4YS3B

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3B00
2NQBA 3B6GA 3LZ1C 4R8PB 3AZLB 5AV6A 5AY8C 3W99B 3KUYA 5B32C 2CV5A 5CPJB 4G91C 3AZGB 5CP6A 4J8VA 3AV2C 3X1SB 2F8NK 1U35A 4WU9B 5GSUA 1ID3A 4J8WC 3AN2B 3REJC 3MGQB 1P3GD 4UUZB 3AZHB 2YFVA 5BO0A 1P3AC 3UT9D 5CPKD 2IO5C 3W96D 5B40C 4YM6B 5B33C 3AFAC 3UTBB 5GXQB 3B6FC 5B1MA 3MGSA 1JFIA 3O62D 4G91B 5BS7A 5F99D 3AYWB 2FJ7A 4H9SA 3LJAC 3WAAA 2HIOD 3A6NB 1KX3C 3C1CB 4J8XB 3REKA 3AZLD 3B0CT 1M1AA 4KHAB 5BNVB 4QLCC 1N1JB 3AZGD 1KX4B 4X23D 1KX5A 3X1UC 5B33B 3AZID 3AFAB 5CPIC 4ZUXA 4ZBJB 3WKJA 4Z66C 3KWQB 1AOIB 5E5AC 4CAYB 1F1EA 3W98D 3REIC 3MGRD 4E44A 3AZMA 3AZNC 3AV1A 1P34C 4EO5B 3LZ1D 5B31A 5B32D 5AV8C 1M19B 2NQBB 3B6GB 3AV2D 1P3IA 5GT0A 2AROC 5CPKA 5AV6B 2CV5B 5E5AB 3REJD 5GT3A 4LD9C 5C3IC 4WNNB 5JRGC 5B2JC 5CP6B 4J8VB 3AZFC 1HQ3A 3O62A 5F99A 1ID3B 4H9OB 3RELB 4WZSB 5B33D 3AFAD 5FUGA 1P3LC 2F8NH 2YFWA 3NQJA 2HUEB 3V9RB 3MNNA 1P3KA 1P3BB 2YFVB 4H9NB 5B0YC 3KWQD 4XZQC 1P3GC 4Z5TC 1P3OC 1WWIA 3LJAD 5CHLB 3C1BA 4DRAA 1KX3D 3AZJB 3UT9C 4H9RA 3AZIA 5B2JB 5B24A 5AVBC 1S32B 4QLCD 2PYOA 4M6BA 3WA9A 2CWEA 3X1UD 1M18B 3AZEB 5CPID 1P3LB 3W98A 2HIOC 3MGRA 1H3OB 3REHC 5AVCC 3LZ0A 5E5AD 3LZ1A 1BH9A 1KX5B 4R8PC 5AY8A 3VH6T 1EQZA 3W99C 3REID 5CPJC 3WKJB 3AZGC 3LELA 3AZND 5JA4B 3RELD 3AV2A 3X1SC 3X1TB 4KGCA 5B1LA 4XUJA 4J8WA 4WU9C 3REJA 5AV8D 3AN2C 3NQUA 3MGQC 2BYKA 3AZKA 3AZMB 3AV1B 3AZHC 1P3MA 5B31B 1P3AA 5B2IB 3X1VA 5B40A 3AZJD 4LD9D 3B6FA 5JRGD 5B2JD 4KUDB 3WTPA 4YM6C 4WV4B 3KXBA 3UTBC 3AZFD 5GXQC 1S32D 4Z2MG 1TZYB 3AYWC 1M18D 3AZED 1P3LD 5KDMB 1F66B 1HQ3B 3A6NC 5B0YD 1ULYA 5DNMB 5B0ZB 3C1CC 4XZQD 4J8XC 3MVDA 4Z5TD 1P3OD 4QLCA 5AV5C 2YFWB 3NQJB 1P3KB 1KX4C 4AWLB 4WU8C 5AVBD 4ZBJC 4Z66A 4YS3B 4DRBA 4G92C 3KWQC 1AOIC 3UTAB 1P3PC 4CSRA 3REIA 1P3FC 3REHD 3VH5W 5AVCD 1P34A 4J8UA 2PYOB 3TU4B 4Z2MH 4EO5C 4R8PD 5AV8A 3W99D 5AV5B 5AV9A 5CPJD 1M19C 3LZ0B 5DNNA 1Q9CA 3VH5A 2NQBC 3B6GC 4WU8B 3X1SD 2AROA 1BH9B 4WU9D 3R45A 3W97B 5B32G 1BH8A 5AV6C 4G92B 1EQZB 2CV5C 3AN2D 4LD9A 3MGQD 4JJNB 2NZDB 3AZFA 3LELB 1P3PB 2F8NB 5CP6C 3MGPB 3AZHD 4J8VC 1P3FB 4KGCB 5B1LB 5GSUC 1ID3C 3RELC 4YM6D 1A7WA 3UTBD 3AZKB 5GXQD 1P3MB 4YS3D 5B0YA 2HUEC 1ZLAB 1P3BC 4XZQA 3X1VB 1P3GA 4Z5TA 1P3OA 3UTAD 3AYWD 3WTPB 3KXBB 3UT9A 3W96A 3A6ND 3AZJC 2LY8A 3KUYB 3C1CD 3TU4D 5BS7C 4J8XD 1B6WA 5BNXA 1U35B 5AV5D 1S32C 3WAAC 5GSUB 1KX4D 3B0DB 2BYMA 4H9QA 1M18C 3AZEC 4WU8D 2HIOA 3REHA 3REKC 5AVCA 5BO0B 1AOID 4R8PA 3AZLA 1P3PD 1KX5C 4HGAB 1P3FD 1B67A 3AZGA 5B1MB 3MGSB 3WKJC 4X23A 1JFIB 3X1SA 2FJ7B 4WU9A 3X1TC 4NE6A 4CSRB 3MGQA 3WAAB 1M19D 4J8UB 3AZMC 3AV1C 2NQBD 3B6GD 3REKB 5B31C 1M1AB 5B2IC 5AV6D 2CV5D 5AV9B 1BFMA 3UTBA 5GXQA 5DNNB 5CP6D 4KUDC 4J8VD 5B32A 1U35D 5GT0C 4ZUXB 3R45B 5GSUD 1ID3D 1BH8B 3AYWA 1TZYC 3A6NA 1F66C 1HQ3C 1P3BD 3C1CA 5DNMC 5B0ZC 4KHAA 5BNVA 1N1JA 1KX4A 3MNNC 1P3KC 4AWLC 5B33A 3AFAA 1P3IB 2RVQC 4YS3C 3KWQA 5GT0B 1AOIA 3WAAD 5CPKB 3UTAC 5GT3B 3LJAA 3REKD 1KX3A 1M1AD 3O62B 5F99B 2PYOC 3TU4C 2BYMB 1KX5D 5FUGB 3MNNB 3B0CW 3WKJD 3X1UA 3LZ0C 5CPIA 3X1TD 5BT1D 3W97C 5E5AA 3C1BB 1EQZC 4H9PA 4WNNA 4JJNC 4E45A 2NZDC 4X23B 4H9RB 3LELC 3AZIB 3AZMD 3AV1D 1TAFA 3MGPC 5B31D 4KGCC 5B1LC 5B24B 5B2ID 4XUJC 3AZNA 4H9OA 3RELA 1KU5A 4KUDD 3WA9B 3AZKC 3V9RA 1P3BA 1P3ID 1P3MC 4H9NA 1ZLAC 5GT0D 3W98B 3MGRB 3X1VC 1TZYD 5GT3D 3LZ1B 4NFTA 3WTPC 3KXBC 3AZJA 5AY8B 1HQ3D 1F66D 5B32B 5DNMD 3KUYC 5B2JA 5JRGA 5B0ZD 3AV2B 1S32A 5G49A 1U35C 4XUJB 4J8WB 3MNND 1P3KD 3REJB 3B0DC 1M18A 3AZEA 3NQUB 1P3LA 2BYKB 3MVDC 1H3OA 2RVQD 1P3AB 3C1BD 2IO5B 2L5AA 5B40B 3B6FB 1HTAA 4HGAC 5B24D 5B1MC 3MGSC 5JA4A 3KSYA 2PYOD 3X1TA 2F8NG 3VH5T 3WA9D 5AVBA 3LJAB 4H9SC 2FJ7C 1KX3B 1WWSA 3LZ0D 4J8UC 3MVDB 5B2IA 5AY8D 3W97D 1M1AC 4QLCB 1EQZD 5AV9C 4JJND 4KUDA 2NZDD 3X1UB 3LELD 5DNNC 2F8ND 3MGPD 5CPIB 3W99A 1R4VA 5CPJA 4KGCD 4NE3A 5B1LD 4ZUXC 4XUJD 4Z66B 4J8WD 1TZYA 3VH6W 4H9PB 5KDMA 3AZKD 1F66A 5BT1C 1TAFB 1P3MD 5DNMA 1P3AD 3AN2A 1ZLAD 3REIB 5B0ZA 3X1VD 5B40D 3AZNB 2JSSA 4UUZA 3AZHA 1P34B 3B6FD 3WTPD 3VH6A 3KXBD 5AV8B 3KUYD 4YM6A 3WTPE 4YS3A 2AROB 1P3IC 5CPKC 3W96C 3UTAA 4LD9B 5C3IB 5JRGB 5GT3C 3AZFB 3MVDD 5G49B 3O62C 3TU4A 4J8XA 5F99C 5AV5A 5B1MD 3MGSD 5B0YB 4Z66D 4XZQB 4WU8A 1P3GB 4Z5TB 1P3OB 3AZLC 2FJ7D 3W97A 3UT9B 3C1BC 4JJNA 2NZDA 3W96B 4CAYA 1P3PA 2F8NA 1P34D 3MGPA 3B0BA 4X23C 4J8UD 3AZIC 1P3FA 5AVBB 4NE5A 5BNXB 5B24C 5AV9D 5DNND 4H9QB 3WA9C 1ZLAA 5B31G 2AROD 2HIOB 3REHB 1M19A 5AVCB 4ZUXD 3W98C 3MGRC
chains in the Genus database with same CATH superfamily
2NQBA 3B6GA 3LZ1C 4R8PB 3AZLB 5AV6A 5AY8C 3W99B 3KUYA 5B32C 2CV5A 5CPJB 4G91C 3AZGB 5CP6A 4J8VA 3AV2C 3X1SB 2F8NK 1U35A 4WU9B 5GSUA 1ID3A 4J8WC 3AN2B 3REJC 3MGQB 1P3GD 4UUZB 3AZHB 2YFVA 5BO0A 1P3AC 3UT9D 5CPKD 2IO5C 3W96D 5B40C 4YM6B 5B33C 3AFAC 3UTBB 5GXQB 3B6FC 5B1MA 3MGSA 1JFIA 3O62D 4G91B 5BS7A 5F99D 2J8PA 3AYWB 2FJ7A 4H9SA 3LJAC 3WAAA 2HIOD 3A6NB 1KX3C 3C1CB 4J8XB 3REKA 3AZLD 3B0CT 1M1AA 2Y2LA 4KHAB 5BNVB 4QLCC 1N1JB 3AZGD 1KX4B 4X23D 1KX5A 3X1UC 5B33B 3AZID 3AFAB 5CPIC 3EPJA 4ZUXA 4ZBJB 2DF4C 3WKJA 4Z66C 3KWQB 1AOIB 5E5AC 4CAYB 2ZY3A 1F1EA 2Y2JA 3W98D 3REIC 3MGRD 4E44A 3AZMA 3AZNC 3AV1A 1P34C 4EO5B 3LZ1D 5B31A 2Y2NA 5B32D 5AV8C 1M19B 2VQRA 2NQBB 3B6GB 3AV2D 1P3IA 2G5IC 5GT0A 2AROC 5CPKA 5AV6B 2CV5B 5E5AB 3REJD 3AL0C 5GT3A 4LD9C 5C3IC 4WNNB 5JRGC 5B2JC 5CP6B 4J8VB 3AZFC 1HQ3A 3O62A 5F99A 1ID3B 4H9OB 3RELB 4WZSB 5B33D 3AFAD 5FUGA 1P3LC 2F8NH 2YFWA 3NQJA 2HUEB 3V9RB 3MNNA 1P3KA 1P3BB 2YFVB 4H9NB 5B0YC 3KWQD 4XZQC 1W2EA 1P3GC 4Z5TC 1P3OC 1WWIA 3LJAD 5CHLB 3P5JB 3C1BA 4DRAA 1KX3D 3AZJB 3UT9C 4H9RA 3AZIA 3EPLA 5B2JB 2Y2HA 5B24A 5AVBC 1S32B 4QLCD 2PYOA 4M6BA 3WA9A 2CWEA 2JE5A 3X1UD 1M18B 3AZEB 5CPID 1P3LB 3W98A 2HIOC 3MGRA 1H3OB 3REHC 5AVCC 3LZ0A 5E5AD 3LZ1A 1BH9A 1KX5B 4R8PC 5AY8A 3EPHA 3VH6T 1EQZA 3W99C 3REID 5CPJC 3WKJB 3AZGC 3LELA 3AZND 5JA4B 3RELD 3AV2A 3X1SC 3X1TB 4KGCA 5B1LA 4XUJA 4J8WA 4WU9C 3REJA 5AV8D 3AN2C 3NQUA 3MGQC 2BYKA 3AZKA 3AZMB 3AV1B 3AZHC 1P3MA 5B31B 1P3AA 5B2IB 3X1VA 5B40A 3AZJD 4LD9D 3B6FA 5JRGD 2ZY2A 5B2JD 4KUDB 3WTPA 4YM6C 4WV4B 3KXBA 3UTBC 3AZFD 5GXQC 1S32D 4Z2MG 1TZYB 3AYWC 1M18D 3AZED 1P3LD 5KDMB 2Y2GA 1HQ3B 1F66B 2Y2IA 3A6NC 5B0YD 1ULYA 5DNMB 5B0ZB 3C1CC 4XZQD 4J8XC 3MVDA 4Z5TD 1P3OD 2UWXA 4QLCA 5AV5C 2YFWB 3NQJB 1P3KB 1KX4C 4AWLB 4WU8C 5AVBD 4ZBJC 4Z66A 4YS3B 4DRBA 4G92C 3KWQC 1AOIC 3A1IA 3UTAB 1P3PC 3EG5B 4CSRA 3REIA 1P3FC 3REHD 3VH5W 5AVCD 1P34A 4J8UA 2PYOB 3TU4B 4Z2MH 4EO5C 4R8PD 2FFFB 5AV8A 3W99D 5AV5B 5AV9A 5CPJD 1M19C 3LZ0B 5DNNA 1Q9CA 3VH5A 2NQBC 3B6GC 4WU8B 3X1SD 2AROA 1BH9B 4WU9D 3R45A 3W97B 5B32G 1BH8A 5AV6C 4G92B 1EQZB 2CV5C 3AN2D 4LD9A 3MGQD 4JJNB 2NZDB 3AZFA 3LELB 1P3PB 2F8NB 5CP6C 3MGPB 2ZM5A 4J8VC 3AZHD 1P3FB 4KGCB 1PZRA 5B1LB 5GSUC 1ID3C 2Y2QA 3RELC 4YM6D 1A7WA 3UTBD 3AZKB 5GXQD 1P3MB 4YS3D 5B0YA 2HUEC 1ZLAB 1P3BC 4XZQA 3X1VB 1P3GA 4Z5TA 1P3OA 3UTAD 3AYWD 3WTPB 3KXBB 3UT9A 3W96A 3A6ND 3AZJC 2LY8A 3KUYB 3C1CD 3TU4D 5BS7C 4J8XD 1B6WA 5BNXA 2Y2MA 1U35B 2ZY4A 5AV5D 1S32C 3WAAC 5GSUB 1KX4D 3B0DB 2BYMA 4H9QA 1M18C 3AZEC 4WU8D 2HIOA 3REHA 3REKC 5AVCA 2RIQA 5BO0B 1AOID 4R8PA 3AZLA 1P3PD 1KX5C 2DQNC 4HGAB 1P3FD 1B67A 3AZGA 5B1MB 3MGSB 3WKJC 4X23A 1JFIB 4UPKA 3X1SA 2FJ7B 4WU9A 3X1TC 4WJ3C 4NE6A 4CSRB 3MGQA 3WAAB 1M19D 4J8UB 3AZMC 3AV1C 2NQBD 3B6GD 3REKB 5B31C 2JCHA 1M1AB 5B2IC 5AV6D 2CV5D 5AV9B 1BFMA 3UTBA 5GXQA 5DNNB 5CP6D 4KUDC 4J8VD 5B32A 1U35D 5GT0C 4ZUXB 3R45B 5GSUD 1ID3D 1BH8B 3AYWA 1TZYC 3A6NA 1F66C 1HQ3C 2Y2PA 1P3BD 3C1CA 5DNMC 5B0ZC 4KHAA 5BNVA 1N1JA 1KX4A 3MNNC 1P3KC 4AWLC 5B33A 3AFAA 2BG1A 1P3IB 2RVQC 4YS3C 3KWQA 5GT0B 1AOIA 3WAAD 5CPKB 3UTAC 5GT3B 3LJAA 3REKD 2G5HC 1KX3A 1M1AD 3O62B 3KFUG 5F99B 2PYOC 2Y2KA 3TU4C 2BYMB 1KX5D 5FUGB 3MNNB 3B0CW 3WKJD 3X1UA 3LZ0C 5CPIA 3X1TD 5BT1D 3W97C 5E5AA 3C1BB 1EQZC 4H9PA 4WNNA 4JJNC 4E45A 2NZDC 4X23B 4H9RB 3LELC 3AZIB 3AZMD 3AV1D 1TAFA 3MGPC 5B31D 4KGCC 5B1LC 5B2ID 5B24B 4XUJC 3AZNA 4H9OA 3H0RC 3RELA 1KU5A 4KUDD 3WA9B 3AZKC 3V9RA 1P3BA 1P3ID 1P3MC 4H9NA 1ZLAC 5GT0D 3W98B 3MGRB 3X1VC 1TZYD 5GT3D 3LZ1B 4NFTA 3WTPC 3KXBC 3AZJA 5AY8B 1HQ3D 2XD1A 5B32B 1F66D 5DNMD 3KUYC 5B2JA 5JRGA 5B0ZD 3AV2B 1S32A 5G49A 1U35C 4XUJB 4J8WB 3MNND 1P3KD 3REJB 3B0DC 1M18A 3AZEA 3NQUB 1P3LA 2BYKB 3MVDC 1H3OA 2XD5A 2RVQD 1P3AB 3C1BD 2Y2OA 2IO5B 2L5AA 5B40B 3B6FB 1HTAA 4HGAC 5B24D 5B1MC 3MGSC 2W8SA 5JA4A 3KSYA 2PYOD 3X1TA 2F8NG 3VH5T 3WA9D 5AVBA 3LJAB 4H9SC 2FJ7C 1KX3B 1WWSA 3LZ0D 2F2AC 4J8UC 3MVDB 3FDDA 5B2IA 5AY8D 3W97D 1M1AC 4QLCB 1EQZD 5AV9C 4JJND 4KUDA 2NZDD 3H0MC 3X1UB 3LELD 5DNNC 2F8ND 3MGPD 5CPIB 3W99A 1R4VA 3A1KA 5CPJA 4NE3A 5B1LD 4KGCD 4ZUXC 4XUJD 4Z66B 4J8WD 1TZYA 3VH6W 4H9PB 3H0LC 5KDMA 3AZKD 1F66A 5BT1C 1TAFB 1P3MD 5DNMA 1P3AD 3AN2A 1ZLAD 3REIB 5B0ZA 3X1VD 5B40D 3AZNB 2JSSA 4UUZA 3AZHA 1P34B 3B6FD 3WTPD 3VH6A 3KXBD 5AV8B 2ZY5A 3KUYD 4YM6A 3WTPE 4YS3A 2AROB 1P3IC 1Z2CB 5CPKC 3W96C 3UTAA 4LD9B 5C3IB 3EPKA 5JRGB 5GT3C 3AZFB 3MVDD 3F6TA 5G49B 3O62C 3TU4A 4J8XA 5F99C 5AV5A 4DQYB 5B1MD 3MGSD 5B0YB 4Z66D 4XZQB 4WU8A 1P3GB 4Z5TB 1P3OB 3AZLC 2FJ7D 3W97A 3UT9B 3C1BC 4JJNA 2NZDA 3W96B 4CAYA 1P3PA 2F8NA 1P34D 3MGPA 3B0BA 4X23C 4J8UD 3AZIC 1P3FA 5AVBB 4NE5A 5BNXB 5B24C 3IP4C 5AV9D 1T3UA 5DNND 4H9QB 3WA9C 1ZLAA 5B31G 2AROD 2HIOB 3REHB 1M19A 5AVCB 4ZUXD 3W98C 3MGRC
chains in the Genus database with same CATH topology
2NQBA 3B6GA 3LZ1C 4R8PB 3AZLB 5AV6A 5AY8C 3W99B 3KUYA 5B32C 2CV5A 5CPJB 4G91C 3AZGB 5CP6A 4J8VA 3AV2C 3X1SB 2F8NK 1U35A 4WU9B 5GSUA 1ID3A 4J8WC 3AN2B 3REJC 3MGQB 1P3GD 4UUZB 3AZHB 2YFVA 5BO0A 1P3AC 3UT9D 5CPKD 2IO5C 3W96D 5B40C 4YM6B 5B33C 3AFAC 3UTBB 5GXQB 3B6FC 5B1MA 3MGSA 1JFIA 3O62D 4G91B 5BS7A 5F99D 2J8PA 3AYWB 2FJ7A 4H9SA 3LJAC 3WAAA 2HIOD 3A6NB 1KX3C 3C1CB 4J8XB 3REKA 3AZLD 3B0CT 1M1AA 2Y2LA 4KHAB 5BNVB 4QLCC 1N1JB 3AZGD 1KX4B 4X23D 1KX5A 3X1UC 5B33B 3AZID 3AFAB 5CPIC 3EPJA 4ZUXA 4ZBJB 2DF4C 3WKJA 4Z66C 3KWQB 1AOIB 5E5AC 4CAYB 2ZY3A 1F1EA 2Y2JA 3W98D 3REIC 3MGRD 4E44A 3AZMA 3AZNC 3AV1A 1P34C 4EO5B 3LZ1D 5B31A 2Y2NA 5B32D 5AV8C 1M19B 2VQRA 2NQBB 3B6GB 3AV2D 1P3IA 2G5IC 5GT0A 2AROC 5CPKA 5AV6B 2CV5B 5E5AB 3REJD 3AL0C 5GT3A 4LD9C 5C3IC 4WNNB 5JRGC 5B2JC 5CP6B 4J8VB 3AZFC 1HQ3A 3O62A 5F99A 1ID3B 4H9OB 3RELB 4WZSB 5B33D 3AFAD 5FUGA 1P3LC 2F8NH 2YFWA 3NQJA 2HUEB 3V9RB 3MNNA 1P3KA 1P3BB 2YFVB 4H9NB 5B0YC 3KWQD 4XZQC 1W2EA 1P3GC 4Z5TC 1P3OC 1WWIA 3LJAD 5CHLB 3P5JB 3C1BA 4DRAA 1KX3D 3AZJB 3UT9C 4H9RA 3AZIA 3EPLA 5B2JB 2Y2HA 5B24A 5AVBC 1S32B 4QLCD 2PYOA 4M6BA 3WA9A 2CWEA 2JE5A 3X1UD 1M18B 3AZEB 5CPID 1P3LB 3W98A 2HIOC 3MGRA 1H3OB 3REHC 5AVCC 3LZ0A 5E5AD 3LZ1A 1BH9A 1KX5B 4R8PC 5AY8A 3EPHA 3VH6T 1EQZA 3W99C 3REID 5CPJC 3WKJB 3AZGC 3LELA 3AZND 5JA4B 3RELD 3AV2A 3X1SC 3X1TB 4KGCA 5B1LA 4XUJA 4J8WA 4WU9C 3REJA 5AV8D 3AN2C 3NQUA 3MGQC 2BYKA 3AZKA 3AZMB 3AV1B 3AZHC 1P3MA 5B31B 1P3AA 5B2IB 3X1VA 5B40A 3AZJD 4LD9D 3B6FA 5JRGD 2ZY2A 5B2JD 4KUDB 3WTPA 4YM6C 4WV4B 3KXBA 3UTBC 3AZFD 5GXQC 1S32D 4Z2MG 1TZYB 3AYWC 1M18D 3AZED 1P3LD 5KDMB 2Y2GA 1HQ3B 1F66B 2Y2IA 3A6NC 5B0YD 1ULYA 5DNMB 5B0ZB 3C1CC 4XZQD 4J8XC 3MVDA 4Z5TD 1P3OD 2UWXA 4QLCA 5AV5C 2YFWB 3NQJB 1P3KB 1KX4C 4AWLB 4WU8C 5AVBD 4ZBJC 4Z66A 4YS3B 4DRBA 4G92C 3KWQC 1AOIC 3A1IA 3UTAB 1P3PC 3EG5B 4CSRA 3REIA 1P3FC 3REHD 3VH5W 5AVCD 1P34A 4J8UA 2PYOB 3TU4B 4Z2MH 4EO5C 4R8PD 2FFFB 5AV8A 3W99D 5AV5B 5AV9A 5CPJD 1M19C 3LZ0B 5DNNA 1Q9CA 3VH5A 2NQBC 3B6GC 4WU8B 3X1SD 2AROA 1BH9B 4WU9D 3R45A 3W97B 5B32G 1BH8A 5AV6C 4G92B 1EQZB 2CV5C 3AN2D 4LD9A 3MGQD 4JJNB 2NZDB 3AZFA 3LELB 1P3PB 2F8NB 5CP6C 3MGPB 2ZM5A 4J8VC 3AZHD 1P3FB 4KGCB 1PZRA 5B1LB 5GSUC 1ID3C 2Y2QA 3RELC 4YM6D 1A7WA 3UTBD 3AZKB 5GXQD 1P3MB 4YS3D 5B0YA 2HUEC 1ZLAB 1P3BC 4XZQA 3X1VB 1P3GA 4Z5TA 1P3OA 3UTAD 3AYWD 3WTPB 3KXBB 3UT9A 3W96A 3A6ND 3AZJC 2LY8A 3KUYB 3C1CD 3TU4D 5BS7C 4J8XD 1B6WA 5BNXA 2Y2MA 1U35B 2ZY4A 5AV5D 1S32C 3WAAC 5GSUB 1KX4D 3B0DB 2BYMA 4H9QA 1M18C 3AZEC 4WU8D 2HIOA 3REHA 3REKC 5AVCA 2RIQA 5BO0B 1AOID 4R8PA 3AZLA 1P3PD 1KX5C 2DQNC 4HGAB 1P3FD 1B67A 3AZGA 5B1MB 3MGSB 3WKJC 4X23A 1JFIB 4UPKA 3X1SA 2FJ7B 4WU9A 3X1TC 4WJ3C 4NE6A 4CSRB 3MGQA 3WAAB 1M19D 4J8UB 3AZMC 3AV1C 2NQBD 3B6GD 3REKB 5B31C 2JCHA 1M1AB 5B2IC 5AV6D 2CV5D 5AV9B 1BFMA 3UTBA 5GXQA 5DNNB 5CP6D 4KUDC 4J8VD 5B32A 1U35D 5GT0C 4ZUXB 3R45B 5GSUD 1ID3D 1BH8B 3AYWA 1TZYC 3A6NA 1F66C 1HQ3C 2Y2PA 1P3BD 3C1CA 5DNMC 5B0ZC 4KHAA 5BNVA 1N1JA 1KX4A 3MNNC 1P3KC 4AWLC 5B33A 3AFAA 2BG1A 1P3IB 2RVQC 4YS3C 3KWQA 5GT0B 1AOIA 3WAAD 5CPKB 3UTAC 5GT3B 3LJAA 3REKD 2G5HC 1KX3A 1M1AD 3O62B 3KFUG 5F99B 2PYOC 2Y2KA 3TU4C 2BYMB 1KX5D 5FUGB 3MNNB 3B0CW 3WKJD 3X1UA 3LZ0C 5CPIA 3X1TD 5BT1D 3W97C 5E5AA 3C1BB 1EQZC 4H9PA 4WNNA 4JJNC 4E45A 2NZDC 4X23B 4H9RB 3LELC 3AZIB 3AZMD 3AV1D 1TAFA 3MGPC 5B31D 4KGCC 5B1LC 5B2ID 5B24B 4XUJC 3AZNA 4H9OA 3H0RC 3RELA 1KU5A 4KUDD 3WA9B 3AZKC 3V9RA 1P3BA 1P3ID 1P3MC 4H9NA 1ZLAC 5GT0D 3W98B 3MGRB 3X1VC 1TZYD 5GT3D 3LZ1B 4NFTA 3WTPC 3KXBC 3AZJA 5AY8B 1HQ3D 2XD1A 5B32B 1F66D 5DNMD 3KUYC 5B2JA 5JRGA 5B0ZD 3AV2B 1S32A 5G49A 1U35C 4XUJB 4J8WB 3MNND 1P3KD 3REJB 3B0DC 1M18A 3AZEA 3NQUB 1P3LA 2BYKB 3MVDC 1H3OA 2XD5A 2RVQD 1P3AB 3C1BD 2Y2OA 2IO5B 2L5AA 5B40B 3B6FB 1HTAA 4HGAC 5B24D 5B1MC 3MGSC 2W8SA 5JA4A 3KSYA 2PYOD 3X1TA 2F8NG 3VH5T 3WA9D 5AVBA 3LJAB 4H9SC 2FJ7C 1KX3B 1WWSA 3LZ0D 2F2AC 4J8UC 3MVDB 3FDDA 5B2IA 5AY8D 3W97D 1M1AC 4QLCB 1EQZD 5AV9C 4JJND 4KUDA 2NZDD 3H0MC 3X1UB 3LELD 5DNNC 2F8ND 3MGPD 5CPIB 3W99A 1R4VA 3A1KA 5CPJA 4NE3A 5B1LD 4KGCD 4ZUXC 4XUJD 4Z66B 4J8WD 1TZYA 3VH6W 4H9PB 3H0LC 5KDMA 3AZKD 1F66A 5BT1C 1TAFB 1P3MD 5DNMA 1P3AD 3AN2A 1ZLAD 3REIB 5B0ZA 3X1VD 5B40D 3AZNB 2JSSA 4UUZA 3AZHA 1P34B 3B6FD 3WTPD 3VH6A 3KXBD 5AV8B 2ZY5A 3KUYD 4YM6A 3WTPE 4YS3A 2AROB 1P3IC 1Z2CB 5CPKC 3W96C 3UTAA 4LD9B 5C3IB 3EPKA 5JRGB 5GT3C 3AZFB 3MVDD 3F6TA 5G49B 3O62C 3TU4A 4J8XA 5F99C 5AV5A 4DQYB 5B1MD 3MGSD 5B0YB 4Z66D 4XZQB 4WU8A 1P3GB 4Z5TB 1P3OB 3AZLC 2FJ7D 3W97A 3UT9B 3C1BC 4JJNA 2NZDA 3W96B 4CAYA 1P3PA 2F8NA 1P34D 3MGPA 3B0BA 4X23C 4J8UD 3AZIC 1P3FA 5AVBB 4NE5A 5BNXB 5B24C 3IP4C 5AV9D 1T3UA 5DNND 4H9QB 3WA9C 1ZLAA 5B31G 2AROD 2HIOB 3REHB 1M19A 5AVCB 4ZUXD 3W98C 3MGRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB A;  3B6G A;  3LZ1 C;  4R8P B;  3AZL B;  5AV6 A;  5AY8 C;  3W99 B;  3KUY A;  5B32 C;  2CV5 A;  5CPJ B;  4G91 C;  3AZG B;  5CP6 A;  4J8V A;  3AV2 C;  3X1S B;  2F8N K;  1U35 A;  4WU9 B;  5GSU A;  1ID3 A;  4J8W C;  3AN2 B;  3REJ C;  3MGQ B;  1P3G D;  4UUZ B;  3AZH B;  2YFV A;  5BO0 A;  1P3A C;  3UT9 D;  5CPK D;  2IO5 C;  3W96 D;  5B40 C;  4YM6 B;  5B33 C;  3AFA C;  3UTB B;  5GXQ B;  3B6F C;  5B1M A;  3MGS A;  1JFI A;  3O62 D;  4G91 B;  5BS7 A;  5F99 D;  3AYW B;  2FJ7 A;  4H9S A;  3LJA C;  3WAA A;  2HIO D;  3A6N B;  1KX3 C;  3C1C B;  4J8X B;  3REK A;  3AZL D;  3B0C T;  1M1A A;  4KHA B;  5BNV B;  4QLC C;  1N1J B;  3AZG D;  1KX4 B;  4X23 D;  1KX5 A;  3X1U C;  5B33 B;  3AZI D;  3AFA B;  5CPI C;  4ZUX A;  4ZBJ B;  3WKJ A;  4Z66 C;  3KWQ B;  1AOI B;  5E5A C;  4CAY B;  1F1E A;  3W98 D;  3REI C;  3MGR D;  4E44 A;  3AZM A;  3AZN C;  3AV1 A;  1P34 C;  4EO5 B;  3LZ1 D;  5B31 A;  5B32 D;  5AV8 C;  1M19 B;  2NQB B;  3B6G B;  3AV2 D;  1P3I A;  5GT0 A;  2ARO C;  5CPK A;  5AV6 B;  2CV5 B;  5E5A B;  3REJ D;  5GT3 A;  4LD9 C;  5C3I C;  4WNN B;  5JRG C;  5B2J C;  5CP6 B;  4J8V B;  3AZF C;  1HQ3 A;  3O62 A;  5F99 A;  1ID3 B;  4H9O B;  3REL B;  4WZS B;  5B33 D;  3AFA D;  5FUG A;  1P3L C;  2F8N H;  2YFW A;  3NQJ A;  2HUE B;  3V9R B;  3MNN A;  1P3K A;  1P3B B;  2YFV B;  4H9N B;  5B0Y C;  3KWQ D;  4XZQ C;  1P3G C;  4Z5T C;  1P3O C;  1WWI A;  3LJA D;  5CHL B;  3C1B A;  4DRA A;  1KX3 D;  3AZJ B;  3UT9 C;  4H9R A;  3AZI A;  5B2J B;  5B24 A;  5AVB C;  1S32 B;  4QLC D;  2PYO A;  4M6B A;  3WA9 A;  2CWE A;  3X1U D;  1M18 B;  3AZE B;  5CPI D;  1P3L B;  3W98 A;  2HIO C;  3MGR A;  1H3O B;  3REH C;  5AVC C;  3LZ0 A;  5E5A D;  3LZ1 A;  1BH9 A;  1KX5 B;  4R8P C;  5AY8 A;  3VH6 T;  1EQZ A;  3W99 C;  3REI D;  5CPJ C;  3WKJ B;  3AZG C;  3LEL A;  3AZN D;  5JA4 B;  3REL D;  3AV2 A;  3X1S C;  3X1T B;  4KGC A;  5B1L A;  4XUJ A;  4J8W A;  4WU9 C;  3REJ A;  5AV8 D;  3AN2 C;  3NQU A;  3MGQ C;  2BYK A;  3AZK A;  3AZM B;  3AV1 B;  3AZH C;  1P3M A;  5B31 B;  1P3A A;  5B2I B;  3X1V A;  5B40 A;  3AZJ D;  4LD9 D;  3B6F A;  5JRG D;  5B2J D;  4KUD B;  3WTP A;  4YM6 C;  4WV4 B;  3KXB A;  3UTB C;  3AZF D;  5GXQ C;  1S32 D;  4Z2M G;  1TZY B;  3AYW C;  1M18 D;  3AZE D;  1P3L D;  5KDM B;  1F66 B;  1HQ3 B;  3A6N C;  5B0Y D;  1ULY A;  5DNM B;  5B0Z B;  3C1C C;  4XZQ D;  4J8X C;  3MVD A;  4Z5T D;  1P3O D;  4QLC A;  5AV5 C;  2YFW B;  3NQJ B;  1P3K B;  1KX4 C;  4AWL B;  4WU8 C;  5AVB D;  4ZBJ C;  4Z66 A;  4YS3 B;  4DRB A;  4G92 C;  3KWQ C;  1AOI C;  3UTA B;  1P3P C;  4CSR A;  3REI A;  1P3F C;  3REH D;  3VH5 W;  5AVC D;  1P34 A;  4J8U A;  2PYO B;  3TU4 B;  4Z2M H;  4EO5 C;  4R8P D;  5AV8 A;  3W99 D;  5AV5 B;  5AV9 A;  5CPJ D;  1M19 C;  3LZ0 B;  5DNN A;  1Q9C A;  3VH5 A;  2NQB C;  3B6G C;  4WU8 B;  3X1S D;  2ARO A;  1BH9 B;  4WU9 D;  3R45 A;  3W97 B;  5B32 G;  1BH8 A;  5AV6 C;  4G92 B;  1EQZ B;  2CV5 C;  3AN2 D;  4LD9 A;  3MGQ D;  4JJN B;  2NZD B;  3AZF A;  3LEL B;  1P3P B;  2F8N B;  5CP6 C;  3MGP B;  3AZH D;  4J8V C;  1P3F B;  4KGC B;  5B1L B;  5GSU C;  1ID3 C;  3REL C;  4YM6 D;  1A7W A;  3UTB D;  3AZK B;  5GXQ D;  1P3M B;  4YS3 D;  5B0Y A;  2HUE C;  1ZLA B;  1P3B C;  4XZQ A;  3X1V B;  1P3G A;  4Z5T A;  1P3O A;  3UTA D;  3AYW D;  3WTP B;  3KXB B;  3UT9 A;  3W96 A;  3A6N D;  3AZJ C;  2LY8 A;  3KUY B;  3C1C D;  3TU4 D;  5BS7 C;  4J8X D;  1B6W A;  5BNX A;  1U35 B;  5AV5 D;  1S32 C;  3WAA C;  5GSU B;  1KX4 D;  3B0D B;  2BYM A;  4H9Q A;  1M18 C;  3AZE C;  4WU8 D;  2HIO A;  3REH A;  3REK C;  5AVC A;  5BO0 B;  1AOI D;  4R8P A;  3AZL A;  1P3P D;  1KX5 C;  4HGA B;  1P3F D;  1B67 A;  3AZG A;  5B1M B;  3MGS B;  3WKJ C;  4X23 A;  1JFI B;  3X1S A;  2FJ7 B;  4WU9 A;  3X1T C;  4NE6 A;  4CSR B;  3MGQ A;  3WAA B;  1M19 D;  4J8U B;  3AZM C;  3AV1 C;  2NQB D;  3B6G D;  3REK B;  5B31 C;  1M1A B;  5B2I C;  5AV6 D;  2CV5 D;  5AV9 B;  1BFM A;  3UTB A;  5GXQ A;  5DNN B;  5CP6 D;  4KUD C;  4J8V D;  5B32 A;  1U35 D;  5GT0 C;  4ZUX B;  3R45 B;  5GSU D;  1ID3 D;  1BH8 B;  3AYW A;  1TZY C;  3A6N A;  1F66 C;  1HQ3 C;  1P3B D;  3C1C A;  5DNM C;  5B0Z C;  4KHA A;  5BNV A;  1N1J A;  1KX4 A;  3MNN C;  1P3K C;  4AWL C;  5B33 A;  3AFA A;  1P3I B;  2RVQ C;  4YS3 C;  3KWQ A;  5GT0 B;  1AOI A;  3WAA D;  5CPK B;  3UTA C;  5GT3 B;  3LJA A;  3REK D;  1KX3 A;  1M1A D;  3O62 B;  5F99 B;  2PYO C;  3TU4 C;  2BYM B;  1KX5 D;  5FUG B;  3MNN B;  3B0C W;  3WKJ D;  3X1U A;  3LZ0 C;  5CPI A;  3X1T D;  5BT1 D;  3W97 C;  5E5A A;  3C1B B;  1EQZ C;  4H9P A;  4WNN A;  4JJN C;  4E45 A;  2NZD C;  4X23 B;  4H9R B;  3LEL C;  3AZI B;  3AZM D;  3AV1 D;  1TAF A;  3MGP C;  5B31 D;  4KGC C;  5B1L C;  5B24 B;  5B2I D;  4XUJ C;  3AZN A;  4H9O A;  3REL A;  1KU5 A;  4KUD D;  3WA9 B;  3AZK C;  3V9R A;  1P3B A;  1P3I D;  1P3M C;  4H9N A;  1ZLA C;  5GT0 D;  3W98 B;  3MGR B;  3X1V C;  1TZY D;  5GT3 D;  3LZ1 B;  4NFT A;  3WTP C;  3KXB C;  3AZJ A;  5AY8 B;  1HQ3 D;  1F66 D;  5B32 B;  5DNM D;  3KUY C;  5B2J A;  5JRG A;  5B0Z D;  3AV2 B;  1S32 A;  5G49 A;  1U35 C;  4XUJ B;  4J8W B;  3MNN D;  1P3K D;  3REJ B;  3B0D C;  1M18 A;  3AZE A;  3NQU B;  1P3L A;  2BYK B;  3MVD C;  1H3O A;  2RVQ D;  1P3A B;  3C1B D;  2IO5 B;  2L5A A;  5B40 B;  3B6F B;  1HTA A;  4HGA C;  5B24 D;  5B1M C;  3MGS C;  5JA4 A;  3KSY A;  2PYO D;  3X1T A;  2F8N G;  3VH5 T;  3WA9 D;  5AVB A;  3LJA B;  4H9S C;  2FJ7 C;  1KX3 B;  1WWS A;  3LZ0 D;  4J8U C;  3MVD B;  5B2I A;  5AY8 D;  3W97 D;  1M1A C;  4QLC B;  1EQZ D;  5AV9 C;  4JJN D;  4KUD A;  2NZD D;  3X1U B;  3LEL D;  5DNN C;  2F8N D;  3MGP D;  5CPI B;  3W99 A;  1R4V A;  5CPJ A;  4KGC D;  4NE3 A;  5B1L D;  4ZUX C;  4XUJ D;  4Z66 B;  4J8W D;  1TZY A;  3VH6 W;  4H9P B;  5KDM A;  3AZK D;  1F66 A;  5BT1 C;  1TAF B;  1P3M D;  5DNM A;  1P3A D;  3AN2 A;  1ZLA D;  3REI B;  5B0Z A;  3X1V D;  5B40 D;  3AZN B;  2JSS A;  4UUZ A;  3AZH A;  1P34 B;  3B6F D;  3WTP D;  3VH6 A;  3KXB D;  5AV8 B;  3KUY D;  4YM6 A;  3WTP E;  4YS3 A;  2ARO B;  1P3I C;  5CPK C;  3W96 C;  3UTA A;  4LD9 B;  5C3I B;  5JRG B;  5GT3 C;  3AZF B;  3MVD D;  5G49 B;  3O62 C;  3TU4 A;  4J8X A;  5F99 C;  5AV5 A;  5B1M D;  3MGS D;  5B0Y B;  4Z66 D;  4XZQ B;  4WU8 A;  1P3G B;  4Z5T B;  1P3O B;  3AZL C;  2FJ7 D;  3W97 A;  3UT9 B;  3C1B C;  4JJN A;  2NZD A;  3W96 B;  4CAY A;  1P3P A;  2F8N A;  1P34 D;  3MGP A;  3B0B A;  4X23 C;  4J8U D;  3AZI C;  1P3F A;  5AVB B;  4NE5 A;  5BNX B;  5B24 C;  5AV9 D;  5DNN D;  4H9Q B;  3WA9 C;  1ZLA A;  5B31 G;  2ARO D;  2HIO B;  3REH B;  1M19 A;  5AVC B;  4ZUX D;  3W98 C;  3MGR C; 
#chains in the Genus database with same CATH topology
 2NQB A;  3B6G A;  3LZ1 C;  4R8P B;  3AZL B;  5AV6 A;  5AY8 C;  3W99 B;  3KUY A;  5B32 C;  2CV5 A;  5CPJ B;  4G91 C;  3AZG B;  5CP6 A;  4J8V A;  3AV2 C;  3X1S B;  2F8N K;  1U35 A;  4WU9 B;  5GSU A;  1ID3 A;  4J8W C;  3AN2 B;  3REJ C;  3MGQ B;  1P3G D;  4UUZ B;  3AZH B;  2YFV A;  5BO0 A;  1P3A C;  3UT9 D;  5CPK D;  2IO5 C;  3W96 D;  5B40 C;  4YM6 B;  5B33 C;  3AFA C;  3UTB B;  5GXQ B;  3B6F C;  5B1M A;  3MGS A;  1JFI A;  3O62 D;  4G91 B;  5BS7 A;  5F99 D;  2J8P A;  3AYW B;  2FJ7 A;  4H9S A;  3LJA C;  3WAA A;  2HIO D;  3A6N B;  1KX3 C;  3C1C B;  4J8X B;  3REK A;  3AZL D;  3B0C T;  1M1A A;  2Y2L A;  4KHA B;  5BNV B;  4QLC C;  1N1J B;  3AZG D;  1KX4 B;  4X23 D;  1KX5 A;  3X1U C;  5B33 B;  3AZI D;  3AFA B;  5CPI C;  3EPJ A;  4ZUX A;  4ZBJ B;  2DF4 C;  3WKJ A;  4Z66 C;  3KWQ B;  1AOI B;  5E5A C;  4CAY B;  2ZY3 A;  1F1E A;  2Y2J A;  3W98 D;  3REI C;  3MGR D;  4E44 A;  3AZM A;  3AZN C;  3AV1 A;  1P34 C;  4EO5 B;  3LZ1 D;  5B31 A;  2Y2N A;  5B32 D;  5AV8 C;  1M19 B;  2VQR A;  2NQB B;  3B6G B;  3AV2 D;  1P3I A;  2G5I C;  5GT0 A;  2ARO C;  5CPK A;  5AV6 B;  2CV5 B;  5E5A B;  3REJ D;  3AL0 C;  5GT3 A;  4LD9 C;  5C3I C;  4WNN B;  5JRG C;  5B2J C;  5CP6 B;  4J8V B;  3AZF C;  1HQ3 A;  3O62 A;  5F99 A;  1ID3 B;  4H9O B;  3REL B;  4WZS B;  5B33 D;  3AFA D;  5FUG A;  1P3L C;  2F8N H;  2YFW A;  3NQJ A;  2HUE B;  3V9R B;  3MNN A;  1P3K A;  1P3B B;  2YFV B;  4H9N B;  5B0Y C;  3KWQ D;  4XZQ C;  1W2E A;  1P3G C;  4Z5T C;  1P3O C;  1WWI A;  3LJA D;  5CHL B;  3P5J B;  3C1B A;  4DRA A;  1KX3 D;  3AZJ B;  3UT9 C;  4H9R A;  3AZI A;  3EPL A;  5B2J B;  2Y2H A;  5B24 A;  5AVB C;  1S32 B;  4QLC D;  2PYO A;  4M6B A;  3WA9 A;  2CWE A;  2JE5 A;  3X1U D;  1M18 B;  3AZE B;  5CPI D;  1P3L B;  3W98 A;  2HIO C;  3MGR A;  1H3O B;  3REH C;  5AVC C;  3LZ0 A;  5E5A D;  3LZ1 A;  1BH9 A;  1KX5 B;  4R8P C;  5AY8 A;  3EPH A;  3VH6 T;  1EQZ A;  3W99 C;  3REI D;  5CPJ C;  3WKJ B;  3AZG C;  3LEL A;  3AZN D;  5JA4 B;  3REL D;  3AV2 A;  3X1S C;  3X1T B;  4KGC A;  5B1L A;  4XUJ A;  4J8W A;  4WU9 C;  3REJ A;  5AV8 D;  3AN2 C;  3NQU A;  3MGQ C;  2BYK A;  3AZK A;  3AZM B;  3AV1 B;  3AZH C;  1P3M A;  5B31 B;  1P3A A;  5B2I B;  3X1V A;  5B40 A;  3AZJ D;  4LD9 D;  3B6F A;  5JRG D;  2ZY2 A;  5B2J D;  4KUD B;  3WTP A;  4YM6 C;  4WV4 B;  3KXB A;  3UTB C;  3AZF D;  5GXQ C;  1S32 D;  4Z2M G;  1TZY B;  3AYW C;  1M18 D;  3AZE D;  1P3L D;  5KDM B;  2Y2G A;  1HQ3 B;  1F66 B;  2Y2I A;  3A6N C;  5B0Y D;  1ULY A;  5DNM B;  5B0Z B;  3C1C C;  4XZQ D;  4J8X C;  3MVD A;  4Z5T D;  1P3O D;  2UWX A;  4QLC A;  5AV5 C;  2YFW B;  3NQJ B;  1P3K B;  1KX4 C;  4AWL B;  4WU8 C;  5AVB D;  4ZBJ C;  4Z66 A;  4YS3 B;  4DRB A;  4G92 C;  3KWQ C;  1AOI C;  3A1I A;  3UTA B;  1P3P C;  3EG5 B;  4CSR A;  3REI A;  1P3F C;  3REH D;  3VH5 W;  5AVC D;  1P34 A;  4J8U A;  2PYO B;  3TU4 B;  4Z2M H;  4EO5 C;  4R8P D;  2FFF B;  5AV8 A;  3W99 D;  5AV5 B;  5AV9 A;  5CPJ D;  1M19 C;  3LZ0 B;  5DNN A;  1Q9C A;  3VH5 A;  2NQB C;  3B6G C;  4WU8 B;  3X1S D;  2ARO A;  1BH9 B;  4WU9 D;  3R45 A;  3W97 B;  5B32 G;  1BH8 A;  5AV6 C;  4G92 B;  1EQZ B;  2CV5 C;  3AN2 D;  4LD9 A;  3MGQ D;  4JJN B;  2NZD B;  3AZF A;  3LEL B;  1P3P B;  2F8N B;  5CP6 C;  3MGP B;  2ZM5 A;  4J8V C;  3AZH D;  1P3F B;  4KGC B;  1PZR A;  5B1L B;  5GSU C;  1ID3 C;  2Y2Q A;  3REL C;  4YM6 D;  1A7W A;  3UTB D;  3AZK B;  5GXQ D;  1P3M B;  4YS3 D;  5B0Y A;  2HUE C;  1ZLA B;  1P3B C;  4XZQ A;  3X1V B;  1P3G A;  4Z5T A;  1P3O A;  3UTA D;  3AYW D;  3WTP B;  3KXB B;  3UT9 A;  3W96 A;  3A6N D;  3AZJ C;  2LY8 A;  3KUY B;  3C1C D;  3TU4 D;  5BS7 C;  4J8X D;  1B6W A;  5BNX A;  2Y2M A;  1U35 B;  2ZY4 A;  5AV5 D;  1S32 C;  3WAA C;  5GSU B;  1KX4 D;  3B0D B;  2BYM A;  4H9Q A;  1M18 C;  3AZE C;  4WU8 D;  2HIO A;  3REH A;  3REK C;  5AVC A;  2RIQ A;  5BO0 B;  1AOI D;  4R8P A;  3AZL A;  1P3P D;  1KX5 C;  2DQN C;  4HGA B;  1P3F D;  1B67 A;  3AZG A;  5B1M B;  3MGS B;  3WKJ C;  4X23 A;  1JFI B;  4UPK A;  3X1S A;  2FJ7 B;  4WU9 A;  3X1T C;  4WJ3 C;  4NE6 A;  4CSR B;  3MGQ A;  3WAA B;  1M19 D;  4J8U B;  3AZM C;  3AV1 C;  2NQB D;  3B6G D;  3REK B;  5B31 C;  2JCH A;  1M1A B;  5B2I C;  5AV6 D;  2CV5 D;  5AV9 B;  1BFM A;  3UTB A;  5GXQ A;  5DNN B;  5CP6 D;  4KUD C;  4J8V D;  5B32 A;  1U35 D;  5GT0 C;  4ZUX B;  3R45 B;  5GSU D;  1ID3 D;  1BH8 B;  3AYW A;  1TZY C;  3A6N A;  1F66 C;  1HQ3 C;  2Y2P A;  1P3B D;  3C1C A;  5DNM C;  5B0Z C;  4KHA A;  5BNV A;  1N1J A;  1KX4 A;  3MNN C;  1P3K C;  4AWL C;  5B33 A;  3AFA A;  2BG1 A;  1P3I B;  2RVQ C;  4YS3 C;  3KWQ A;  5GT0 B;  1AOI A;  3WAA D;  5CPK B;  3UTA C;  5GT3 B;  3LJA A;  3REK D;  2G5H C;  1KX3 A;  1M1A D;  3O62 B;  3KFU G;  5F99 B;  2PYO C;  2Y2K A;  3TU4 C;  2BYM B;  1KX5 D;  5FUG B;  3MNN B;  3B0C W;  3WKJ D;  3X1U A;  3LZ0 C;  5CPI A;  3X1T D;  5BT1 D;  3W97 C;  5E5A A;  3C1B B;  1EQZ C;  4H9P A;  4WNN A;  4JJN C;  4E45 A;  2NZD C;  4X23 B;  4H9R B;  3LEL C;  3AZI B;  3AZM D;  3AV1 D;  1TAF A;  3MGP C;  5B31 D;  4KGC C;  5B1L C;  5B2I D;  5B24 B;  4XUJ C;  3AZN A;  4H9O A;  3H0R C;  3REL A;  1KU5 A;  4KUD D;  3WA9 B;  3AZK C;  3V9R A;  1P3B A;  1P3I D;  1P3M C;  4H9N A;  1ZLA C;  5GT0 D;  3W98 B;  3MGR B;  3X1V C;  1TZY D;  5GT3 D;  3LZ1 B;  4NFT A;  3WTP C;  3KXB C;  3AZJ A;  5AY8 B;  1HQ3 D;  2XD1 A;  5B32 B;  1F66 D;  5DNM D;  3KUY C;  5B2J A;  5JRG A;  5B0Z D;  3AV2 B;  1S32 A;  5G49 A;  1U35 C;  4XUJ B;  4J8W B;  3MNN D;  1P3K D;  3REJ B;  3B0D C;  1M18 A;  3AZE A;  3NQU B;  1P3L A;  2BYK B;  3MVD C;  1H3O A;  2XD5 A;  2RVQ D;  1P3A B;  3C1B D;  2Y2O A;  2IO5 B;  2L5A A;  5B40 B;  3B6F B;  1HTA A;  4HGA C;  5B24 D;  5B1M C;  3MGS C;  2W8S A;  5JA4 A;  3KSY A;  2PYO D;  3X1T A;  2F8N G;  3VH5 T;  3WA9 D;  5AVB A;  3LJA B;  4H9S C;  2FJ7 C;  1KX3 B;  1WWS A;  3LZ0 D;  2F2A C;  4J8U C;  3MVD B;  3FDD A;  5B2I A;  5AY8 D;  3W97 D;  1M1A C;  4QLC B;  1EQZ D;  5AV9 C;  4JJN D;  4KUD A;  2NZD D;  3H0M C;  3X1U B;  3LEL D;  5DNN C;  2F8N D;  3MGP D;  5CPI B;  3W99 A;  1R4V A;  3A1K A;  5CPJ A;  4NE3 A;  5B1L D;  4KGC D;  4ZUX C;  4XUJ D;  4Z66 B;  4J8W D;  1TZY A;  3VH6 W;  4H9P B;  3H0L C;  5KDM A;  3AZK D;  1F66 A;  5BT1 C;  1TAF B;  1P3M D;  5DNM A;  1P3A D;  3AN2 A;  1ZLA D;  3REI B;  5B0Z A;  3X1V D;  5B40 D;  3AZN B;  2JSS A;  4UUZ A;  3AZH A;  1P34 B;  3B6F D;  3WTP D;  3VH6 A;  3KXB D;  5AV8 B;  2ZY5 A;  3KUY D;  4YM6 A;  3WTP E;  4YS3 A;  2ARO B;  1P3I C;  1Z2C B;  5CPK C;  3W96 C;  3UTA A;  4LD9 B;  5C3I B;  3EPK A;  5JRG B;  5GT3 C;  3AZF B;  3MVD D;  3F6T A;  5G49 B;  3O62 C;  3TU4 A;  4J8X A;  5F99 C;  5AV5 A;  4DQY B;  5B1M D;  3MGS D;  5B0Y B;  4Z66 D;  4XZQ B;  4WU8 A;  1P3G B;  4Z5T B;  1P3O B;  3AZL C;  2FJ7 D;  3W97 A;  3UT9 B;  3C1B C;  4JJN A;  2NZD A;  3W96 B;  4CAY A;  1P3P A;  2F8N A;  1P34 D;  3MGP A;  3B0B A;  4X23 C;  4J8U D;  3AZI C;  1P3F A;  5AVB B;  4NE5 A;  5BNX B;  5B24 C;  3IP4 C;  5AV9 D;  1T3U A;  5DNN D;  4H9Q B;  3WA9 C;  1ZLA A;  5B31 G;  2ARO D;  2HIO B;  3REH B;  1M19 A;  5AVC B;  4ZUX D;  3W98 C;  3MGR C; 
#chains in the Genus database with same CATH homology
 2NQB A;  3B6G A;  3LZ1 C;  4R8P B;  3AZL B;  5AV6 A;  5AY8 C;  3W99 B;  3KUY A;  5B32 C;  2CV5 A;  5CPJ B;  4G91 C;  3AZG B;  5CP6 A;  4J8V A;  3AV2 C;  3X1S B;  2F8N K;  1U35 A;  4WU9 B;  5GSU A;  1ID3 A;  4J8W C;  3AN2 B;  3REJ C;  3MGQ B;  1P3G D;  4UUZ B;  3AZH B;  2YFV A;  5BO0 A;  1P3A C;  3UT9 D;  5CPK D;  2IO5 C;  3W96 D;  5B40 C;  4YM6 B;  5B33 C;  3AFA C;  3UTB B;  5GXQ B;  3B6F C;  5B1M A;  3MGS A;  1JFI A;  3O62 D;  4G91 B;  5BS7 A;  5F99 D;  2J8P A;  3AYW B;  2FJ7 A;  4H9S A;  3LJA C;  3WAA A;  2HIO D;  3A6N B;  1KX3 C;  3C1C B;  4J8X B;  3REK A;  3AZL D;  3B0C T;  1M1A A;  2Y2L A;  4KHA B;  5BNV B;  4QLC C;  1N1J B;  3AZG D;  1KX4 B;  4X23 D;  1KX5 A;  3X1U C;  5B33 B;  3AZI D;  3AFA B;  5CPI C;  3EPJ A;  4ZUX A;  4ZBJ B;  2DF4 C;  3WKJ A;  4Z66 C;  3KWQ B;  1AOI B;  5E5A C;  4CAY B;  2ZY3 A;  1F1E A;  2Y2J A;  3W98 D;  3REI C;  3MGR D;  4E44 A;  3AZM A;  3AZN C;  3AV1 A;  1P34 C;  4EO5 B;  3LZ1 D;  5B31 A;  2Y2N A;  5B32 D;  5AV8 C;  1M19 B;  2VQR A;  2NQB B;  3B6G B;  3AV2 D;  1P3I A;  2G5I C;  5GT0 A;  2ARO C;  5CPK A;  5AV6 B;  2CV5 B;  5E5A B;  3REJ D;  3AL0 C;  5GT3 A;  4LD9 C;  5C3I C;  4WNN B;  5JRG C;  5B2J C;  5CP6 B;  4J8V B;  3AZF C;  1HQ3 A;  3O62 A;  5F99 A;  1ID3 B;  4H9O B;  3REL B;  4WZS B;  5B33 D;  3AFA D;  5FUG A;  1P3L C;  2F8N H;  2YFW A;  3NQJ A;  2HUE B;  3V9R B;  3MNN A;  1P3K A;  1P3B B;  2YFV B;  4H9N B;  5B0Y C;  3KWQ D;  4XZQ C;  1W2E A;  1P3G C;  4Z5T C;  1P3O C;  1WWI A;  3LJA D;  5CHL B;  3P5J B;  3C1B A;  4DRA A;  1KX3 D;  3AZJ B;  3UT9 C;  4H9R A;  3AZI A;  3EPL A;  5B2J B;  2Y2H A;  5B24 A;  5AVB C;  1S32 B;  4QLC D;  2PYO A;  4M6B A;  3WA9 A;  2CWE A;  2JE5 A;  3X1U D;  1M18 B;  3AZE B;  5CPI D;  1P3L B;  3W98 A;  2HIO C;  3MGR A;  1H3O B;  3REH C;  5AVC C;  3LZ0 A;  5E5A D;  3LZ1 A;  1BH9 A;  1KX5 B;  4R8P C;  5AY8 A;  3EPH A;  3VH6 T;  1EQZ A;  3W99 C;  3REI D;  5CPJ C;  3WKJ B;  3AZG C;  3LEL A;  3AZN D;  5JA4 B;  3REL D;  3AV2 A;  3X1S C;  3X1T B;  4KGC A;  5B1L A;  4XUJ A;  4J8W A;  4WU9 C;  3REJ A;  5AV8 D;  3AN2 C;  3NQU A;  3MGQ C;  2BYK A;  3AZK A;  3AZM B;  3AV1 B;  3AZH C;  1P3M A;  5B31 B;  1P3A A;  5B2I B;  3X1V A;  5B40 A;  3AZJ D;  4LD9 D;  3B6F A;  5JRG D;  2ZY2 A;  5B2J D;  4KUD B;  3WTP A;  4YM6 C;  4WV4 B;  3KXB A;  3UTB C;  3AZF D;  5GXQ C;  1S32 D;  4Z2M G;  1TZY B;  3AYW C;  1M18 D;  3AZE D;  1P3L D;  5KDM B;  2Y2G A;  1HQ3 B;  1F66 B;  2Y2I A;  3A6N C;  5B0Y D;  1ULY A;  5DNM B;  5B0Z B;  3C1C C;  4XZQ D;  4J8X C;  3MVD A;  4Z5T D;  1P3O D;  2UWX A;  4QLC A;  5AV5 C;  2YFW B;  3NQJ B;  1P3K B;  1KX4 C;  4AWL B;  4WU8 C;  5AVB D;  4ZBJ C;  4Z66 A;  4YS3 B;  4DRB A;  4G92 C;  3KWQ C;  1AOI C;  3A1I A;  3UTA B;  1P3P C;  3EG5 B;  4CSR A;  3REI A;  1P3F C;  3REH D;  3VH5 W;  5AVC D;  1P34 A;  4J8U A;  2PYO B;  3TU4 B;  4Z2M H;  4EO5 C;  4R8P D;  2FFF B;  5AV8 A;  3W99 D;  5AV5 B;  5AV9 A;  5CPJ D;  1M19 C;  3LZ0 B;  5DNN A;  1Q9C A;  3VH5 A;  2NQB C;  3B6G C;  4WU8 B;  3X1S D;  2ARO A;  1BH9 B;  4WU9 D;  3R45 A;  3W97 B;  5B32 G;  1BH8 A;  5AV6 C;  4G92 B;  1EQZ B;  2CV5 C;  3AN2 D;  4LD9 A;  3MGQ D;  4JJN B;  2NZD B;  3AZF A;  3LEL B;  1P3P B;  2F8N B;  5CP6 C;  3MGP B;  2ZM5 A;  4J8V C;  3AZH D;  1P3F B;  4KGC B;  1PZR A;  5B1L B;  5GSU C;  1ID3 C;  2Y2Q A;  3REL C;  4YM6 D;  1A7W A;  3UTB D;  3AZK B;  5GXQ D;  1P3M B;  4YS3 D;  5B0Y A;  2HUE C;  1ZLA B;  1P3B C;  4XZQ A;  3X1V B;  1P3G A;  4Z5T A;  1P3O A;  3UTA D;  3AYW D;  3WTP B;  3KXB B;  3UT9 A;  3W96 A;  3A6N D;  3AZJ C;  2LY8 A;  3KUY B;  3C1C D;  3TU4 D;  5BS7 C;  4J8X D;  1B6W A;  5BNX A;  2Y2M A;  1U35 B;  2ZY4 A;  5AV5 D;  1S32 C;  3WAA C;  5GSU B;  1KX4 D;  3B0D B;  2BYM A;  4H9Q A;  1M18 C;  3AZE C;  4WU8 D;  2HIO A;  3REH A;  3REK C;  5AVC A;  2RIQ A;  5BO0 B;  1AOI D;  4R8P A;  3AZL A;  1P3P D;  1KX5 C;  2DQN C;  4HGA B;  1P3F D;  1B67 A;  3AZG A;  5B1M B;  3MGS B;  3WKJ C;  4X23 A;  1JFI B;  4UPK A;  3X1S A;  2FJ7 B;  4WU9 A;  3X1T C;  4WJ3 C;  4NE6 A;  4CSR B;  3MGQ A;  3WAA B;  1M19 D;  4J8U B;  3AZM C;  3AV1 C;  2NQB D;  3B6G D;  3REK B;  5B31 C;  2JCH A;  1M1A B;  5B2I C;  5AV6 D;  2CV5 D;  5AV9 B;  1BFM A;  3UTB A;  5GXQ A;  5DNN B;  5CP6 D;  4KUD C;  4J8V D;  5B32 A;  1U35 D;  5GT0 C;  4ZUX B;  3R45 B;  5GSU D;  1ID3 D;  1BH8 B;  3AYW A;  1TZY C;  3A6N A;  1F66 C;  1HQ3 C;  2Y2P A;  1P3B D;  3C1C A;  5DNM C;  5B0Z C;  4KHA A;  5BNV A;  1N1J A;  1KX4 A;  3MNN C;  1P3K C;  4AWL C;  5B33 A;  3AFA A;  2BG1 A;  1P3I B;  2RVQ C;  4YS3 C;  3KWQ A;  5GT0 B;  1AOI A;  3WAA D;  5CPK B;  3UTA C;  5GT3 B;  3LJA A;  3REK D;  2G5H C;  1KX3 A;  1M1A D;  3O62 B;  3KFU G;  5F99 B;  2PYO C;  2Y2K A;  3TU4 C;  2BYM B;  1KX5 D;  5FUG B;  3MNN B;  3B0C W;  3WKJ D;  3X1U A;  3LZ0 C;  5CPI A;  3X1T D;  5BT1 D;  3W97 C;  5E5A A;  3C1B B;  1EQZ C;  4H9P A;  4WNN A;  4JJN C;  4E45 A;  2NZD C;  4X23 B;  4H9R B;  3LEL C;  3AZI B;  3AZM D;  3AV1 D;  1TAF A;  3MGP C;  5B31 D;  4KGC C;  5B1L C;  5B2I D;  5B24 B;  4XUJ C;  3AZN A;  4H9O A;  3H0R C;  3REL A;  1KU5 A;  4KUD D;  3WA9 B;  3AZK C;  3V9R A;  1P3B A;  1P3I D;  1P3M C;  4H9N A;  1ZLA C;  5GT0 D;  3W98 B;  3MGR B;  3X1V C;  1TZY D;  5GT3 D;  3LZ1 B;  4NFT A;  3WTP C;  3KXB C;  3AZJ A;  5AY8 B;  1HQ3 D;  2XD1 A;  5B32 B;  1F66 D;  5DNM D;  3KUY C;  5B2J A;  5JRG A;  5B0Z D;  3AV2 B;  1S32 A;  5G49 A;  1U35 C;  4XUJ B;  4J8W B;  3MNN D;  1P3K D;  3REJ B;  3B0D C;  1M18 A;  3AZE A;  3NQU B;  1P3L A;  2BYK B;  3MVD C;  1H3O A;  2XD5 A;  2RVQ D;  1P3A B;  3C1B D;  2Y2O A;  2IO5 B;  2L5A A;  5B40 B;  3B6F B;  1HTA A;  4HGA C;  5B24 D;  5B1M C;  3MGS C;  2W8S A;  5JA4 A;  3KSY A;  2PYO D;  3X1T A;  2F8N G;  3VH5 T;  3WA9 D;  5AVB A;  3LJA B;  4H9S C;  2FJ7 C;  1KX3 B;  1WWS A;  3LZ0 D;  2F2A C;  4J8U C;  3MVD B;  3FDD A;  5B2I A;  5AY8 D;  3W97 D;  1M1A C;  4QLC B;  1EQZ D;  5AV9 C;  4JJN D;  4KUD A;  2NZD D;  3H0M C;  3X1U B;  3LEL D;  5DNN C;  2F8N D;  3MGP D;  5CPI B;  3W99 A;  1R4V A;  3A1K A;  5CPJ A;  4NE3 A;  5B1L D;  4KGC D;  4ZUX C;  4XUJ D;  4Z66 B;  4J8W D;  1TZY A;  3VH6 W;  4H9P B;  3H0L C;  5KDM A;  3AZK D;  1F66 A;  5BT1 C;  1TAF B;  1P3M D;  5DNM A;  1P3A D;  3AN2 A;  1ZLA D;  3REI B;  5B0Z A;  3X1V D;  5B40 D;  3AZN B;  2JSS A;  4UUZ A;  3AZH A;  1P34 B;  3B6F D;  3WTP D;  3VH6 A;  3KXB D;  5AV8 B;  2ZY5 A;  3KUY D;  4YM6 A;  3WTP E;  4YS3 A;  2ARO B;  1P3I C;  1Z2C B;  5CPK C;  3W96 C;  3UTA A;  4LD9 B;  5C3I B;  3EPK A;  5JRG B;  5GT3 C;  3AZF B;  3MVD D;  3F6T A;  5G49 B;  3O62 C;  3TU4 A;  4J8X A;  5F99 C;  5AV5 A;  4DQY B;  5B1M D;  3MGS D;  5B0Y B;  4Z66 D;  4XZQ B;  4WU8 A;  1P3G B;  4Z5T B;  1P3O B;  3AZL C;  2FJ7 D;  3W97 A;  3UT9 B;  3C1B C;  4JJN A;  2NZD A;  3W96 B;  4CAY A;  1P3P A;  2F8N A;  1P34 D;  3MGP A;  3B0B A;  4X23 C;  4J8U D;  3AZI C;  1P3F A;  5AVB B;  4NE5 A;  5BNX B;  5B24 C;  3IP4 C;  5AV9 D;  1T3U A;  5DNN D;  4H9Q B;  3WA9 C;  1ZLA A;  5B31 G;  2ARO D;  2HIO B;  3REH B;  1M19 A;  5AVC B;  4ZUX D;  3W98 C;  3MGR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...