4YS3B

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3B00
4LD9D 3MVDD 1AOIB 3B6GA 5DNNC 1TZYD 2AROA 3AZEB 3MNNC 5CHLB 3KUYA 1P3PB 3A6ND 1ULYA 3W99C 3W96C 3LZ0B 5B0ZB 1P3GB 3X1UB 4AWLB 3WKJA 3VH6T 3REIB 4XUJA 5B1LB 3RELC 5B40B 4WU8B 3AV2D 4X23D 3KWQD 1P3KA 3AZND 5B1MD 3UT9D 1HQ3D 3X1SD 5B33B 4WNNB 2PYOB 3WAAD 3WTPB 3NQUA 1P3BD 4J8UA 4R8PB 2NZDA 4CSRA 4JJNB 3C1BA 3REKD 3UTAA 4LD9B 3MVDB 5C3IB 1P3FC 1TZYB 3O62C 4HGAC 4QLCA 1P3OD 3AZKA 3AYWA 5CPID 5AVBB 3A6NB 5AV9D 2CWEA 3LELA 3AN2A 5AV6A 3X1VD 3AV2B 3REHC 4X23B 3KWQB 3AZEA 3AZNB 3MGQC 1ZLAD 5B1MB 3UT9B 1HQ3B 1EQZD 3B6GD 3NQJA 3TU4C 5B24C 1P3PA 2AROD 1AOIC 3WAAB 4NE6A 5F99C 3LZ0A 1P3BB 1P3GA 3X1UA 3KUYD 5JA4A 3REIA 5B1LA 4WU8A 5B32G 5B31G 3KXBC 1F1EA 1M19C 2HIOD 4G92C 4XUJD 5B0ZC 3X1UC 4AWLC 4ZBJB 1P3OB 5B33A 5B40C 5B32A 3WTPA 4H9NB 5CPIB 1KX4A 4CAYB 4J8VD 5CPKC 5AV9B 4R8PA 2YFWB 3AZMC 5AV5D 5AV8C 2PYOC 3X1VB 1P3MA 2NZDD 1S32D 1ZLAB 3C1BD 4JJNC 1P3AD 1EQZB 3B6GB 1KX5B 1P3IA 5AVBA 3A6NA 2AROB 3MVDC 1P3LA 3VH6A 3WA9A 4LD9C 1TZYC 3KUYB 4KHAB 1B67A 4NFTA 3R45B 3MGRC 5AV6D 4X23A 3KWQA 4J8WB 3AZNA 1KX3D 3UT9A 2HIOB 1HQ3A 3AZHB 3AV2C 3C1CC 4J8XD 1KU5A 4J8VB 1P34C 5B1MC 1BH8B 3UTBD 3X1SC 2BYKB 3MGPD 5AV5B 3NQUB 5BS7A 3MGSD 4YM6A 3WAAC 2HUEC 1P3BC 2NZDB 4CSRB 5B1LD 4WU8D 5GT3C 3AZJA 4WU9A 1S32B 2JSSA 3X1TA 1P3AB 3REKC 4H9SA 4CAYA 2IO5C 5G49B 2FJ7D 5B32D 3WTPD 5B31D 1P3OC 4H9PA 4Z5TA 3W98D 1KX4D 3AZGD 3AZFD 3X1VA 2NQBA 5B2JB 5CPIC 5JRGD 4Z66C 5AV9C 1KX3B 1JFIB 1ZLAA 1P3MD 1EQZA 5BT1D 1KX5A 4KGCC 4E45A 4J8XB 3AZLD 4KHAA 3NQJB 5AY8A 3UTBB 1P3ID 5AVBD 1P3LD 3WA9D 3MGPB 3B6GC 1N1JB 4KUDD 3MGSB 3R45A 2AROC 4J8WA 3W97D 1M18A 5JA4B 1B6WA 2HIOA 5AVCA 4EO5B 4NE5A 3KUYC 3B6FA 3AZHA 3WKJC 4J8VA 1BH8A 4XUJC 2CV5D 2FJ7B 2BYKA 5AV5A 5B32B 5B31B 2F8NG 3W98B 4G91B 1KX4B 5GT0D 1P3KC 3AZGB 3AZFB 5CP6A 5JRGB 1BH9B 1S32A 5B0YA 4YM6D 2LY8A 1P3MB 1P3AA 4J8UC 3AZJD 4WU9D 5G49A 1F66D 2NZDC 3VH6W 3LZ1D 3X1TD 3C1BC 5E5AB 3REJD 3AZLB 3UTAC 3B0CT 1P3IB 1P3LB 3WA9B 1TAFB 2F8NK 5B2JA 4KUDB 1ID3A 4QLCC 1KX3A 5GXQB 1JFIA 3W97B 4Z5TD 5BO0B 3AZKC 4YS3D 3AYWC 3AV1A 2NQBD 5GSUD 1Q9CA 3LELC 3AN2C 5AV6C 4H9RB 4J8XA 4ZUXD 3UTBA 3LJAD 2CV5B 1KX5D 3MGPA 1N1JA 3MGSA 1M1AB 5GT0B 3AZEC 5AY8D 2RVQD 1P3PC 4YM6B 4J8WD 1M18D 5AVCD 3LZ0C 5CPJA 1P3GC 3AZJB 3B6FD 4WU9B 3REIC 4EO5C 5B1LC 3AZHD 1F66B 3LZ1B 2FJ7A 4WU8C 3X1TB 5B31A 3REJB 3W98A 3AZGA 3AZFA 5JRGA 1BH9A 4DRBA 3W96D 4H9PB 4Z5TB 5B33C 4H9OA 5B32C 3WTPC 4YS3B 5CP6D 2NQBB 4G91C 1KX4C 1R4VA 3B0DB 3AZGC 4R8PC 5GSUB 5B0YD 3AZIA 2F8ND 1WWIA 3AZLA 5E5AA 4ZUXB 3LJAB 5C3IC 1TAFA 1P3MC 4KUDA 3W97A 5GXQA 5AY8B 5BO0A 5B2JD 1P3IC 5AVBC 3A6NC 1P3LC 3WA9C 1ID3D 1M18B 5AVCB 4H9RA 3AV1D 3O62D 3B6FB 4E44A 2CV5A 5FUGB 5KDMA 1M1AA 5GT0A 4X23C 3KWQC 3AZNC 3UT9C 1HQ3C 5DNMA 3W96B 3AFAA 5CP6B 3RELB 5B0YB 3REHD 1F66A 3LZ1A 3MGQD 4Z2MH 2F8NB 5BS7C 5CPJD 4YM6C 3REJA 3TU4D 5B24D 4ZBJC 5F99D 3AZJC 4WU9C 3WTPE 3X1TC 4YS3A 4H9SC 1ID3B 3KXBD 5GSUA 5BNXA 1M19D 3B0BA 4WZSB 3O62B 3AV1B 4Z5TC 4HGAB 4ZUXA 3LJAA 3X1VC 2NQBC 4XZQA 3B0DC 3AZID 1U35A 1ZLAC 5E5AD 5CPKD 1EQZC 5B2IA 4ZUXC 3AZMD 1KX5C 5AV8D 5GXQD 5DNNA 5AY8C 5BNVB 3REHB 3MGQB 5FUGA 3MNNA 5CPJB 4J8WC 1M18C 3TU4B 5B24B 2HIOC 5AVCC 3W99A 3W96A 5F99B 3B6FC 3AZHC 1M1AD 1HTAA 5DNMD 3RELA 4J8VC 3KXBB 3MGRD 1M19B 5AV5C 4H9OB 3AFAD 4M6BA 4G92B 4H9QB 2F8NA 5CP6C 3AZIB 3C1CD 1S32C 5B0YC 5CPKB 1P34D 3KSYA 1P3AC 3AZMB 1A7WA 5AV8B 1P3FA 4UUZB 3O62A 5GT3D 2YFVB 3VH5A 5B2JC 1ID3C 1KX3C 3AV1C 4XZQD 5KDMB 1U35D 5DNMB 4J8XC 5B2ID 5BNVA 3REHA 3UTBC 4Z66D 3MGRB 1WWSA 3MGQA 3MGPC 3B0CW 3AFAB 3MGSC 5DNND 3TU4A 5B24A 1AOIA 3C1CB 5F99A 4KGCD 3MNND 2F8NH 1P34B 3X1SB 5CPJC 3W99D 2BYMB 3KXBA 2HUEB 1M19A 2FJ7C 5B31C 1H3OB 4H9QA 5B0ZA 3W98C 3RELD 5GT3B 3AZFC 5BNXB 3V9RB 5JRGC 5B40A 4NE3A 3REKB 3WKJD 5CPKA 2IO5B 4XZQB 5BT1C 3AZMA 5AV8A 1U35B 4WNNA 2PYOA 1P3KD 4Z2MG 3AZIC 3AZLC 4UUZA 5E5AC 5B2IB 4Z66B 2YFVA 4JJNA 4KUDC 5DNNB 1P3FD 5GXQC 3W97C 4LD9A 3MVDA 4J8UD 1TZYA 4KGCB 3MNNB 3UTAD 3VH5T 3W99B 3MGRA 4QLCD 2CV5C 3AZKD 3AYWD 1M1AC 5GT0C 5DNMC 3LELD 3AV2A 3AN2D 3C1CA 3WKJB 1P34A 5B1MA 3AFAC 4XUJB 3X1SA 1AOID 2BYMA 1F66C 3WAAA 3AZED 1P3KB 3LZ1C 1P3BA 1H3OA 3REJC 5GT3A 1P3PD 3V9RA 3VH5W 3LZ0D 3REKA 5B0ZD 1P3FB 1P3GD 3X1UD 4J8UB 4YS3C 3REID 5B40D 1P3OA 3C1BB 5GSUC 3UTAB 4H9NA 5CPIA 4Z66A 4QLCB 5AV9A 3LJAC 5B33D 2YFWA 4XZQC 4WV4B 3AZKB 2PYOD 3AYWB 1BFMA 1U35C 2L5AA 4DRAA 4R8PD 3LELB 5B2IC 2RVQC 3AN2B 4KGCA 4JJND 5AV6B
chains in the Genus database with same CATH superfamily
4LD9D 3MVDD 1AOIB 3B6GA 5DNNC 1TZYD 2AROA 3AZEB 3MNNC 5CHLB 3KUYA 1P3PB 3A6ND 1ULYA 3W99C 3W96C 3LZ0B 5B0ZB 1P3GB 3X1UB 4AWLB 3WKJA 3VH6T 3REIB 4XUJA 5B1LB 3RELC 5B40B 4WU8B 3AV2D 2Y2JA 2RIQA 4X23D 3KWQD 3AZND 1P3KA 5B1MD 3UT9D 1HQ3D 3X1SD 5B33B 4WNNB 2PYOB 3WAAD 3WTPB 3NQUA 1P3BD 4J8UA 4R8PB 2NZDA 2J8PA 4CSRA 4JJNB 3C1BA 3REKD 3UTAA 4LD9B 3MVDB 5C3IB 1P3FC 1TZYB 3O62C 4HGAC 2DQNC 4QLCA 1P3OD 3AZKA 1PZRA 3AYWA 5CPID 5AVBB 3A6NB 5AV9D 2CWEA 3LELA 3AN2A 5AV6A 3X1VD 3AV2B 3REHC 4X23B 3KWQB 3AZEA 3AZNB 3MGQC 1ZLAD 5B1MB 3UT9B 1HQ3B 1EQZD 3B6GD 2JE5A 3NQJA 5B24C 3TU4C 1P3PA 2AROD 1AOIC 3WAAB 4NE6A 5F99C 3LZ0A 1P3BB 1P3GA 3X1UA 3KUYD 5JA4A 1T3UA 3REIA 5B1LA 4WU8A 5B32G 5B31G 3KXBC 1F1EA 1M19C 2HIOD 4G92C 4XUJD 5B0ZC 3X1UC 4AWLC 4ZBJB 1P3OB 5B33A 5B40C 5B32A 3WTPA 4H9NB 5CPIB 1KX4A 4CAYB 4J8VD 5CPKC 5AV9B 4R8PA 1W2EA 2YFWB 3AZMC 5AV5D 5AV8C 2PYOC 3X1VB 1P3MA 2NZDD 2Y2LA 1S32D 1ZLAB 3C1BD 4JJNC 1P3AD 1EQZB 3B6GB 1KX5B 1P3IA 5AVBA 3A6NA 2AROB 3MVDC 1P3LA 3VH6A 3WA9A 4LD9C 1TZYC 3EG5B 3KUYB 4KHAB 1B67A 4NFTA 2XD5A 3R45B 3MGRC 5AV6D 4X23A 3H0LC 3KWQA 4J8WB 3AZNA 3UT9A 2HIOB 1KX3D 1HQ3A 3AZHB 3F6TA 3AV2C 3C1CC 4J8XD 1KU5A 4J8VB 1P34C 5B1MC 1BH8B 3UTBD 3X1SC 2BYKB 3MGPD 5AV5B 3NQUB 5BS7A 3MGSD 4YM6A 3WAAC 2HUEC 1P3BC 2NZDB 4CSRB 5B1LD 4WU8D 5GT3C 3AZJA 4WU9A 1S32B 2JSSA 3FDDA 3X1TA 1P3AB 3REKC 4H9SA 2W8SA 4CAYA 2IO5C 5G49B 2FJ7D 5B32D 3WTPD 5B31D 1P3OC 4H9PA 4Z5TA 3W98D 1KX4D 3AZGD 3AZFD 3X1VA 2NQBA 5B2JB 5CPIC 5JRGD 4Z66C 5AV9C 1KX3B 1JFIB 1ZLAA 1P3MD 1EQZA 5BT1D 1KX5A 2Y2OA 4KGCC 4E45A 4J8XB 3AZLD 4KHAA 3NQJB 5AY8A 3UTBB 1P3ID 5AVBD 1P3LD 3WA9D 3MGPB 3B6GC 1N1JB 4KUDD 3MGSB 3R45A 2AROC 4J8WA 3W97D 2F2AC 1M18A 5JA4B 1B6WA 2HIOA 5AVCA 4EO5B 4NE5A 3KUYC 3B6FA 3AZHA 1Z2CB 3WKJC 4J8VA 1BH8A 4XUJC 2CV5D 2FJ7B 2BYKA 5AV5A 5B32B 5B31B 2F8NG 3W98B 4G91B 1KX4B 5GT0D 1P3KC 3AZGB 3AZFB 5CP6A 5JRGB 1BH9B 2DF4C 2Y2IA 1S32A 2JCHA 5B0YA 4YM6D 2LY8A 1P3MB 1P3AA 4J8UC 3AZJD 4WU9D 5G49A 1F66D 2NZDC 3VH6W 3LZ1D 3X1TD 3C1BC 5E5AB 3REJD 3AZLB 3UTAC 3B0CT 1P3IB 1P3LB 3WA9B 1TAFB 2F8NK 5B2JA 4KUDB 1ID3A 4QLCC 1KX3A 5GXQB 1JFIA 3W97B 4Z5TD 5BO0B 3AZKC 4YS3D 3AYWC 3AV1A 2NQBD 2G5HC 5GSUD 1Q9CA 3LELC 3AN2C 5AV6C 4H9RB 4J8XA 4ZUXD 3UTBA 3LJAD 3IP4C 2CV5B 1KX5D 3AL0C 3MGPA 1N1JA 3MGSA 1M1AB 5GT0B 3AZEC 5AY8D 3H0MC 2RVQD 1P3PC 4YM6B 4J8WD 1M18D 5AVCD 3LZ0C 5CPJA 1P3GC 3AZJB 3B6FD 4WU9B 3REIC 4EO5C 5B1LC 3AZHD 1F66B 3LZ1B 2FJ7A 4WU8C 3X1TB 5B31A 3REJB 2XD1A 3W98A 3AZGA 3AZFA 5JRGA 1BH9A 4DRBA 3W96D 4H9PB 4Z5TB 5B33C 2Y2NA 4H9OA 5B32C 3WTPC 4YS3B 5CP6D 2NQBB 4G91C 1KX4C 1R4VA 3B0DB 3AZGC 4R8PC 5GSUB 5B0YD 3AZIA 2F8ND 1WWIA 3EPJA 5E5AA 3AZLA 4ZUXB 3LJAB 2Y2MA 4UPKA 5C3IC 1TAFA 1P3MC 4KUDA 3A1IA 3W97A 5GXQA 5AY8B 5BO0A 5B2JD 1P3IC 5AVBC 3A6NC 1P3LC 3WA9C 1ID3D 1M18B 5AVCB 4H9RA 3AV1D 3O62D 4WJ3C 3B6FB 4E44A 2CV5A 2Y2KA 5FUGB 5KDMA 1M1AA 5GT0A 4X23C 3KWQC 3AZNC 3UT9C 1HQ3C 5DNMA 3W96B 3AFAA 5CP6B 3RELB 5B0YB 3REHD 1F66A 3LZ1A 3MGQD 4Z2MH 2F8NB 5BS7C 5CPJD 4YM6C 3REJA 3TU4D 5B24D 3EPHA 4ZBJC 5F99D 3AZJC 4WU9C 3WTPE 3X1TC 4YS3A 4H9SC 1ID3B 3KXBD 3A1KA 5GSUA 5BNXA 1M19D 3B0BA 4WZSB 3O62B 3AV1B 4Z5TC 4HGAB 4ZUXA 3LJAA 3X1VC 2NQBC 4XZQA 3B0DC 3AZID 1U35A 1ZLAC 5E5AD 5CPKD 1EQZC 5B2IA 4ZUXC 3AZMD 1KX5C 5AV8D 2Y2HA 5GXQD 5DNNA 5AY8C 5BNVB 3EPLA 3REHB 3MGQB 5FUGA 3MNNA 5CPJB 4J8WC 1M18C 3TU4B 2Y2GA 5B24B 2HIOC 5AVCC 3W99A 3W96A 5F99B 3B6FC 3AZHC 1M1AD 2G5IC 1HTAA 5DNMD 3RELA 4J8VC 3KXBB 3MGRD 1M19B 5AV5C 4H9OB 3AFAD 4M6BA 4G92B 4H9QB 2F8NA 5CP6C 2ZM5A 3AZIB 3C1CD 1S32C 5B0YC 5CPKB 1P34D 3KSYA 1P3AC 3AZMB 1A7WA 2ZY4A 5AV8B 2ZY5A 1P3FA 4UUZB 3O62A 5GT3D 2YFVB 3VH5A 5B2JC 2UWXA 1ID3C 1KX3C 3AV1C 4XZQD 5KDMB 1U35D 5DNMB 4J8XC 5B2ID 5BNVA 3REHA 2ZY2A 4Z66D 3MGRB 1WWSA 3UTBC 3MGQA 3MGPC 3B0CW 3AFAB 3MGSC 5DNND 3TU4A 5B24A 1AOIA 3C1CB 5F99A 4KGCD 3MNND 2F8NH 1P34B 3X1SB 5CPJC 3W99D 2BYMB 3KXBA 2HUEB 1M19A 2FJ7C 5B31C 1H3OB 4H9QA 5B0ZA 3W98C 3RELD 5GT3B 4DQYB 3AZFC 3EPKA 5BNXB 5JRGC 3V9RB 5B40A 2FFFB 4NE3A 3REKB 3WKJD 5CPKA 2IO5B 4XZQB 5BT1C 3AZMA 5AV8A 1U35B 2Y2PA 4WNNA 2PYOA 1P3KD 4Z2MG 3AZIC 2Y2QA 3AZLC 4UUZA 5E5AC 5B2IB 4Z66B 2YFVA 4JJNA 4KUDC 5DNNB 1P3FD 5GXQC 3W97C 4LD9A 3MVDA 4J8UD 1TZYA 4KGCB 3MNNB 3P5JB 3UTAD 3VH5T 3W99B 3MGRA 4QLCD 2CV5C 3AZKD 3AYWD 1M1AC 5GT0C 5DNMC 3LELD 3AV2A 3AN2D 3C1CA 3WKJB 1P34A 5B1MA 3AFAC 4XUJB 3X1SA 1AOID 2BYMA 1F66C 3WAAA 3AZED 1P3KB 3LZ1C 1P3BA 1H3OA 3REJC 2ZY3A 5GT3A 1P3PD 3V9RA 3VH5W 3LZ0D 3REKA 5B0ZD 1P3FB 1P3GD 3X1UD 4J8UB 4YS3C 3REID 5B40D 1P3OA 3C1BB 5GSUC 3UTAB 3H0RC 4H9NA 5CPIA 4Z66A 4QLCB 5AV9A 3LJAC 5B33D 2YFWA 4XZQC 4WV4B 3AZKB 2PYOD 3AYWB 1BFMA 1U35C 2VQRA 2L5AA 4DRAA 4R8PD 2BG1A 3LELB 5B2IC 2RVQC 3AN2B 4KGCA 4JJND 3KFUG 5AV6B
chains in the Genus database with same CATH topology
4LD9D 3MVDD 1AOIB 3B6GA 5DNNC 1TZYD 2AROA 3AZEB 3MNNC 5CHLB 3KUYA 1P3PB 3A6ND 1ULYA 3W99C 3W96C 3LZ0B 5B0ZB 1P3GB 3X1UB 4AWLB 3WKJA 3VH6T 3REIB 4XUJA 5B1LB 3RELC 5B40B 4WU8B 3AV2D 2Y2JA 2RIQA 4X23D 3KWQD 3AZND 1P3KA 5B1MD 3UT9D 1HQ3D 3X1SD 5B33B 4WNNB 2PYOB 3WAAD 3WTPB 3NQUA 1P3BD 4J8UA 4R8PB 2NZDA 2J8PA 4CSRA 4JJNB 3C1BA 3REKD 3UTAA 4LD9B 3MVDB 5C3IB 1P3FC 1TZYB 3O62C 4HGAC 2DQNC 4QLCA 1P3OD 3AZKA 1PZRA 3AYWA 5CPID 5AVBB 3A6NB 5AV9D 2CWEA 3LELA 3AN2A 5AV6A 3X1VD 3AV2B 3REHC 4X23B 3KWQB 3AZEA 3AZNB 3MGQC 1ZLAD 5B1MB 3UT9B 1HQ3B 1EQZD 3B6GD 2JE5A 3NQJA 5B24C 3TU4C 1P3PA 2AROD 1AOIC 3WAAB 4NE6A 5F99C 3LZ0A 1P3BB 1P3GA 3X1UA 3KUYD 5JA4A 1T3UA 3REIA 5B1LA 4WU8A 5B32G 5B31G 3KXBC 1F1EA 1M19C 2HIOD 4G92C 4XUJD 5B0ZC 3X1UC 4AWLC 4ZBJB 1P3OB 5B33A 5B40C 5B32A 3WTPA 4H9NB 5CPIB 1KX4A 4CAYB 4J8VD 5CPKC 5AV9B 4R8PA 1W2EA 2YFWB 3AZMC 5AV5D 5AV8C 2PYOC 3X1VB 1P3MA 2NZDD 2Y2LA 1S32D 1ZLAB 3C1BD 4JJNC 1P3AD 1EQZB 3B6GB 1KX5B 1P3IA 5AVBA 3A6NA 2AROB 3MVDC 1P3LA 3VH6A 3WA9A 4LD9C 1TZYC 3EG5B 3KUYB 4KHAB 1B67A 4NFTA 2XD5A 3R45B 3MGRC 5AV6D 4X23A 3H0LC 3KWQA 4J8WB 3AZNA 3UT9A 2HIOB 1KX3D 1HQ3A 3AZHB 3F6TA 3AV2C 3C1CC 4J8XD 1KU5A 4J8VB 1P34C 5B1MC 1BH8B 3UTBD 3X1SC 2BYKB 3MGPD 5AV5B 3NQUB 5BS7A 3MGSD 4YM6A 3WAAC 2HUEC 1P3BC 2NZDB 4CSRB 5B1LD 4WU8D 5GT3C 3AZJA 4WU9A 1S32B 2JSSA 3FDDA 3X1TA 1P3AB 3REKC 4H9SA 2W8SA 4CAYA 2IO5C 5G49B 2FJ7D 5B32D 3WTPD 5B31D 1P3OC 4H9PA 4Z5TA 3W98D 1KX4D 3AZGD 3AZFD 3X1VA 2NQBA 5B2JB 5CPIC 5JRGD 4Z66C 5AV9C 1KX3B 1JFIB 1ZLAA 1P3MD 1EQZA 5BT1D 1KX5A 2Y2OA 4KGCC 4E45A 4J8XB 3AZLD 4KHAA 3NQJB 5AY8A 3UTBB 1P3ID 5AVBD 1P3LD 3WA9D 3MGPB 3B6GC 1N1JB 4KUDD 3MGSB 3R45A 2AROC 4J8WA 3W97D 2F2AC 1M18A 5JA4B 1B6WA 2HIOA 5AVCA 4EO5B 4NE5A 3KUYC 3B6FA 3AZHA 1Z2CB 3WKJC 4J8VA 1BH8A 4XUJC 2CV5D 2FJ7B 2BYKA 5AV5A 5B32B 5B31B 2F8NG 3W98B 4G91B 1KX4B 5GT0D 1P3KC 3AZGB 3AZFB 5CP6A 5JRGB 1BH9B 2DF4C 2Y2IA 1S32A 2JCHA 5B0YA 4YM6D 2LY8A 1P3MB 1P3AA 4J8UC 3AZJD 4WU9D 5G49A 1F66D 2NZDC 3VH6W 3LZ1D 3X1TD 3C1BC 5E5AB 3REJD 3AZLB 3UTAC 3B0CT 1P3IB 1P3LB 3WA9B 1TAFB 2F8NK 5B2JA 4KUDB 1ID3A 4QLCC 1KX3A 5GXQB 1JFIA 3W97B 4Z5TD 5BO0B 3AZKC 4YS3D 3AYWC 3AV1A 2NQBD 2G5HC 5GSUD 1Q9CA 3LELC 3AN2C 5AV6C 4H9RB 4J8XA 4ZUXD 3UTBA 3LJAD 3IP4C 2CV5B 1KX5D 3AL0C 3MGPA 1N1JA 3MGSA 1M1AB 5GT0B 3AZEC 5AY8D 3H0MC 2RVQD 1P3PC 4YM6B 4J8WD 1M18D 5AVCD 3LZ0C 5CPJA 1P3GC 3AZJB 3B6FD 4WU9B 3REIC 4EO5C 5B1LC 3AZHD 1F66B 3LZ1B 2FJ7A 4WU8C 3X1TB 5B31A 3REJB 2XD1A 3W98A 3AZGA 3AZFA 5JRGA 1BH9A 4DRBA 3W96D 4H9PB 4Z5TB 5B33C 2Y2NA 4H9OA 5B32C 3WTPC 4YS3B 5CP6D 2NQBB 4G91C 1KX4C 1R4VA 3B0DB 3AZGC 4R8PC 5GSUB 5B0YD 3AZIA 2F8ND 1WWIA 3EPJA 5E5AA 3AZLA 4ZUXB 3LJAB 2Y2MA 4UPKA 5C3IC 1TAFA 1P3MC 4KUDA 3A1IA 3W97A 5GXQA 5AY8B 5BO0A 5B2JD 1P3IC 5AVBC 3A6NC 1P3LC 3WA9C 1ID3D 1M18B 5AVCB 4H9RA 3AV1D 3O62D 4WJ3C 3B6FB 4E44A 2CV5A 2Y2KA 5FUGB 5KDMA 1M1AA 5GT0A 4X23C 3KWQC 3AZNC 3UT9C 1HQ3C 5DNMA 3W96B 3AFAA 5CP6B 3RELB 5B0YB 3REHD 1F66A 3LZ1A 3MGQD 4Z2MH 2F8NB 5BS7C 5CPJD 4YM6C 3REJA 3TU4D 5B24D 3EPHA 4ZBJC 5F99D 3AZJC 4WU9C 3WTPE 3X1TC 4YS3A 4H9SC 1ID3B 3KXBD 3A1KA 5GSUA 5BNXA 1M19D 3B0BA 4WZSB 3O62B 3AV1B 4Z5TC 4HGAB 4ZUXA 3LJAA 3X1VC 2NQBC 4XZQA 3B0DC 3AZID 1U35A 1ZLAC 5E5AD 5CPKD 1EQZC 5B2IA 4ZUXC 3AZMD 1KX5C 5AV8D 2Y2HA 5GXQD 5DNNA 5AY8C 5BNVB 3EPLA 3REHB 3MGQB 5FUGA 3MNNA 5CPJB 4J8WC 1M18C 3TU4B 2Y2GA 5B24B 2HIOC 5AVCC 3W99A 3W96A 5F99B 3B6FC 3AZHC 1M1AD 2G5IC 1HTAA 5DNMD 3RELA 4J8VC 3KXBB 3MGRD 1M19B 5AV5C 4H9OB 3AFAD 4M6BA 4G92B 4H9QB 2F8NA 5CP6C 2ZM5A 3AZIB 3C1CD 1S32C 5B0YC 5CPKB 1P34D 3KSYA 1P3AC 3AZMB 1A7WA 2ZY4A 5AV8B 2ZY5A 1P3FA 4UUZB 3O62A 5GT3D 2YFVB 3VH5A 5B2JC 2UWXA 1ID3C 1KX3C 3AV1C 4XZQD 5KDMB 1U35D 5DNMB 4J8XC 5B2ID 5BNVA 3REHA 2ZY2A 4Z66D 3MGRB 1WWSA 3UTBC 3MGQA 3MGPC 3B0CW 3AFAB 3MGSC 5DNND 3TU4A 5B24A 1AOIA 3C1CB 5F99A 4KGCD 3MNND 2F8NH 1P34B 3X1SB 5CPJC 3W99D 2BYMB 3KXBA 2HUEB 1M19A 2FJ7C 5B31C 1H3OB 4H9QA 5B0ZA 3W98C 3RELD 5GT3B 4DQYB 3AZFC 3EPKA 5BNXB 5JRGC 3V9RB 5B40A 2FFFB 4NE3A 3REKB 3WKJD 5CPKA 2IO5B 4XZQB 5BT1C 3AZMA 5AV8A 1U35B 2Y2PA 4WNNA 2PYOA 1P3KD 4Z2MG 3AZIC 2Y2QA 3AZLC 4UUZA 5E5AC 5B2IB 4Z66B 2YFVA 4JJNA 4KUDC 5DNNB 1P3FD 5GXQC 3W97C 4LD9A 3MVDA 4J8UD 1TZYA 4KGCB 3MNNB 3P5JB 3UTAD 3VH5T 3W99B 3MGRA 4QLCD 2CV5C 3AZKD 3AYWD 1M1AC 5GT0C 5DNMC 3LELD 3AV2A 3AN2D 3C1CA 3WKJB 1P34A 5B1MA 3AFAC 4XUJB 3X1SA 1AOID 2BYMA 1F66C 3WAAA 3AZED 1P3KB 3LZ1C 1P3BA 1H3OA 3REJC 2ZY3A 5GT3A 1P3PD 3V9RA 3VH5W 3LZ0D 3REKA 5B0ZD 1P3FB 1P3GD 3X1UD 4J8UB 4YS3C 3REID 5B40D 1P3OA 3C1BB 5GSUC 3UTAB 3H0RC 4H9NA 5CPIA 4Z66A 4QLCB 5AV9A 3LJAC 5B33D 2YFWA 4XZQC 4WV4B 3AZKB 2PYOD 3AYWB 1BFMA 1U35C 2VQRA 2L5AA 4DRAA 4R8PD 2BG1A 3LELB 5B2IC 2RVQC 3AN2B 4KGCA 4JJND 3KFUG 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 D;  3MVD D;  1AOI B;  3B6G A;  5DNN C;  1TZY D;  2ARO A;  3AZE B;  3MNN C;  5CHL B;  3KUY A;  1P3P B;  3A6N D;  1ULY A;  3W99 C;  3W96 C;  3LZ0 B;  5B0Z B;  1P3G B;  3X1U B;  4AWL B;  3WKJ A;  3VH6 T;  3REI B;  4XUJ A;  5B1L B;  3REL C;  5B40 B;  4WU8 B;  3AV2 D;  4X23 D;  3KWQ D;  1P3K A;  3AZN D;  5B1M D;  3UT9 D;  1HQ3 D;  3X1S D;  5B33 B;  4WNN B;  2PYO B;  3WAA D;  3WTP B;  3NQU A;  1P3B D;  4J8U A;  4R8P B;  2NZD A;  4CSR A;  4JJN B;  3C1B A;  3REK D;  3UTA A;  4LD9 B;  3MVD B;  5C3I B;  1P3F C;  1TZY B;  3O62 C;  4HGA C;  4QLC A;  1P3O D;  3AZK A;  3AYW A;  5CPI D;  5AVB B;  3A6N B;  5AV9 D;  2CWE A;  3LEL A;  3AN2 A;  5AV6 A;  3X1V D;  3AV2 B;  3REH C;  4X23 B;  3KWQ B;  3AZE A;  3AZN B;  3MGQ C;  1ZLA D;  5B1M B;  3UT9 B;  1HQ3 B;  1EQZ D;  3B6G D;  3NQJ A;  3TU4 C;  5B24 C;  1P3P A;  2ARO D;  1AOI C;  3WAA B;  4NE6 A;  5F99 C;  3LZ0 A;  1P3B B;  1P3G A;  3X1U A;  3KUY D;  5JA4 A;  3REI A;  5B1L A;  4WU8 A;  5B32 G;  5B31 G;  3KXB C;  1F1E A;  1M19 C;  2HIO D;  4G92 C;  4XUJ D;  5B0Z C;  3X1U C;  4AWL C;  4ZBJ B;  1P3O B;  5B33 A;  5B40 C;  5B32 A;  3WTP A;  4H9N B;  5CPI B;  1KX4 A;  4CAY B;  4J8V D;  5CPK C;  5AV9 B;  4R8P A;  2YFW B;  3AZM C;  5AV5 D;  5AV8 C;  2PYO C;  3X1V B;  1P3M A;  2NZD D;  1S32 D;  1ZLA B;  3C1B D;  4JJN C;  1P3A D;  1EQZ B;  3B6G B;  1KX5 B;  1P3I A;  5AVB A;  3A6N A;  2ARO B;  3MVD C;  1P3L A;  3VH6 A;  3WA9 A;  4LD9 C;  1TZY C;  3KUY B;  4KHA B;  1B67 A;  4NFT A;  3R45 B;  3MGR C;  5AV6 D;  4X23 A;  3KWQ A;  4J8W B;  3AZN A;  1KX3 D;  3UT9 A;  2HIO B;  1HQ3 A;  3AZH B;  3AV2 C;  3C1C C;  4J8X D;  1KU5 A;  4J8V B;  1P34 C;  5B1M C;  1BH8 B;  3UTB D;  3X1S C;  2BYK B;  3MGP D;  5AV5 B;  3NQU B;  5BS7 A;  3MGS D;  4YM6 A;  3WAA C;  2HUE C;  1P3B C;  2NZD B;  4CSR B;  5B1L D;  4WU8 D;  5GT3 C;  3AZJ A;  4WU9 A;  1S32 B;  2JSS A;  3X1T A;  1P3A B;  3REK C;  4H9S A;  4CAY A;  2IO5 C;  5G49 B;  2FJ7 D;  5B32 D;  3WTP D;  5B31 D;  1P3O C;  4H9P A;  4Z5T A;  3W98 D;  1KX4 D;  3AZG D;  3AZF D;  3X1V A;  2NQB A;  5B2J B;  5CPI C;  5JRG D;  4Z66 C;  5AV9 C;  1KX3 B;  1JFI B;  1ZLA A;  1P3M D;  1EQZ A;  5BT1 D;  1KX5 A;  4KGC C;  4E45 A;  4J8X B;  3AZL D;  4KHA A;  3NQJ B;  5AY8 A;  3UTB B;  1P3I D;  5AVB D;  1P3L D;  3WA9 D;  3MGP B;  3B6G C;  1N1J B;  4KUD D;  3MGS B;  3R45 A;  2ARO C;  4J8W A;  3W97 D;  1M18 A;  5JA4 B;  1B6W A;  2HIO A;  5AVC A;  4EO5 B;  4NE5 A;  3KUY C;  3B6F A;  3AZH A;  3WKJ C;  4J8V A;  1BH8 A;  4XUJ C;  2CV5 D;  2FJ7 B;  2BYK A;  5AV5 A;  5B32 B;  5B31 B;  2F8N G;  3W98 B;  4G91 B;  1KX4 B;  5GT0 D;  1P3K C;  3AZG B;  3AZF B;  5CP6 A;  5JRG B;  1BH9 B;  1S32 A;  5B0Y A;  4YM6 D;  2LY8 A;  1P3M B;  1P3A A;  4J8U C;  3AZJ D;  4WU9 D;  5G49 A;  1F66 D;  2NZD C;  3VH6 W;  3LZ1 D;  3X1T D;  3C1B C;  5E5A B;  3REJ D;  3AZL B;  3UTA C;  3B0C T;  1P3I B;  1P3L B;  3WA9 B;  1TAF B;  2F8N K;  5B2J A;  4KUD B;  1ID3 A;  4QLC C;  1KX3 A;  5GXQ B;  1JFI A;  3W97 B;  4Z5T D;  5BO0 B;  3AZK C;  4YS3 D;  3AYW C;  3AV1 A;  2NQB D;  5GSU D;  1Q9C A;  3LEL C;  3AN2 C;  5AV6 C;  4H9R B;  4J8X A;  4ZUX D;  3UTB A;  3LJA D;  2CV5 B;  1KX5 D;  3MGP A;  1N1J A;  3MGS A;  1M1A B;  5GT0 B;  3AZE C;  5AY8 D;  2RVQ D;  1P3P C;  4YM6 B;  4J8W D;  1M18 D;  5AVC D;  3LZ0 C;  5CPJ A;  1P3G C;  3AZJ B;  3B6F D;  4WU9 B;  3REI C;  4EO5 C;  5B1L C;  3AZH D;  1F66 B;  3LZ1 B;  2FJ7 A;  4WU8 C;  3X1T B;  5B31 A;  3REJ B;  3W98 A;  3AZG A;  3AZF A;  5JRG A;  1BH9 A;  4DRB A;  3W96 D;  4H9P B;  4Z5T B;  5B33 C;  4H9O A;  5B32 C;  3WTP C;  4YS3 B;  5CP6 D;  2NQB B;  4G91 C;  1KX4 C;  1R4V A;  3B0D B;  3AZG C;  4R8P C;  5GSU B;  5B0Y D;  3AZI A;  2F8N D;  1WWI A;  3AZL A;  5E5A A;  4ZUX B;  3LJA B;  5C3I C;  1TAF A;  1P3M C;  4KUD A;  3W97 A;  5GXQ A;  5AY8 B;  5BO0 A;  5B2J D;  1P3I C;  5AVB C;  3A6N C;  1P3L C;  3WA9 C;  1ID3 D;  1M18 B;  5AVC B;  4H9R A;  3AV1 D;  3O62 D;  3B6F B;  4E44 A;  2CV5 A;  5FUG B;  5KDM A;  1M1A A;  5GT0 A;  4X23 C;  3KWQ C;  3AZN C;  3UT9 C;  1HQ3 C;  5DNM A;  3W96 B;  3AFA A;  5CP6 B;  3REL B;  5B0Y B;  3REH D;  1F66 A;  3LZ1 A;  3MGQ D;  4Z2M H;  2F8N B;  5BS7 C;  5CPJ D;  4YM6 C;  3REJ A;  3TU4 D;  5B24 D;  4ZBJ C;  5F99 D;  3AZJ C;  4WU9 C;  3WTP E;  3X1T C;  4YS3 A;  4H9S C;  1ID3 B;  3KXB D;  5GSU A;  5BNX A;  1M19 D;  3B0B A;  4WZS B;  3O62 B;  3AV1 B;  4Z5T C;  4HGA B;  4ZUX A;  3LJA A;  3X1V C;  2NQB C;  4XZQ A;  3B0D C;  3AZI D;  1U35 A;  1ZLA C;  5E5A D;  5CPK D;  1EQZ C;  5B2I A;  4ZUX C;  3AZM D;  1KX5 C;  5AV8 D;  5GXQ D;  5DNN A;  5AY8 C;  5BNV B;  3REH B;  3MGQ B;  5FUG A;  3MNN A;  5CPJ B;  4J8W C;  1M18 C;  3TU4 B;  5B24 B;  2HIO C;  5AVC C;  3W99 A;  3W96 A;  5F99 B;  3B6F C;  3AZH C;  1M1A D;  1HTA A;  5DNM D;  3REL A;  4J8V C;  3KXB B;  3MGR D;  1M19 B;  5AV5 C;  4H9O B;  3AFA D;  4M6B A;  4G92 B;  4H9Q B;  2F8N A;  5CP6 C;  3AZI B;  3C1C D;  1S32 C;  5B0Y C;  5CPK B;  1P34 D;  3KSY A;  1P3A C;  3AZM B;  1A7W A;  5AV8 B;  1P3F A;  4UUZ B;  3O62 A;  5GT3 D;  2YFV B;  3VH5 A;  5B2J C;  1ID3 C;  1KX3 C;  3AV1 C;  4XZQ D;  5KDM B;  1U35 D;  5DNM B;  4J8X C;  5B2I D;  5BNV A;  3REH A;  3UTB C;  4Z66 D;  3MGR B;  1WWS A;  3MGQ A;  3MGP C;  3B0C W;  3AFA B;  3MGS C;  5DNN D;  3TU4 A;  5B24 A;  1AOI A;  3C1C B;  5F99 A;  4KGC D;  3MNN D;  2F8N H;  1P34 B;  3X1S B;  5CPJ C;  3W99 D;  2BYM B;  3KXB A;  2HUE B;  1M19 A;  2FJ7 C;  5B31 C;  1H3O B;  4H9Q A;  5B0Z A;  3W98 C;  3REL D;  5GT3 B;  3AZF C;  5BNX B;  3V9R B;  5JRG C;  5B40 A;  4NE3 A;  3REK B;  3WKJ D;  5CPK A;  2IO5 B;  4XZQ B;  5BT1 C;  3AZM A;  5AV8 A;  1U35 B;  4WNN A;  2PYO A;  1P3K D;  4Z2M G;  3AZI C;  3AZL C;  4UUZ A;  5E5A C;  5B2I B;  4Z66 B;  2YFV A;  4JJN A;  4KUD C;  5DNN B;  1P3F D;  5GXQ C;  3W97 C;  4LD9 A;  3MVD A;  4J8U D;  1TZY A;  4KGC B;  3MNN B;  3UTA D;  3VH5 T;  3W99 B;  3MGR A;  4QLC D;  2CV5 C;  3AZK D;  3AYW D;  1M1A C;  5GT0 C;  5DNM C;  3LEL D;  3AV2 A;  3AN2 D;  3C1C A;  3WKJ B;  1P34 A;  5B1M A;  3AFA C;  4XUJ B;  3X1S A;  1AOI D;  2BYM A;  1F66 C;  3WAA A;  3AZE D;  1P3K B;  3LZ1 C;  1P3B A;  1H3O A;  3REJ C;  5GT3 A;  1P3P D;  3V9R A;  3VH5 W;  3LZ0 D;  3REK A;  5B0Z D;  1P3F B;  1P3G D;  3X1U D;  4J8U B;  4YS3 C;  3REI D;  5B40 D;  1P3O A;  3C1B B;  5GSU C;  3UTA B;  4H9N A;  5CPI A;  4Z66 A;  4QLC B;  5AV9 A;  3LJA C;  5B33 D;  2YFW A;  4XZQ C;  4WV4 B;  3AZK B;  2PYO D;  3AYW B;  1BFM A;  1U35 C;  2L5A A;  4DRA A;  4R8P D;  3LEL B;  5B2I C;  2RVQ C;  3AN2 B;  4KGC A;  4JJN D;  5AV6 B; 
#chains in the Genus database with same CATH topology
 4LD9 D;  3MVD D;  1AOI B;  3B6G A;  5DNN C;  1TZY D;  2ARO A;  3AZE B;  3MNN C;  5CHL B;  3KUY A;  1P3P B;  3A6N D;  1ULY A;  3W99 C;  3W96 C;  3LZ0 B;  5B0Z B;  1P3G B;  3X1U B;  4AWL B;  3WKJ A;  3VH6 T;  3REI B;  4XUJ A;  5B1L B;  3REL C;  5B40 B;  4WU8 B;  3AV2 D;  2Y2J A;  2RIQ A;  4X23 D;  3KWQ D;  3AZN D;  1P3K A;  5B1M D;  3UT9 D;  1HQ3 D;  3X1S D;  5B33 B;  4WNN B;  2PYO B;  3WAA D;  3WTP B;  3NQU A;  1P3B D;  4J8U A;  4R8P B;  2NZD A;  2J8P A;  4CSR A;  4JJN B;  3C1B A;  3REK D;  3UTA A;  4LD9 B;  3MVD B;  5C3I B;  1P3F C;  1TZY B;  3O62 C;  4HGA C;  2DQN C;  4QLC A;  1P3O D;  3AZK A;  1PZR A;  3AYW A;  5CPI D;  5AVB B;  3A6N B;  5AV9 D;  2CWE A;  3LEL A;  3AN2 A;  5AV6 A;  3X1V D;  3AV2 B;  3REH C;  4X23 B;  3KWQ B;  3AZE A;  3AZN B;  3MGQ C;  1ZLA D;  5B1M B;  3UT9 B;  1HQ3 B;  1EQZ D;  3B6G D;  2JE5 A;  3NQJ A;  5B24 C;  3TU4 C;  1P3P A;  2ARO D;  1AOI C;  3WAA B;  4NE6 A;  5F99 C;  3LZ0 A;  1P3B B;  1P3G A;  3X1U A;  3KUY D;  5JA4 A;  1T3U A;  3REI A;  5B1L A;  4WU8 A;  5B32 G;  5B31 G;  3KXB C;  1F1E A;  1M19 C;  2HIO D;  4G92 C;  4XUJ D;  5B0Z C;  3X1U C;  4AWL C;  4ZBJ B;  1P3O B;  5B33 A;  5B40 C;  5B32 A;  3WTP A;  4H9N B;  5CPI B;  1KX4 A;  4CAY B;  4J8V D;  5CPK C;  5AV9 B;  4R8P A;  1W2E A;  2YFW B;  3AZM C;  5AV5 D;  5AV8 C;  2PYO C;  3X1V B;  1P3M A;  2NZD D;  2Y2L A;  1S32 D;  1ZLA B;  3C1B D;  4JJN C;  1P3A D;  1EQZ B;  3B6G B;  1KX5 B;  1P3I A;  5AVB A;  3A6N A;  2ARO B;  3MVD C;  1P3L A;  3VH6 A;  3WA9 A;  4LD9 C;  1TZY C;  3EG5 B;  3KUY B;  4KHA B;  1B67 A;  4NFT A;  2XD5 A;  3R45 B;  3MGR C;  5AV6 D;  4X23 A;  3H0L C;  3KWQ A;  4J8W B;  3AZN A;  3UT9 A;  2HIO B;  1KX3 D;  1HQ3 A;  3AZH B;  3F6T A;  3AV2 C;  3C1C C;  4J8X D;  1KU5 A;  4J8V B;  1P34 C;  5B1M C;  1BH8 B;  3UTB D;  3X1S C;  2BYK B;  3MGP D;  5AV5 B;  3NQU B;  5BS7 A;  3MGS D;  4YM6 A;  3WAA C;  2HUE C;  1P3B C;  2NZD B;  4CSR B;  5B1L D;  4WU8 D;  5GT3 C;  3AZJ A;  4WU9 A;  1S32 B;  2JSS A;  3FDD A;  3X1T A;  1P3A B;  3REK C;  4H9S A;  2W8S A;  4CAY A;  2IO5 C;  5G49 B;  2FJ7 D;  5B32 D;  3WTP D;  5B31 D;  1P3O C;  4H9P A;  4Z5T A;  3W98 D;  1KX4 D;  3AZG D;  3AZF D;  3X1V A;  2NQB A;  5B2J B;  5CPI C;  5JRG D;  4Z66 C;  5AV9 C;  1KX3 B;  1JFI B;  1ZLA A;  1P3M D;  1EQZ A;  5BT1 D;  1KX5 A;  2Y2O A;  4KGC C;  4E45 A;  4J8X B;  3AZL D;  4KHA A;  3NQJ B;  5AY8 A;  3UTB B;  1P3I D;  5AVB D;  1P3L D;  3WA9 D;  3MGP B;  3B6G C;  1N1J B;  4KUD D;  3MGS B;  3R45 A;  2ARO C;  4J8W A;  3W97 D;  2F2A C;  1M18 A;  5JA4 B;  1B6W A;  2HIO A;  5AVC A;  4EO5 B;  4NE5 A;  3KUY C;  3B6F A;  3AZH A;  1Z2C B;  3WKJ C;  4J8V A;  1BH8 A;  4XUJ C;  2CV5 D;  2FJ7 B;  2BYK A;  5AV5 A;  5B32 B;  5B31 B;  2F8N G;  3W98 B;  4G91 B;  1KX4 B;  5GT0 D;  1P3K C;  3AZG B;  3AZF B;  5CP6 A;  5JRG B;  1BH9 B;  2DF4 C;  2Y2I A;  1S32 A;  2JCH A;  5B0Y A;  4YM6 D;  2LY8 A;  1P3M B;  1P3A A;  4J8U C;  3AZJ D;  4WU9 D;  5G49 A;  1F66 D;  2NZD C;  3VH6 W;  3LZ1 D;  3X1T D;  3C1B C;  5E5A B;  3REJ D;  3AZL B;  3UTA C;  3B0C T;  1P3I B;  1P3L B;  3WA9 B;  1TAF B;  2F8N K;  5B2J A;  4KUD B;  1ID3 A;  4QLC C;  1KX3 A;  5GXQ B;  1JFI A;  3W97 B;  4Z5T D;  5BO0 B;  3AZK C;  4YS3 D;  3AYW C;  3AV1 A;  2NQB D;  2G5H C;  5GSU D;  1Q9C A;  3LEL C;  3AN2 C;  5AV6 C;  4H9R B;  4J8X A;  4ZUX D;  3UTB A;  3LJA D;  3IP4 C;  2CV5 B;  1KX5 D;  3AL0 C;  3MGP A;  1N1J A;  3MGS A;  1M1A B;  5GT0 B;  3AZE C;  5AY8 D;  3H0M C;  2RVQ D;  1P3P C;  4YM6 B;  4J8W D;  1M18 D;  5AVC D;  3LZ0 C;  5CPJ A;  1P3G C;  3AZJ B;  3B6F D;  4WU9 B;  3REI C;  4EO5 C;  5B1L C;  3AZH D;  1F66 B;  3LZ1 B;  2FJ7 A;  4WU8 C;  3X1T B;  5B31 A;  3REJ B;  2XD1 A;  3W98 A;  3AZG A;  3AZF A;  5JRG A;  1BH9 A;  4DRB A;  3W96 D;  4H9P B;  4Z5T B;  5B33 C;  2Y2N A;  4H9O A;  5B32 C;  3WTP C;  4YS3 B;  5CP6 D;  2NQB B;  4G91 C;  1KX4 C;  1R4V A;  3B0D B;  3AZG C;  4R8P C;  5GSU B;  5B0Y D;  3AZI A;  2F8N D;  1WWI A;  3EPJ A;  5E5A A;  3AZL A;  4ZUX B;  3LJA B;  2Y2M A;  4UPK A;  5C3I C;  1TAF A;  1P3M C;  4KUD A;  3A1I A;  3W97 A;  5GXQ A;  5AY8 B;  5BO0 A;  5B2J D;  1P3I C;  5AVB C;  3A6N C;  1P3L C;  3WA9 C;  1ID3 D;  1M18 B;  5AVC B;  4H9R A;  3AV1 D;  3O62 D;  4WJ3 C;  3B6F B;  4E44 A;  2CV5 A;  2Y2K A;  5FUG B;  5KDM A;  1M1A A;  5GT0 A;  4X23 C;  3KWQ C;  3AZN C;  3UT9 C;  1HQ3 C;  5DNM A;  3W96 B;  3AFA A;  5CP6 B;  3REL B;  5B0Y B;  3REH D;  1F66 A;  3LZ1 A;  3MGQ D;  4Z2M H;  2F8N B;  5BS7 C;  5CPJ D;  4YM6 C;  3REJ A;  3TU4 D;  5B24 D;  3EPH A;  4ZBJ C;  5F99 D;  3AZJ C;  4WU9 C;  3WTP E;  3X1T C;  4YS3 A;  4H9S C;  1ID3 B;  3KXB D;  3A1K A;  5GSU A;  5BNX A;  1M19 D;  3B0B A;  4WZS B;  3O62 B;  3AV1 B;  4Z5T C;  4HGA B;  4ZUX A;  3LJA A;  3X1V C;  2NQB C;  4XZQ A;  3B0D C;  3AZI D;  1U35 A;  1ZLA C;  5E5A D;  5CPK D;  1EQZ C;  5B2I A;  4ZUX C;  3AZM D;  1KX5 C;  5AV8 D;  2Y2H A;  5GXQ D;  5DNN A;  5AY8 C;  5BNV B;  3EPL A;  3REH B;  3MGQ B;  5FUG A;  3MNN A;  5CPJ B;  4J8W C;  1M18 C;  3TU4 B;  2Y2G A;  5B24 B;  2HIO C;  5AVC C;  3W99 A;  3W96 A;  5F99 B;  3B6F C;  3AZH C;  1M1A D;  2G5I C;  1HTA A;  5DNM D;  3REL A;  4J8V C;  3KXB B;  3MGR D;  1M19 B;  5AV5 C;  4H9O B;  3AFA D;  4M6B A;  4G92 B;  4H9Q B;  2F8N A;  5CP6 C;  2ZM5 A;  3AZI B;  3C1C D;  1S32 C;  5B0Y C;  5CPK B;  1P34 D;  3KSY A;  1P3A C;  3AZM B;  1A7W A;  2ZY4 A;  5AV8 B;  2ZY5 A;  1P3F A;  4UUZ B;  3O62 A;  5GT3 D;  2YFV B;  3VH5 A;  5B2J C;  2UWX A;  1ID3 C;  1KX3 C;  3AV1 C;  4XZQ D;  5KDM B;  1U35 D;  5DNM B;  4J8X C;  5B2I D;  5BNV A;  3REH A;  2ZY2 A;  4Z66 D;  3MGR B;  1WWS A;  3UTB C;  3MGQ A;  3MGP C;  3B0C W;  3AFA B;  3MGS C;  5DNN D;  3TU4 A;  5B24 A;  1AOI A;  3C1C B;  5F99 A;  4KGC D;  3MNN D;  2F8N H;  1P34 B;  3X1S B;  5CPJ C;  3W99 D;  2BYM B;  3KXB A;  2HUE B;  1M19 A;  2FJ7 C;  5B31 C;  1H3O B;  4H9Q A;  5B0Z A;  3W98 C;  3REL D;  5GT3 B;  4DQY B;  3AZF C;  3EPK A;  5BNX B;  5JRG C;  3V9R B;  5B40 A;  2FFF B;  4NE3 A;  3REK B;  3WKJ D;  5CPK A;  2IO5 B;  4XZQ B;  5BT1 C;  3AZM A;  5AV8 A;  1U35 B;  2Y2P A;  4WNN A;  2PYO A;  1P3K D;  4Z2M G;  3AZI C;  2Y2Q A;  3AZL C;  4UUZ A;  5E5A C;  5B2I B;  4Z66 B;  2YFV A;  4JJN A;  4KUD C;  5DNN B;  1P3F D;  5GXQ C;  3W97 C;  4LD9 A;  3MVD A;  4J8U D;  1TZY A;  4KGC B;  3MNN B;  3P5J B;  3UTA D;  3VH5 T;  3W99 B;  3MGR A;  4QLC D;  2CV5 C;  3AZK D;  3AYW D;  1M1A C;  5GT0 C;  5DNM C;  3LEL D;  3AV2 A;  3AN2 D;  3C1C A;  3WKJ B;  1P34 A;  5B1M A;  3AFA C;  4XUJ B;  3X1S A;  1AOI D;  2BYM A;  1F66 C;  3WAA A;  3AZE D;  1P3K B;  3LZ1 C;  1P3B A;  1H3O A;  3REJ C;  2ZY3 A;  5GT3 A;  1P3P D;  3V9R A;  3VH5 W;  3LZ0 D;  3REK A;  5B0Z D;  1P3F B;  1P3G D;  3X1U D;  4J8U B;  4YS3 C;  3REI D;  5B40 D;  1P3O A;  3C1B B;  5GSU C;  3UTA B;  3H0R C;  4H9N A;  5CPI A;  4Z66 A;  4QLC B;  5AV9 A;  3LJA C;  5B33 D;  2YFW A;  4XZQ C;  4WV4 B;  3AZK B;  2PYO D;  3AYW B;  1BFM A;  1U35 C;  2VQR A;  2L5A A;  4DRA A;  4R8P D;  2BG1 A;  3LEL B;  5B2I C;  2RVQ C;  3AN2 B;  4KGC A;  4JJN D;  3KFU G;  5AV6 B; 
#chains in the Genus database with same CATH homology
 4LD9 D;  3MVD D;  1AOI B;  3B6G A;  5DNN C;  1TZY D;  2ARO A;  3AZE B;  3MNN C;  5CHL B;  3KUY A;  1P3P B;  3A6N D;  1ULY A;  3W99 C;  3W96 C;  3LZ0 B;  5B0Z B;  1P3G B;  3X1U B;  4AWL B;  3WKJ A;  3VH6 T;  3REI B;  4XUJ A;  5B1L B;  3REL C;  5B40 B;  4WU8 B;  3AV2 D;  2Y2J A;  2RIQ A;  4X23 D;  3KWQ D;  3AZN D;  1P3K A;  5B1M D;  3UT9 D;  1HQ3 D;  3X1S D;  5B33 B;  4WNN B;  2PYO B;  3WAA D;  3WTP B;  3NQU A;  1P3B D;  4J8U A;  4R8P B;  2NZD A;  2J8P A;  4CSR A;  4JJN B;  3C1B A;  3REK D;  3UTA A;  4LD9 B;  3MVD B;  5C3I B;  1P3F C;  1TZY B;  3O62 C;  4HGA C;  2DQN C;  4QLC A;  1P3O D;  3AZK A;  1PZR A;  3AYW A;  5CPI D;  5AVB B;  3A6N B;  5AV9 D;  2CWE A;  3LEL A;  3AN2 A;  5AV6 A;  3X1V D;  3AV2 B;  3REH C;  4X23 B;  3KWQ B;  3AZE A;  3AZN B;  3MGQ C;  1ZLA D;  5B1M B;  3UT9 B;  1HQ3 B;  1EQZ D;  3B6G D;  2JE5 A;  3NQJ A;  5B24 C;  3TU4 C;  1P3P A;  2ARO D;  1AOI C;  3WAA B;  4NE6 A;  5F99 C;  3LZ0 A;  1P3B B;  1P3G A;  3X1U A;  3KUY D;  5JA4 A;  1T3U A;  3REI A;  5B1L A;  4WU8 A;  5B32 G;  5B31 G;  3KXB C;  1F1E A;  1M19 C;  2HIO D;  4G92 C;  4XUJ D;  5B0Z C;  3X1U C;  4AWL C;  4ZBJ B;  1P3O B;  5B33 A;  5B40 C;  5B32 A;  3WTP A;  4H9N B;  5CPI B;  1KX4 A;  4CAY B;  4J8V D;  5CPK C;  5AV9 B;  4R8P A;  1W2E A;  2YFW B;  3AZM C;  5AV5 D;  5AV8 C;  2PYO C;  3X1V B;  1P3M A;  2NZD D;  2Y2L A;  1S32 D;  1ZLA B;  3C1B D;  4JJN C;  1P3A D;  1EQZ B;  3B6G B;  1KX5 B;  1P3I A;  5AVB A;  3A6N A;  2ARO B;  3MVD C;  1P3L A;  3VH6 A;  3WA9 A;  4LD9 C;  1TZY C;  3EG5 B;  3KUY B;  4KHA B;  1B67 A;  4NFT A;  2XD5 A;  3R45 B;  3MGR C;  5AV6 D;  4X23 A;  3H0L C;  3KWQ A;  4J8W B;  3AZN A;  3UT9 A;  2HIO B;  1KX3 D;  1HQ3 A;  3AZH B;  3F6T A;  3AV2 C;  3C1C C;  4J8X D;  1KU5 A;  4J8V B;  1P34 C;  5B1M C;  1BH8 B;  3UTB D;  3X1S C;  2BYK B;  3MGP D;  5AV5 B;  3NQU B;  5BS7 A;  3MGS D;  4YM6 A;  3WAA C;  2HUE C;  1P3B C;  2NZD B;  4CSR B;  5B1L D;  4WU8 D;  5GT3 C;  3AZJ A;  4WU9 A;  1S32 B;  2JSS A;  3FDD A;  3X1T A;  1P3A B;  3REK C;  4H9S A;  2W8S A;  4CAY A;  2IO5 C;  5G49 B;  2FJ7 D;  5B32 D;  3WTP D;  5B31 D;  1P3O C;  4H9P A;  4Z5T A;  3W98 D;  1KX4 D;  3AZG D;  3AZF D;  3X1V A;  2NQB A;  5B2J B;  5CPI C;  5JRG D;  4Z66 C;  5AV9 C;  1KX3 B;  1JFI B;  1ZLA A;  1P3M D;  1EQZ A;  5BT1 D;  1KX5 A;  2Y2O A;  4KGC C;  4E45 A;  4J8X B;  3AZL D;  4KHA A;  3NQJ B;  5AY8 A;  3UTB B;  1P3I D;  5AVB D;  1P3L D;  3WA9 D;  3MGP B;  3B6G C;  1N1J B;  4KUD D;  3MGS B;  3R45 A;  2ARO C;  4J8W A;  3W97 D;  2F2A C;  1M18 A;  5JA4 B;  1B6W A;  2HIO A;  5AVC A;  4EO5 B;  4NE5 A;  3KUY C;  3B6F A;  3AZH A;  1Z2C B;  3WKJ C;  4J8V A;  1BH8 A;  4XUJ C;  2CV5 D;  2FJ7 B;  2BYK A;  5AV5 A;  5B32 B;  5B31 B;  2F8N G;  3W98 B;  4G91 B;  1KX4 B;  5GT0 D;  1P3K C;  3AZG B;  3AZF B;  5CP6 A;  5JRG B;  1BH9 B;  2DF4 C;  2Y2I A;  1S32 A;  2JCH A;  5B0Y A;  4YM6 D;  2LY8 A;  1P3M B;  1P3A A;  4J8U C;  3AZJ D;  4WU9 D;  5G49 A;  1F66 D;  2NZD C;  3VH6 W;  3LZ1 D;  3X1T D;  3C1B C;  5E5A B;  3REJ D;  3AZL B;  3UTA C;  3B0C T;  1P3I B;  1P3L B;  3WA9 B;  1TAF B;  2F8N K;  5B2J A;  4KUD B;  1ID3 A;  4QLC C;  1KX3 A;  5GXQ B;  1JFI A;  3W97 B;  4Z5T D;  5BO0 B;  3AZK C;  4YS3 D;  3AYW C;  3AV1 A;  2NQB D;  2G5H C;  5GSU D;  1Q9C A;  3LEL C;  3AN2 C;  5AV6 C;  4H9R B;  4J8X A;  4ZUX D;  3UTB A;  3LJA D;  3IP4 C;  2CV5 B;  1KX5 D;  3AL0 C;  3MGP A;  1N1J A;  3MGS A;  1M1A B;  5GT0 B;  3AZE C;  5AY8 D;  3H0M C;  2RVQ D;  1P3P C;  4YM6 B;  4J8W D;  1M18 D;  5AVC D;  3LZ0 C;  5CPJ A;  1P3G C;  3AZJ B;  3B6F D;  4WU9 B;  3REI C;  4EO5 C;  5B1L C;  3AZH D;  1F66 B;  3LZ1 B;  2FJ7 A;  4WU8 C;  3X1T B;  5B31 A;  3REJ B;  2XD1 A;  3W98 A;  3AZG A;  3AZF A;  5JRG A;  1BH9 A;  4DRB A;  3W96 D;  4H9P B;  4Z5T B;  5B33 C;  2Y2N A;  4H9O A;  5B32 C;  3WTP C;  4YS3 B;  5CP6 D;  2NQB B;  4G91 C;  1KX4 C;  1R4V A;  3B0D B;  3AZG C;  4R8P C;  5GSU B;  5B0Y D;  3AZI A;  2F8N D;  1WWI A;  3EPJ A;  5E5A A;  3AZL A;  4ZUX B;  3LJA B;  2Y2M A;  4UPK A;  5C3I C;  1TAF A;  1P3M C;  4KUD A;  3A1I A;  3W97 A;  5GXQ A;  5AY8 B;  5BO0 A;  5B2J D;  1P3I C;  5AVB C;  3A6N C;  1P3L C;  3WA9 C;  1ID3 D;  1M18 B;  5AVC B;  4H9R A;  3AV1 D;  3O62 D;  4WJ3 C;  3B6F B;  4E44 A;  2CV5 A;  2Y2K A;  5FUG B;  5KDM A;  1M1A A;  5GT0 A;  4X23 C;  3KWQ C;  3AZN C;  3UT9 C;  1HQ3 C;  5DNM A;  3W96 B;  3AFA A;  5CP6 B;  3REL B;  5B0Y B;  3REH D;  1F66 A;  3LZ1 A;  3MGQ D;  4Z2M H;  2F8N B;  5BS7 C;  5CPJ D;  4YM6 C;  3REJ A;  3TU4 D;  5B24 D;  3EPH A;  4ZBJ C;  5F99 D;  3AZJ C;  4WU9 C;  3WTP E;  3X1T C;  4YS3 A;  4H9S C;  1ID3 B;  3KXB D;  3A1K A;  5GSU A;  5BNX A;  1M19 D;  3B0B A;  4WZS B;  3O62 B;  3AV1 B;  4Z5T C;  4HGA B;  4ZUX A;  3LJA A;  3X1V C;  2NQB C;  4XZQ A;  3B0D C;  3AZI D;  1U35 A;  1ZLA C;  5E5A D;  5CPK D;  1EQZ C;  5B2I A;  4ZUX C;  3AZM D;  1KX5 C;  5AV8 D;  2Y2H A;  5GXQ D;  5DNN A;  5AY8 C;  5BNV B;  3EPL A;  3REH B;  3MGQ B;  5FUG A;  3MNN A;  5CPJ B;  4J8W C;  1M18 C;  3TU4 B;  2Y2G A;  5B24 B;  2HIO C;  5AVC C;  3W99 A;  3W96 A;  5F99 B;  3B6F C;  3AZH C;  1M1A D;  2G5I C;  1HTA A;  5DNM D;  3REL A;  4J8V C;  3KXB B;  3MGR D;  1M19 B;  5AV5 C;  4H9O B;  3AFA D;  4M6B A;  4G92 B;  4H9Q B;  2F8N A;  5CP6 C;  2ZM5 A;  3AZI B;  3C1C D;  1S32 C;  5B0Y C;  5CPK B;  1P34 D;  3KSY A;  1P3A C;  3AZM B;  1A7W A;  2ZY4 A;  5AV8 B;  2ZY5 A;  1P3F A;  4UUZ B;  3O62 A;  5GT3 D;  2YFV B;  3VH5 A;  5B2J C;  2UWX A;  1ID3 C;  1KX3 C;  3AV1 C;  4XZQ D;  5KDM B;  1U35 D;  5DNM B;  4J8X C;  5B2I D;  5BNV A;  3REH A;  2ZY2 A;  4Z66 D;  3MGR B;  1WWS A;  3UTB C;  3MGQ A;  3MGP C;  3B0C W;  3AFA B;  3MGS C;  5DNN D;  3TU4 A;  5B24 A;  1AOI A;  3C1C B;  5F99 A;  4KGC D;  3MNN D;  2F8N H;  1P34 B;  3X1S B;  5CPJ C;  3W99 D;  2BYM B;  3KXB A;  2HUE B;  1M19 A;  2FJ7 C;  5B31 C;  1H3O B;  4H9Q A;  5B0Z A;  3W98 C;  3REL D;  5GT3 B;  4DQY B;  3AZF C;  3EPK A;  5BNX B;  5JRG C;  3V9R B;  5B40 A;  2FFF B;  4NE3 A;  3REK B;  3WKJ D;  5CPK A;  2IO5 B;  4XZQ B;  5BT1 C;  3AZM A;  5AV8 A;  1U35 B;  2Y2P A;  4WNN A;  2PYO A;  1P3K D;  4Z2M G;  3AZI C;  2Y2Q A;  3AZL C;  4UUZ A;  5E5A C;  5B2I B;  4Z66 B;  2YFV A;  4JJN A;  4KUD C;  5DNN B;  1P3F D;  5GXQ C;  3W97 C;  4LD9 A;  3MVD A;  4J8U D;  1TZY A;  4KGC B;  3MNN B;  3P5J B;  3UTA D;  3VH5 T;  3W99 B;  3MGR A;  4QLC D;  2CV5 C;  3AZK D;  3AYW D;  1M1A C;  5GT0 C;  5DNM C;  3LEL D;  3AV2 A;  3AN2 D;  3C1C A;  3WKJ B;  1P34 A;  5B1M A;  3AFA C;  4XUJ B;  3X1S A;  1AOI D;  2BYM A;  1F66 C;  3WAA A;  3AZE D;  1P3K B;  3LZ1 C;  1P3B A;  1H3O A;  3REJ C;  2ZY3 A;  5GT3 A;  1P3P D;  3V9R A;  3VH5 W;  3LZ0 D;  3REK A;  5B0Z D;  1P3F B;  1P3G D;  3X1U D;  4J8U B;  4YS3 C;  3REI D;  5B40 D;  1P3O A;  3C1B B;  5GSU C;  3UTA B;  3H0R C;  4H9N A;  5CPI A;  4Z66 A;  4QLC B;  5AV9 A;  3LJA C;  5B33 D;  2YFW A;  4XZQ C;  4WV4 B;  3AZK B;  2PYO D;  3AYW B;  1BFM A;  1U35 C;  2VQR A;  2L5A A;  4DRA A;  4R8P D;  2BG1 A;  3LEL B;  5B2I C;  2RVQ C;  3AN2 B;  4KGC A;  4JJN D;  3KFU G;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...