1J A;  4KUD B;  5B31 C;  2F8N A;  1P3F B;  3A6N C;  1HQ3 C;  5B2J D;  1P3L C;  3AZL B;  3MNN A;  4WNN A;  3WAA A;  3B0B A;  1B6W A;  3MGQ C;  2NQB B;  4HGA B;  4XZQ B;  3AV2 D;  4ZUX B;  3UTB D;  4ZBJ C;  5B40 D;  1S32 A;  5B33 C;  1HTA A;  3R45 B;  5JA4 B;  5AVC D;  1M19 C;  3NQU A;  1P3M A;  3C1B D;  1P3G D;  3B0D B;  3KWQ B;  4J8U A;  1AOI A;  2BYM A;  3B6F D;  2IO5 B;  4LD9 A;  3AN2 D;  5GSU A;  5AV5 D;  1N1J B;  5GT3 C;  2F8N B;  4CSR A;  4AWL B;  3C1C A;  5E5A A;  5GT0 C;  3AYW C;  3REI B;  4J8X B;  1ZLA C;  3MNN B;  3WAA B;  3W97 D;  4NFT A;  4WU8 D;  5B1L D;  3W99 C;  2YFV B;  5F99 D;  3AZF C;  5BT1 C;  1P3P C;  2PYO C;  3REJ D;  5B0Y C;  3MGR C;  5CPJ A;  5B1M A;  3O62 C;  1S32 B;  3NQU B;  1P3M B;  5B24 C;  3X1V C;  3REK D;  2CV5 D;  1P34 C;  4J8U B;  4LD9 B;  4KGC C;  5GSU B;  4XUJ C;  1M1A D;  5BO0 A;  4CSR B;  3X1S D;  5E5A B;  4JJN A;  1R4V A;  4Z66 A;  4X23 D;  5B2J C;  3AFA B;  1TZY A;  3AZN D;  3VH6 W;  5B32 A;  1P3O A;  2CWE A;  4WZS B;  2ARO D;  3KXB D;  1KX3 A;  1KX4 A;  3AV2 C;  5CPJ B;  5B1M B;  5C3I C;  3LJA A;  3UTB C;  1KX5 A;  5B40 C;  5AV9 A;  3AZE A;  4KUD D;  5AVC C;  1P3F D;  3C1B C;  1P3G C;  3B6F C;  3AZK B;  3VH6 A;  2F8N G;  4NE6 A;  3AZL D;  3AN2 C;  5AV5 C;  5AV6 A;  3B0C T;  4Z66 B;  2NQB D;  2JSS A;  4XZQ D;  4WU9 A;  3W98 B;  3WA9 A;  4ZUX D;  2BYK B;  3W97 C;  4H9Q A;  4H9N B;  4WU8 C;  5B1L C;  1KX3 B;  1KX4 B;  5F99 C;  1U35 A;  3KWQ D;  5B0Z A;  4DRB A;  3REJ C;  3LJA B;  4YM6 A;  5AV9 B;  3AZE B;  3AZI A;  3AZM A;  2F8N D;  1WWI A;  3REK C;  2CV5 C;  1F66 A;  4EO5 B;  3REI D;  4J8X D;  3MNN D;  5GXQ A;  3WAA D;  5AV6 B;  1M1A C;  1ULY A;  5DNM A;  3NQJ A;  4H9O A;  2L5A A;  5DNN A;  3X1S C;  5G49 B;  4X23 C;  4CAY A;  5JRG A;  3AZJ B;  4G91 B;  3WA9 B;  4G92 C;  4UUZ A;  3AZN C;  3MGS A;  4J8W B;  3UTA A;  5CPI B;  4H9Q B;  1S32 D;  5B2I A;  3AZG A;  2ARO C;  1BFM A;  1P3M D;  3KXB C;  3LEL C;  3WTP B;  4J8U D;  3KUY B;  4LD9 D;  4YM6 B;  3AZH A;  5GSU D;  3AZI B;  3AZM B;  4KUD C;  5E5A D;  1P3F C;  2FJ7 A;  1P3A A;  3AFA D;  4YS3 A;  1EQZ A;  1KU5 A;  3AZL C;  3X1T A;  5DNM B;  4J8V A;  5AV8 A;  2NQB C;  4CAY B;  4HGA C;  5JRG B;  4XZQ C;  4UUZ B;  3MGS B;  3UTA B;  4ZUX C;  5CPJ D;  5B1M D;  2F8N H;  5B2I B;  3TU4 A;  3B6G A;  3B0D C;  3KWQ C;  3MGQ A;  3AZK D;  2IO5 C;  3AZH B;  4KHA B;  4AWL C;  4Z66 D;  3REH B;  3REL A;  2FJ7 B;  1P3K A;  5B33 A;  4YS3 B;  3W98 D;  2NZD B;  1EQZ B;  3REI C;  4J8X C;  3MNN C;  3WAA C;  1BH8 B;  5FUG A;  5CHL B;  4J8V B;  5AV8 B;  1KX3 D;  1KX4 D;  5GT3 A;  3LJA D;  4WNN B;  3VH5 T;  5AV9 D;  3AZE D;  1S32 C;  3AYW A;  5AY8 A;  1ZLA A;  1A7W A;  3TU4 B;  1P3M C;  3B6G B;  4J8U C;  4LD9 C;  5AV6 D;  3AZF A;  1P3P A;  3KSY A;  2PYO A;  5E5A C;  5B0Y A;  3MGR A;  3REL B;  4ZBJ B;  5CP6 A;  1P3K B;  3AZJ D;  3W96 A;  1AOI B;  1H3O A;  3WA9 D;  2BYM B;  2HIO A;  5AVB A;  3AFA C;  5B24 A;  4J8W D;  3X1V A;  5CPI D;  3C1C B;  4XUJ A;  3WTP D;  3KUY D;  4YM6 D;  5BS7 C;  5CPJ C;  5B1M C;  3AZI D;  5AY8 B;  3AZM D;  1ZLA B;  1P3I A;  3AZK C;  1P3B A;  5DNM D;  5BNV A;  5CP6 B;  4Z66 C;  3UTB A;  4Z5T A;  5JRG D;  5B40 A;  3LZ1 A;  1H3O B;  3W96 B;  2HIO B;  5AVB B;  3W98 C;  1JFI A;  2YFW A;  3MGS D;  3UTA D;  5BO0 B;  5B2I D;  4JJN B;  5BNX A;  3MVD A;  3AN2 A;  1KX3 C;  1KX4 C;  1TZY B;  3X1U A;  3AZH D;  3LJA C;  3MGP A;  5B32 B;  5AV9 C;  3AZE C;  1P3O B;  3LZ0 A;  1P3I B;  2FJ7 D;  3REH D;  4YS3 D;  4WU8 A;  2NZD D;  1EQZ D;  4EO5 C;  1P3B B;  1KX5 B;  5AV6 C;  3V9R A;  5AV8 D;  4J8V D;  3REJ A;  4Z5T B;  4E45 A;  3LZ1 B;  3AZJ C;  3AV1 A;  4G91 C;  3WA9 C;  4J8W C;  4H9P A;  5CPI C;  3REK A;  1M18 A;  2CV5 A;  2HUE B;  3MVD B;  3WKJ A;  3TU4 D;  4WU9 B;  1M1A A;  4H9S C;  3B6G D;  3X1U B;  3WTP C;  3KUY C;  4YM6 C;  3MGP B;  1B67 A;  3LZ0 B;  3AZM C;  3AZN A;  3AZI C;  3REL D;  1U35 B;  1P3K D;  1AOI D;  5B0Z B;  2ARO A;  4R8P A;  3KXB A;  3LEL A;  4NE3 A;  5CPK A;  5DNM C;  3VH6 T;  3V9R B;  3C1C D;  4QLC A;  5JRG C;  3AV1 B;  1ID3 A;  1F66 B;  1P3F A;  3MGS C;  4H9P B;  5GXQ B;  3UTA C;  1M18 B;  1TAF A;  3NQJ B;  4H9O B;  5AY8 D;  5DNN B;  5B2I C;  1ZLA D;  3WKJ B;  3UT9 A;  5B31 A;  2NQB A;  5B32 G;  3A6N A;  3AZH C;  1HQ3 A;  4XZQ A;  3AZG B;  1P3L A;  4ZUX A;  5CP6 D;  2FJ7 C;  3REH C;  4E44 A;  3W96 D;  4Z2M G;  2HIO D;  5AVB D;  4R8P B;  4YS3 C;  2NZD C;  1EQZ C;  3LEL B;  5CPK B;  4DRA A;  3KWQ A;  4QLC B;  4J8V C;  5AV8 C;  4JJN D;  1ID3 B;  1P3A B;  1TZY D;  1M19 A;  1TAF B;  3X1T B;  5B32 D;  1P3O D;  3REI A;  4J8X A;  1P3I D;  3UT9 B;  3TU4 C;  3B6G C;  1BH9 A;  5B31 B;  5GT0 A;  3A6N B;  1HQ3 B;  2YFV A;  1P3B D;  1KX5 D;  1P3L B;  3B0C W;  3REL C;  4Z5T D;  3LZ1 D;  1P3K C;  1AOI C;  3MGQ B;  3W99 A;  5GSU C;  3C1C C;  3MVD D;  3O62 A;  5B33 B;  4WU9 D;  3X1U D;  1WWS A;  1M19 B;  3MGP D;  5FUG B;  1P34 A;  3LZ0 D;  5AY8 C;  3AFA A;  4H9R A;  4KGC A;  5GT3 B;  1U35 D;  1BH9 B;  5B0Z D;  5GT0 B;  5B2J A;  3AYW B;  5BS7 A;  5CP6 C;  3AV1 D;  3W96 C;  1F66 D;  4M6B A;  2HIO C;  5AVB C;  3W99 B;  4NE5 A;  5GXQ D;  3AZF B;  1M18 D;  5KDM A;  3AV2 A;  4WV4 B;  1P3P B;  2PYO B;  5DNN D;  5B0Y B;  3MGR B;  3AZK A;  3WKJ D;  4JJN C;  2RVQ D;  3O62 B;  1TZY C;  5AVC A;  4Z2M H;  5B24 B;  3X1V B;  3C1B A;  1P34 B;  1P3G A;  3B6F A;  5B32 C;  4H9R B;  3AZG D;  1P3O C;  3W98 A;  4KGC B;  5B31 G;  4XUJ B;  1P3I C;  2BYK A;  5AV5 A;  4H9N A;  4R8P D;  3LEL D;  1P3B C;  5B2J B;  5CPK D;  1KX5 C;  4QLC D;  4Z5T C;  3W97 A;  3LZ1 C;  1ID3 D;  1P3A D;  5B1L A;  5F99 A;  5KDM B;  3X1T D;  3AV2 B;  5BNV B;  2HUE C;  5C3I B;  3UTB B;  3MVD C;  5B40 B;  3UT9 D;  4WU9 C;  5B31 D;  5AVC B;  1JFI B;  3X1U C;  2YFW B;  3A6N D;  5G49 A;  1HQ3 D;  3C1B B;  1P3G B;  3MGP C;  3AZJ A;  3B6F B;  1P3L D;  3LZ0 C;  5BNX B;  3AN2 B;  4J8W A;  5AV5 B;  5CPI A;  1U35 C;  3X1S A;  5B0Z C;  3MGQ D; 
#chains in the Genus database with same CATH topology
 4X23 A;  4H9S A;  3WTP A;  3KUY A;  3W97 B;  3WTP E;  5B33 D;  3AV1 C;  1F66 C;  4WU8 B;  5B1L B;  1M19 D;  2ZY3 A;  5F99 B;  5GXQ C;  3VH5 W;  1M18 C;  2Y2I A;  3REJ B;  5DNN C;  3WKJ C;  2RVQ C;  5GT3 D;  4KUD A;  5GT0 D;  3REK B;  2CV5 B;  3AYW D;  1Q9C A;  3AZG C;  2LY8 A;  1M1A B;  3AZL A;  3X1S B;  4R8P C;  3W99 D;  4X23 B;  3VH5 A;  4G92 B;  3AZF D;  5CPK C;  5BT1 D;  3AZN B;  1P3P D;  2PYO D;  4QLC C;  5B0Y D;  3MGR D;  3O62 D;  4KHA A;  1ID3 C;  3R45 A;  2ARO B;  5JA4 A;  1P3A C;  3KXB B;  5B24 D;  1PZR A;  2Y2M A;  3REH A;  3X1V D;  2F8N K;  1P34 D;  2JE5 A;  3X1T C;  2NZD A;  4KGC D;  1F1E A;  4XUJ D;  3UT9 C;  1BH8 A;  1N1J A;  4KUD B;  5B31 C;  2F8N A;  1P3F B;  3A6N C;  1HQ3 C;  4DQY B;  5B2J D;  1P3L C;  3AZL B;  3MNN A;  4WNN A;  3WAA A;  1T3U A;  3B0B A;  1B6W A;  3MGQ C;  2NQB B;  4HGA B;  4XZQ B;  3AV2 D;  4ZUX B;  3UTB D;  4ZBJ C;  5B40 D;  1S32 A;  5B33 C;  1HTA A;  3R45 B;  5JA4 B;  5AVC D;  1M19 C;  3NQU A;  1P3M A;  3C1B D;  1P3G D;  3B0D B;  3KWQ B;  4J8U A;  1AOI A;  2BYM A;  3B6F D;  2IO5 B;  4LD9 A;  3AN2 D;  5GSU A;  5AV5 D;  1N1J B;  5GT3 C;  2F8N B;  4CSR A;  4AWL B;  3C1C A;  5E5A A;  5GT0 C;  3AYW C;  3H0L C;  4J8X B;  3REI B;  1ZLA C;  3MNN B;  3WAA B;  3W97 D;  4NFT A;  4WU8 D;  5B1L D;  3W99 C;  2YFV B;  5F99 D;  2DF4 C;  3AZF C;  5BT1 C;  1P3P C;  2PYO C;  3REJ D;  5B0Y C;  3MGR C;  5CPJ A;  5B1M A;  3O62 C;  2Y2H A;  1S32 B;  2Y2Q A;  3NQU B;  2G5H C;  1P3M B;  5B24 C;  3X1V C;  3REK D;  2CV5 D;  1P34 C;  4J8U B;  3EPH A;  4LD9 B;  4KGC C;  5GSU B;  4XUJ C;  1M1A D;  5BO0 A;  4CSR B;  3X1S D;  5E5A B;  4JJN A;  1R4V A;  4Z66 A;  4X23 D;  5B2J C;  3AFA B;  1TZY A;  3AZN D;  3VH6 W;  2ZY5 A;  5B32 A;  1P3O A;  2CWE A;  4WZS B;  2ARO D;  3KXB D;  1KX3 A;  1KX4 A;  3AV2 C;  5CPJ B;  2Y2P A;  5B1M B;  5C3I C;  2Y2O A;  3LJA A;  3UTB C;  5B40 C;  1KX5 A;  5AV9 A;  3AZE A;  4KUD D;  5AVC C;  1P3F D;  3C1B C;  1P3G C;  2Y2L A;  3B6F C;  3AZK B;  3VH6 A;  2XD5 A;  2F8N G;  4NE6 A;  3AZL D;  3AN2 C;  5AV5 C;  5AV6 A;  3H0M C;  3EPK A;  3B0C T;  4Z66 B;  2NQB D;  2JSS A;  4XZQ D;  4WU9 A;  3W98 B;  3WA9 A;  3A1K A;  4ZUX D;  2BYK B;  3W97 C;  4H9Q A;  4H9N B;  4WU8 C;  5B1L C;  2Y2J A;  1KX3 B;  1KX4 B;  5F99 C;  1U35 A;  3KWQ D;  5B0Z A;  4DRB A;  3REJ C;  3LJA B;  4YM6 A;  5AV9 B;  3AZE B;  3AL0 C;  3AZI A;  3AZM A;  2F8N D;  1WWI A;  3REK C;  2CV5 C;  1F66 A;  4EO5 B;  3REI D;  4J8X D;  3MNN D;  5GXQ A;  3WAA D;  5AV6 B;  1M1A C;  1ULY A;  5DNM A;  3NQJ A;  4H9O A;  2L5A A;  5DNN A;  3X1S C;  5G49 B;  4X23 C;  4CAY A;  5JRG A;  3AZJ B;  4G91 B;  3WA9 B;  4G92 C;  4UUZ A;  3AZN C;  3MGS A;  4J8W B;  3UTA A;  5CPI B;  4H9Q B;  1S32 D;  5B2I A;  3AZG A;  2ARO C;  1BFM A;  1P3M D;  3KXB C;  3LEL C;  3WTP B;  4J8U D;  3KUY B;  2F2A C;  4LD9 D;  4YM6 B;  3AZH A;  5GSU D;  3AZI B;  3AZM B;  4KUD C;  5E5A D;  1P3F C;  2FJ7 A;  1P3A A;  3AFA D;  4YS3 A;  1EQZ A;  1KU5 A;  3AZL C;  3EPL A;  3X1T A;  5DNM B;  4J8V A;  5AV8 A;  2NQB C;  4CAY B;  4HGA C;  5JRG B;  4XZQ C;  4UUZ B;  3EG5 B;  2J8P A;  3MGS B;  3UTA B;  4ZUX C;  5CPJ D;  5B1M D;  2F8N H;  5B2I B;  3TU4 A;  3B6G A;  3B0D C;  3KWQ C;  3MGQ A;  3AZK D;  2IO5 C;  3AZH B;  4KHA B;  4AWL C;  4Z66 D;  3REH B;  3REL A;  2FJ7 B;  1P3K A;  2ZM5 A;  5B33 A;  4YS3 B;  3W98 D;  2NZD B;  1EQZ B;  3REI C;  4J8X C;  3MNN C;  3WAA C;  1BH8 B;  5FUG A;  1Z2C B;  5CHL B;  5AV8 B;  4J8V B;  3A1I A;  1KX3 D;  1KX4 D;  5GT3 A;  3LJA D;  4WNN B;  3VH5 T;  5AV9 D;  3AZE D;  1S32 C;  3AYW A;  5AY8 A;  1ZLA A;  1A7W A;  3TU4 B;  1P3M C;  3B6G B;  4J8U C;  4LD9 C;  5AV6 D;  3AZF A;  1P3P A;  3FDD A;  3KSY A;  2PYO A;  5E5A C;  5B0Y A;  3MGR A;  3REL B;  4ZBJ B;  5CP6 A;  1P3K B;  3AZJ D;  3W96 A;  1AOI B;  1H3O A;  3WA9 D;  2BYM B;  2HIO A;  5AVB A;  3AFA C;  5B24 A;  4J8W D;  3X1V A;  5CPI D;  3C1C B;  4XUJ A;  2FFF B;  3WTP D;  3KUY D;  4YM6 D;  5BS7 C;  5CPJ C;  5B1M C;  3AZI D;  5AY8 B;  3AZM D;  1ZLA B;  2W8S A;  1P3I A;  3F6T A;  3AZK C;  2DQN C;  1P3B A;  5DNM D;  5BNV A;  5CP6 B;  4Z66 C;  3UTB A;  4Z5T A;  5JRG D;  5B40 A;  3LZ1 A;  1H3O B;  3W96 B;  2HIO B;  5AVB B;  3W98 C;  1JFI A;  2YFW A;  3MGS D;  3UTA D;  5BO0 B;  5B2I D;  2BG1 A;  4JJN B;  5BNX A;  3MVD A;  3AN2 A;  1KX3 C;  1KX4 C;  1TZY B;  3X1U A;  3AZH D;  3LJA C;  3MGP A;  5B32 B;  5AV9 C;  3AZE C;  1P3O B;  3LZ0 A;  1P3I B;  2FJ7 D;  3REH D;  4WU8 A;  4YS3 D;  2NZD D;  1EQZ D;  4EO5 C;  1P3B B;  1KX5 B;  5AV6 C;  4UPK A;  3V9R A;  5AV8 D;  4J8V D;  3REJ A;  4Z5T B;  4E45 A;  3LZ1 B;  3H0R C;  3AZJ C;  3AV1 A;  4G91 C;  3WA9 C;  4J8W C;  4H9P A;  5CPI C;  3REK A;  1M18 A;  2CV5 A;  2HUE B;  3MVD B;  3WKJ A;  3TU4 D;  4WU9 B;  1M1A A;  4H9S C;  3B6G D;  3X1U B;  3WTP C;  3KUY C;  4YM6 C;  3MGP B;  1B67 A;  3LZ0 B;  3AZM C;  3AZN A;  3AZI C;  3REL D;  1U35 B;  1P3K D;  1AOI D;  5B0Z B;  2ARO A;  4R8P A;  3KXB A;  3LEL A;  4NE3 A;  3IP4 C;  5CPK A;  5DNM C;  3VH6 T;  3V9R B;  3C1C D;  4QLC A;  5JRG C;  3AV1 B;  1ID3 A;  1F66 B;  1P3F A;  3MGS C;  4H9P B;  5GXQ B;  3UTA C;  1M18 B;  1TAF A;  3NQJ B;  4H9O B;  5AY8 D;  5DNN B;  5B2I C;  1ZLA D;  3WKJ B;  3UT9 A;  5B31 A;  2NQB A;  5B32 G;  3A6N A;  3AZH C;  1HQ3 A;  4XZQ A;  2UWX A;  2XD1 A;  3AZG B;  1P3L A;  4ZUX A;  5CP6 D;  2FJ7 C;  3REH C;  4E44 A;  3W96 D;  4Z2M G;  2HIO D;  5AVB D;  4R8P B;  4YS3 C;  2NZD C;  3EPJ A;  1EQZ C;  3KFU G;  3LEL B;  5CPK B;  4DRA A;  3KWQ A;  4QLC B;  4J8V C;  5AV8 C;  4JJN D;  1ID3 B;  1P3A B;  1TZY D;  1M19 A;  2Y2G A;  1TAF B;  3X1T B;  5B32 D;  1P3O D;  3REI A;  4J8X A;  1P3I D;  3UT9 B;  3TU4 C;  3B6G C;  1BH9 A;  5B31 B;  5GT0 A;  3A6N B;  1HQ3 B;  2YFV A;  1P3B D;  1KX5 D;  1P3L B;  3B0C W;  3REL C;  4Z5T D;  3LZ1 D;  1P3K C;  1AOI C;  3MGQ B;  3W99 A;  5GSU C;  3C1C C;  3MVD D;  2Y2N A;  3O62 A;  5B33 B;  4WU9 D;  3X1U D;  1WWS A;  1M19 B;  2ZY4 A;  3MGP D;  5FUG B;  1P34 A;  4WJ3 C;  3LZ0 D;  5AY8 C;  3AFA A;  4H9R A;  4KGC A;  5GT3 B;  1U35 D;  1BH9 B;  5B0Z D;  5GT0 B;  2Y2K A;  3P5J B;  5B2J A;  3AYW B;  5BS7 A;  5CP6 C;  3AV1 D;  3W96 C;  1F66 D;  4M6B A;  2HIO C;  5AVB C;  3W99 B;  4NE5 A;  5GXQ D;  1W2E A;  3AZF B;  1M18 D;  5KDM A;  3AV2 A;  4WV4 B;  1P3P B;  2PYO B;  5DNN D;  5B0Y B;  3MGR B;  3AZK A;  3WKJ D;  4JJN C;  2RVQ D;  3O62 B;  2G5I C;  1TZY C;  5AVC A;  4Z2M H;  5B24 B;  3X1V B;  3C1B A;  1P34 B;  1P3G A;  3B6F A;  5B32 C;  4H9R B;  3AZG D;  1P3O C;  3W98 A;  4KGC B;  5B31 G;  4XUJ B;  1P3I C;  2BYK A;  5AV5 A;  2JCH A;  4H9N A;  4R8P D;  3LEL D;  1P3B C;  5B2J B;  5CPK D;  1KX5 C;  4QLC D;  2ZY2 A;  4Z5T C;  3W97 A;  3LZ1 C;  1ID3 D;  1P3A D;  2RIQ A;  5B1L A;  5F99 A;  5KDM B;  3X1T D;  3AV2 B;  5BNV B;  2HUE C;  5C3I B;  3UTB B;  3MVD C;  5B40 B;  3UT9 D;  2VQR A;  4WU9 C;  5B31 D;  5AVC B;  1JFI B;  2YFW B;  3X1U C;  3A6N D;  5G49 A;  1HQ3 D;  3C1B B;  1P3G B;  3MGP C;  3AZJ A;  3B6F B;  1P3L D;  3LZ0 C;  5BNX B;  3AN2 B;  4J8W A;  5AV5 B;  5CPI A;  1U35 C;  3X1S A;  5B0Z C;  3MGQ D; 
#chains in the Genus database with same CATH homology
 4X23 A;  4H9S A;  3WTP A;  3KUY A;  3W97 B;  3WTP E;  5B33 D;  3AV1 C;  1F66 C;  4WU8 B;  5B1L B;  1M19 D;  2ZY3 A;  5F99 B;  5GXQ C;  3VH5 W;  1M18 C;  2Y2I A;  3REJ B;  5DNN C;  3WKJ C;  2RVQ C;  5GT3 D;  4KUD A;  5GT0 D;  3REK B;  2CV5 B;  3AYW D;  1Q9C A;  3AZG C;  2LY8 A;  1M1A B;  3AZL A;  3X1S B;  4R8P C;  3W99 D;  4X23 B;  3VH5 A;  4G92 B;  3AZF D;  5CPK C;  5BT1 D;  3AZN B;  1P3P D;  2PYO D;  4QLC C;  5B0Y D;  3MGR D;  3O62 D;  4KHA A;  1ID3 C;  3R45 A;  2ARO B;  5JA4 A;  1P3A C;  3KXB B;  5B24 D;  1PZR A;  2Y2M A;  3REH A;  3X1V D;  2F8N K;  1P34 D;  2JE5 A;  3X1T C;  2NZD A;  4KGC D;  1F1E A;  4XUJ D;  3UT9 C;  1BH8 A;  1N1J A;  4KUD B;  5B31 C;  2F8N A;  1P3F B;  3A6N C;  1HQ3 C;  4DQY B;  5B2J D;  1P3L C;  3AZL B;  3MNN A;  4WNN A;  3WAA A;  1T3U A;  3B0B A;  1B6W A;  3MGQ C;  2NQB B;  4HGA B;  4XZQ B;  3AV2 D;  4ZUX B;  3UTB D;  4ZBJ C;  5B40 D;  1S32 A;  5B33 C;  1HTA A;  3R45 B;  5JA4 B;  5AVC D;  1M19 C;  3NQU A;  1P3M A;  3C1B D;  1P3G D;  3B0D B;  3KWQ B;  4J8U A;  1AOI A;  2BYM A;  3B6F D;  2IO5 B;  4LD9 A;  3AN2 D;  5GSU A;  5AV5 D;  1N1J B;  5GT3 C;  2F8N B;  4CSR A;  4AWL B;  3C1C A;  5E5A A;  5GT0 C;  3AYW C;  3H0L C;  4J8X B;  3REI B;  1ZLA C;  3MNN B;  3WAA B;  3W97 D;  4NFT A;  4WU8 D;  5B1L D;  3W99 C;  2YFV B;  5F99 D;  2DF4 C;  3AZF C;  5BT1 C;  1P3P C;  2PYO C;  3REJ D;  5B0Y C;  3MGR C;  5CPJ A;  5B1M A;  3O62 C;  2Y2H A;  1S32 B;  2Y2Q A;  3NQU B;  2G5H C;  1P3M B;  5B24 C;  3X1V C;  3REK D;  2CV5 D;  1P34 C;  4J8U B;  3EPH A;  4LD9 B;  4KGC C;  5GSU B;  4XUJ C;  1M1A D;  5BO0 A;  4CSR B;  3X1S D;  5E5A B;  4JJN A;  1R4V A;  4Z66 A;  4X23 D;  5B2J C;  3AFA B;  1TZY A;  3AZN D;  3VH6 W;  2ZY5 A;  5B32 A;  1P3O A;  2CWE A;  4WZS B;  2ARO D;  3KXB D;  1KX3 A;  1KX4 A;  3AV2 C;  5CPJ B;  2Y2P A;  5B1M B;  5C3I C;  2Y2O A;  3LJA A;  3UTB C;  5B40 C;  1KX5 A;  5AV9 A;  3AZE A;  4KUD D;  5AVC C;  1P3F D;  3C1B C;  1P3G C;  2Y2L A;  3B6F C;  3AZK B;  3VH6 A;  2XD5 A;  2F8N G;  4NE6 A;  3AZL D;  3AN2 C;  5AV5 C;  5AV6 A;  3H0M C;  3EPK A;  3B0C T;  4Z66 B;  2NQB D;  2JSS A;  4XZQ D;  4WU9 A;  3W98 B;  3WA9 A;  3A1K A;  4ZUX D;  2BYK B;  3W97 C;  4H9Q A;  4H9N B;  4WU8 C;  5B1L C;  2Y2J A;  1KX3 B;  1KX4 B;  5F99 C;  1U35 A;  3KWQ D;  5B0Z A;  4DRB A;  3REJ C;  3LJA B;  4YM6 A;  5AV9 B;  3AZE B;  3AL0 C;  3AZI A;  3AZM A;  2F8N D;  1WWI A;  3REK C;  2CV5 C;  1F66 A;  4EO5 B;  3REI D;  4J8X D;  3MNN D;  5GXQ A;  3WAA D;  5AV6 B;  1M1A C;  1ULY A;  5DNM A;  3NQJ A;  4H9O A;  2L5A A;  5DNN A;  3X1S C;  5G49 B;  4X23 C;  4CAY A;  5JRG A;  3AZJ B;  4G91 B;  3WA9 B;  4G92 C;  4UUZ A;  3AZN C;  3MGS A;  4J8W B;  3UTA A;  5CPI B;  4H9Q B;  1S32 D;  5B2I A;  3AZG A;  2ARO C;  1BFM A;  1P3M D;  3KXB C;  3LEL C;  3WTP B;  4J8U D;  3KUY B;  2F2A C;  4LD9 D;  4YM6 B;  3AZH A;  5GSU D;  3AZI B;  3AZM B;  4KUD C;  5E5A D;  1P3F C;  2FJ7 A;  1P3A A;  3AFA D;  4YS3 A;  1EQZ A;  1KU5 A;  3AZL C;  3EPL A;  3X1T A;  5DNM B;  4J8V A;  5AV8 A;  2NQB C;  4CAY B;  4HGA C;  5JRG B;  4XZQ C;  4UUZ B;  3EG5 B;  2J8P A;  3MGS B;  3UTA B;  4ZUX C;  5CPJ D;  5B1M D;  2F8N H;  5B2I B;  3TU4 A;  3B6G A;  3B0D C;  3KWQ C;  3MGQ A;  3AZK D;  2IO5 C;  3AZH B;  4KHA B;  4AWL C;  4Z66 D;  3REH B;  3REL A;  2FJ7 B;  1P3K A;  2ZM5 A;  5B33 A;  4YS3 B;  3W98 D;  2NZD B;  1EQZ B;  3REI C;  4J8X C;  3MNN C;  3WAA C;  1BH8 B;  5FUG A;  1Z2C B;  5CHL B;  5AV8 B;  4J8V B;  3A1I A;  1KX3 D;  1KX4 D;  5GT3 A;  3LJA D;  4WNN B;  3VH5 T;  5AV9 D;  3AZE D;  1S32 C;  3AYW A;  5AY8 A;  1ZLA A;  1A7W A;  3TU4 B;  1P3M C;  3B6G B;  4J8U C;  4LD9 C;  5AV6 D;  3AZF A;  1P3P A;  3FDD A;  3KSY A;  2PYO A;  5E5A C;  5B0Y A;  3MGR A;  3REL B;  4ZBJ B;  5CP6 A;  1P3K B;  3AZJ D;  3W96 A;  1AOI B;  1H3O A;  3WA9 D;  2BYM B;  2HIO A;  5AVB A;  3AFA C;  5B24 A;  4J8W D;  3X1V A;  5CPI D;  3C1C B;  4XUJ A;  2FFF B;  3WTP D;  3KUY D;  4YM6 D;  5BS7 C;  5CPJ C;  5B1M C;  3AZI D;  5AY8 B;  3AZM D;  1ZLA B;  2W8S A;  1P3I A;  3F6T A;  3AZK C;  2DQN C;  1P3B A;  5DNM D;  5BNV A;  5CP6 B;  4Z66 C;  3UTB A;  4Z5T A;  5JRG D;  5B40 A;  3LZ1 A;  1H3O B;  3W96 B;  2HIO B;  5AVB B;  3W98 C;  1JFI A;  2YFW A;  3MGS D;  3UTA D;  5BO0 B;  5B2I D;  2BG1 A;  4JJN B;  5BNX A;  3MVD A;  3AN2 A;  1KX3 C;  1KX4 C;  1TZY B;  3X1U A;  3AZH D;  3LJA C;  3MGP A;  5B32 B;  5AV9 C;  3AZE C;  1P3O B;  3LZ0 A;  1P3I B;  2FJ7 D;  3REH D;  4WU8 A;  4YS3 D;  2NZD D;  1EQZ D;  4EO5 C;  1P3B B;  1KX5 B;  5AV6 C;  4UPK A;  3V9R A;  5AV8 D;  4J8V D;  3REJ A;  4Z5T B;  4E45 A;  3LZ1 B;  3H0R C;  3AZJ C;  3AV1 A;  4G91 C;  3WA9 C;  4J8W C;  4H9P A;  5CPI C;  3REK A;  1M18 A;  2CV5 A;  2HUE B;  3MVD B;  3WKJ A;  3TU4 D;  4WU9 B;  1M1A A;  4H9S C;  3B6G D;  3X1U B;  3WTP C;  3KUY C;  4YM6 C;  3MGP B;  1B67 A;  3LZ0 B;  3AZM C;  3AZN A;  3AZI C;  3REL D;  1U35 B;  1P3K D;  1AOI D;  5B0Z B;  2ARO A;  4R8P A;  3KXB A;  3LEL A;  4NE3 A;  3IP4 C;  5CPK A;  5DNM C;  3VH6 T;  3V9R B;  3C1C D;  4QLC A;  5JRG C;  3AV1 B;  1ID3 A;  1F66 B;  1P3F A;  3MGS C;  4H9P B;  5GXQ B;  3UTA C;  1M18 B;  1TAF A;  3NQJ B;  4H9O B;  5AY8 D;  5DNN B;  5B2I C;  1ZLA D;  3WKJ B;  3UT9 A;  5B31 A;  2NQB A;  5B32 G;  3A6N A;  3AZH C;  1HQ3 A;  4XZQ A;  2UWX A;  2XD1 A;  3AZG B;  1P3L A;  4ZUX A;  5CP6 D;  2FJ7 C;  3REH C;  4E44 A;  3W96 D;  4Z2M G;  2HIO D;  5AVB D;  4R8P B;  4YS3 C;  2NZD C;  3EPJ A;  1EQZ C;  3KFU G;  3LEL B;  5CPK B;  4DRA A;  3KWQ A;  4QLC B;  4J8V C;  5AV8 C;  4JJN D;  1ID3 B;  1P3A B;  1TZY D;  1M19 A;  2Y2G A;  1TAF B;  3X1T B;  5B32 D;  1P3O D;  3REI A;  4J8X A;  1P3I D;  3UT9 B;  3TU4 C;  3B6G C;  1BH9 A;  5B31 B;  5GT0 A;  3A6N B;  1HQ3 B;  2YFV A;  1P3B D;  1KX5 D;  1P3L B;  3B0C W;  3REL C;  4Z5T D;  3LZ1 D;  1P3K C;  1AOI C;  3MGQ B;  3W99 A;  5GSU C;  3C1C C;  3MVD D;  2Y2N A;  3O62 A;  5B33 B;  4WU9 D;  3X1U D;  1WWS A;  1M19 B;  2ZY4 A;  3MGP D;  5FUG B;  1P34 A;  4WJ3 C;  3LZ0 D;  5AY8 C;  3AFA A;  4H9R A;  4KGC A;  5GT3 B;  1U35 D;  1BH9 B;  5B0Z D;  5GT0 B;  2Y2K A;  3P5J B;  5B2J A;  3AYW B;  5BS7 A;  5CP6 C;  3AV1 D;  3W96 C;  1F66 D;  4M6B A;  2HIO C;  5AVB C;  3W99 B;  4NE5 A;  5GXQ D;  1W2E A;  3AZF B;  1M18 D;  5KDM A;  3AV2 A;  4WV4 B;  1P3P B;  2PYO B;  5DNN D;  5B0Y B;  3MGR B;  3AZK A;  3WKJ D;  4JJN C;  2RVQ D;  3O62 B;  2G5I C;  1TZY C;  5AVC A;  4Z2M H;  5B24 B;  3X1V B;  3C1B A;  1P34 B;  1P3G A;  3B6F A;  5B32 C;  4H9R B;  3AZG D;  1P3O C;  3W98 A;  4KGC B;  5B31 G;  4XUJ B;  1P3I C;  2BYK A;  5AV5 A;  2JCH A;  4H9N A;  4R8P D;  3LEL D;  1P3B C;  5B2J B;  5CPK D;  1KX5 C;  4QLC D;  2ZY2 A;  4Z5T C;  3W97 A;  3LZ1 C;  1ID3 D;  1P3A D;  2RIQ A;  5B1L A;  5F99 A;  5KDM B;  3X1T D;  3AV2 B;  5BNV B;  2HUE C;  5C3I B;  3UTB B;  3MVD C;  5B40 B;  3UT9 D;  2VQR A;  4WU9 C;  5B31 D;  5AVC B;  1JFI B;  2YFW B;  3X1U C;  3A6N D;  5G49 A;  1HQ3 D;  3C1B B;  1P3G B;  3MGP C;  3AZJ A;  3B6F B;  1P3L D;  3LZ0 C;  5BNX B;  3AN2 B;  4J8W A;  5AV5 B;  5CPI A;  1U35 C;  3X1S A;  5B0Z C;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...