5AVCA

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcA00
3MVDA 1TAFA 1P3FD 3KWQC 3X1TD 4KGCA 4J8UD 3B0BA 4ZBJB 5B24B 5B2IB 4J8WA 3REKA 4QLCD 3REJB 1KX3C 1ULYA 1P34A 3B6FA 3W98A 5GT0D 5BS7A 1AOIB 4KHAB 3WKJC 4XZQC 3TU4C 4WV4B 1M1AC 3AZJC 1M19A 5GSUC 4WU9D 3X1UB 3RELD 1TZYA 1P3MC 3LZ1D 5CPKB 3AZIA 5AV9B 4R8PA 3WA9B 5AV5B 3AYWA 4HGAC 5GXQB 5B2JB 5GT3B 1F66C 4H9QA 3B6GC 2CV5D 3AZFC 5B31B 3MGRB 3C1CD 4NE6A 3VH5A 4EO5C 3AZNC 5AVBC 2FJ7A 5B32B 3W99A 1P3IB 1KX5D 2AROA 3AV2D 5JA4B 5CPIC 4XUJB 5CPJB 5CP6C 3LZ0D 5B1MB 3VH5T 4WNNB 3X1SA 4YM6C 4NE3A 1M18D 2F8NH 2NZDB 3W97C 4H9RB 3KWQA 3REIC 2F8NB 3AZGC 3UTAB 1ZLAC 4H9PA 4H9OB 1BH9A 1S32D 1P3GB 3LELB 5G49B 3WTPC 3LJAA 1P3LD 5FUGB 5DNMB 1HQ3B 5DNNC 1U35A 1P3BD 2YFWB 3AV1B 5E5AA 4CAYA 5B1LD 4J8XC 4YS3B 3UTBC 3TU4A 3W96C 5B0ZA 3KXBC 3MGSB 3AZJA 1P3PB 1M1AA 5B33C 5GSUA 4ZUXB 5AV8A 1P3OB 1TAFB 3O62D 4KGCB 1P3FC 3MGQB 5B40D 4J8UC 1H3OA 4Z2MH 2BYMA 3REKB 1F66A 2BYKB 5B0YB 4QLCC 3A6NB 4LD9D 3MVDC 3W98B 3VH6A 4WU8A 4G91B 4JJNA 3WAAB 5AVCD 3AN2B 4J8WC 1P3OA 2HUEC 1BFMA 3MNND 1KX4D 3AZHA 3AZED 3AZMD 1A7WA 1B6WA 4R8PB 5CP6A 1P34C 3B6FC 3VH6T 4J8VA 5B24D 5BS7C 5B2ID 5AV6B 3W97A 3REJD 1M19C 3REIA 3AZGA 1ZLAA 4H9SA 4H9QB 4X23B 1TZYC 5JRGA 3AZIC 4E44A 1AOID 5DNNA 5CHLB 3C1CC 4Z66B 3X1VA 1N1JB 4J8XA 3X1UD 3NQJB 3W96A 3WA9D 2YFVA 4Z5TB 1ID3A 2FJ7C 3V9RA 3X1SB 5GXQD 1P3KB 3KUYA 4H9NB 5B2JD 3KWQB 1P3FA 1EQZD 3W99C 3X1TA 5KDMB 4J8UA 2AROC 5B31D 3MGRD 5B32D 1KX3B 4QLCA 3B0DC 3R45B 4CSRB 3C1BD 5GT0A 3WKJB 4XUJD 4XZQB 3TU4B 3LJAC 5B1MD 3AZJB 1M1AB 3AZLD 5GSUB 4WU9A 2NZDD 1U35C 1P3MB 3MGPD 3RELA 2L5AA 3KSYA 5E5AC 3AZKD 3NQUA 3LZ1A 2F8NK 1P3GD 5B40C 4HGAB 5DNMD 4AWLC 5B0ZC 1F66B 3AV1D 3B6GB 5AV8C 5F99D 3AZFB 2CV5A 2PYOB 4LD9C 4YS3D 3C1CA 2HIOD 4EO5B 5AVBB 3AZNB 3AFAD 4DRBA 3MGSD 1P3PD 5AVCC 4WZSB 4ZUXD 1P3OD 1KX5A 5CPIB 3AV2A 3AZEC 3MGQD 3AZMC 5CP6B 3LZ0A 4JJNC 3UT9B 4WU8C 4YM6B 5B24C 3WTPE 1M18A 3W97B 1P3AD 5B0YD 3REIB 3AZGB 1ZLAB 3AZHC 3A6ND 5BT1D 1S32A 3WTPB 1WWIA 1P3LA 3WAAD 5DNNB 4J8VC 1AOIC 3AN2D 1P3BA 5AY8D 3VH5W 4J8XB 5B1LA 5BNVA 3REHB 4H9SC 3UTBB 5JRGC 3KXBB 4UUZB 2RVQD 2YFVB 5B33B 1KU5A 2NQBB 5AV6D 3X1VC 1R4VA 1P3FB 4X23D 3O62A 1EQZC 1F1EA 5BO0A 4J8UB 5B40A 5B31C 4Z66D 1ID3C 4KUDC 4QLCB 3KUYC 3MVDB 4LD9A 3X1TC 3C1BC 5B31G 4Z5TD 4J8WB 5AVCA 5C3IC 3AZLC 3MNNA 1P3KD 1KX4A 2CWEA 2NZDC 1HTAA 3MGPC 3AZEA 3AZMA 1P34B 3AZKC 3B6FB 1JFIA 5GT0C 5B24A 5B2IA 1M19B 1KX3D 3REJA 4WU9C 1TZYB 3RELC 3AZIB 3LZ1C 5F99C 3C1CB 3WKJD 3AYWB 4XZQD 4KHAA 1AOIA 2HIOC 3AFAC 3VH6W 3X1UA 1P3MD 2CV5C 3WA9A 2FJ7B 4M6BA 5GXQA 1P3AC 3W99B 1EQZA 3B6GD 3AZFD 2AROB 5CPKD 1KX5C 5AV9D 2PYOD 5BT1C 3AV2C 5B31A 4NE5A 5AV5D 3MGRA 3AZND 5AVBD 4G91C 4KUDA 3LZ0C 3B0DB 5B32A 3AN2C 1M18C 5AY8C 5GT3D 4H9PB 3C1BA 5CPID 5JA4A 1BH9B 4XUJA 1S32C 3LJAB 5B1MA 3UT9D 1P3LC 3AZLA 4YM6D 3B0CT 1U35B 3W97D 2NZDA 3MGPA 5E5AB 1P3BC 4H9RA 4CAYB 3AZKA 5B1LC 1P3ID 4H9OA 5B40B 3WTPD 1P3GA 5CPJD 4AWLB 5B0ZB 5FUGA 5DNMA 2IO5C 2YFWA 3AV1A 2LY8A 5AV8B 4G92C 5F99A 2F8ND 3UTAD 3REHD 4LD9B 3O62C 3UTBD 2HIOA 1H3OB 3LELD 3KXBD 3AFAA 3MGSA 2BYMB 5B33D 5AVCB 1P3PA 1HQ3D 2NQBD 4ZUXA 3AZEB 3AZMB 3MGQA 4WU8B 4JJNB 1JFIB 1P3AA 2BYKA 5B0YA 5BNXA 3AZHB 3MNNC 1BH8A 1KX4C 3A6NA 3MVDD 4KGCD 3WAAA 4J8VB 4ZBJC 4J8WD 3AN2A 5B2IC 3REKD 5AY8A 3REJC 1Q9CA 1B67A 5JRGB 1P34D 3B6FD 3W98D 5AV6A 3X1VB 1M19D 1EQZB 1TZYD 3X1UC 4X23A 3AZID 4R8PD 5CPKC 3W96B 5AV9C 2PYOC 3WA9C 3AYWD 5AV5C 1ID3B 4Z66A 4KUDB 3V9RB 1N1JA 5GXQC 3KUYB 5B2JC 5GT3C 3NQJA 3X1TB 3C1BB 4Z5TA 3MGRC 2FJ7D 5C3IB 3UT9C 3AZLB 5B32C 1P3KA 4H9NA 3MGPB 3W99D 3AZKB 5KDMA 2AROD 1P3IC 5GT0B 4DRAA 4XUJC 5CPJC 5B32G 2HUEB 5B1MC 1KX3A 3X1SD 4WU9B 3R45A 3RELB 3KWQD 3NQUB 5F99B 3LZ1B 4CSRA 3UTAC 3REHC 3WKJA 2HIOB 4XZQA 3LJAD 1P3GC 3AFAB 3LELC 5DNMC 1HQ3C 1U35D 2NQBC 4E45A 1P3MA 5E5AD 3AV1C 2F8NG 2CV5B 1WWSA 4YS3C 3TU4D 5B0ZD 1M1AD 3AZJD 3MGSC 1P3PC 5GSUD 1P3AB 4ZUXC 5BNXB 3B6GA 5AV8D 1BH8B 1KX5B 3AZFA 5CPKA 1P3OC 5AV9A 3AV2B 2PYOA 4KGCC 5AV5A 3MGQC 3AZNA 5AVBA 3LZ0B 1M18B 5AY8B 3REKC 1F66D 5B2JA 5GT3A 5B0YC 5CPIA 3A6NC 1S32B 3W98C 4JJND 4WU8D 1P3LB 3WAAC 3UT9A 4YM6A 1P3BB 2JSSA 4Z2MG 3AZHD 5B1LB 5BNVB 1P3IA 3WTPA 5CP6D 5CPJA 4R8PC 2RVQC 4J8VD 2IO5B 4WNNA 3AYWC 5AV6C 4G92B 3REID 3AZGD 3B0CW 1ZLAD 2F8NA 3UTAA 3REHA 3O62B 4X23C 5BO0B 5JRGD 3UTBA 3LELA 5G49A 4UUZA 3KXBA 5B33A 1HQ3A 4NFTA 5DNND 2NQBA 4Z66C 3X1VD 4J8XD 4YS3A 3W96D 4Z5TC 1ID3D 4KUDD 3MNNB 1KX4B 3X1SC 1P3KC 3KUYD
chains in the Genus database with same CATH superfamily
3MVDA 1TAFA 1P3FD 3KWQC 3X1TD 4KGCA 4J8UD 3B0BA 4ZBJB 5B24B 5B2IB 4J8WA 3REKA 4QLCD 3REJB 2JE5A 1KX3C 1ULYA 1P34A 3B6FA 3W98A 5GT0D 5BS7A 1AOIB 4KHAB 3WKJC 4XZQC 3TU4C 4WV4B 1M1AC 3AZJC 1M19A 5GSUC 4WU9D 3KFUG 3X1UB 3RELD 1TZYA 1P3MC 3LZ1D 5CPKB 2Y2JA 2Y2KA 3AZIA 5AV9B 4R8PA 3WA9B 5AV5B 3AYWA 4HGAC 5GXQB 5B2JB 5GT3B 1F66C 4H9QA 3B6GC 2CV5D 3AZFC 3H0RC 5B31B 3MGRB 3C1CD 4NE6A 3VH5A 4EO5C 3AZNC 5AVBC 2FJ7A 5B32B 2DF4C 3W99A 2UWXA 1P3IB 1KX5D 2AROA 3AV2D 5JA4B 5CPIC 4XUJB 5CPJB 5CP6C 3LZ0D 5B1MB 3VH5T 4WNNB 3X1SA 4YM6C 4NE3A 1M18D 2F8NH 2NZDB 3W97C 4H9RB 3KWQA 3REIC 2F8NB 3AZGC 2G5IC 3UTAB 4H9PA 1ZLAC 4H9OB 1BH9A 1S32D 3F6TA 1P3GB 3LELB 5G49B 3WTPC 3LJAA 1P3LD 5FUGB 5DNMB 1HQ3B 5DNNC 1U35A 1P3BD 2Y2LA 2YFWB 3AV1B 5E5AA 4CAYA 5B1LD 4J8XC 4YS3B 3UTBC 3TU4A 3W96C 5B0ZA 3KXBC 3MGSB 3AZJA 1P3PB 1M1AA 5B33C 5GSUA 4ZUXB 5AV8A 1P3OB 1TAFB 3O62D 4KGCB 1P3FC 3MGQB 5B40D 4J8UC 1H3OA 4Z2MH 2BYMA 2DQNC 3REKB 1F66A 2BYKB 5B0YB 4QLCC 3A6NB 4LD9D 3MVDC 3W98B 3VH6A 4WU8A 4G91B 4JJNA 3WAAB 5AVCD 3AN2B 4J8WC 1P3OA 2HUEC 1BFMA 3MNND 1KX4D 3AZHA 3AZED 3AZMD 1A7WA 1B6WA 4R8PB 5CP6A 2Y2GA 1P34C 3B6FC 3VH6T 4J8VA 5B24D 5BS7C 5B2ID 5AV6B 3W97A 3REJD 1M19C 3REIA 3AZGA 1ZLAA 4H9SA 4H9QB 4X23B 1TZYC 5JRGA 3AZIC 4E44A 1AOID 5DNNA 5CHLB 3C1CC 4Z66B 3X1VA 1N1JB 4J8XA 3X1UD 3NQJB 3W96A 3WA9D 2YFVA 4Z5TB 1ID3A 2FJ7C 3V9RA 3X1SB 5GXQD 1P3KB 3KUYA 4H9NB 5B2JD 3KWQB 3P5JB 1P3FA 3W99C 1EQZD 3X1TA 5KDMB 4J8UA 2AROC 5B31D 3MGRD 5B32D 1KX3B 4QLCA 3B0DC 3R45B 3EPKA 4CSRB 1PZRA 3C1BD 2Y2IA 5GT0A 3WKJB 4XUJD 4XZQB 3TU4B 3LJAC 5B1MD 3AZJB 1M1AB 3AZLD 5GSUB 4WU9A 2NZDD 1U35C 1P3MB 3MGPD 3RELA 2L5AA 3KSYA 5E5AC 3AZKD 3NQUA 3LZ1A 2F8NK 1P3GD 5B40C 4HGAB 5DNMD 4AWLC 5B0ZC 1F66B 3EG5B 3AV1D 3B6GB 5AV8C 5F99D 3AZFB 2CV5A 2PYOB 4LD9C 4YS3D 3C1CA 2HIOD 4EO5B 5AVBB 3AZNB 3AFAD 4DRBA 3MGSD 1P3PD 5AVCC 4WZSB 4ZUXD 1P3OD 1KX5A 2Y2OA 5CPIB 3AV2A 3AZEC 3MGQD 3AZMC 5CP6B 3LZ0A 4JJNC 3UT9B 4WU8C 4YM6B 5B24C 3WTPE 1M18A 3W97B 2XD1A 1P3AD 5B0YD 2VQRA 3REIB 3AZGB 1ZLAB 3AZHC 3A6ND 5BT1D 2FFFB 1S32A 3WTPB 1WWIA 1P3LA 3WAAD 1T3UA 5DNNB 4J8VC 1AOIC 3AN2D 1P3BA 5AY8D 3VH5W 2ZM5A 2RIQA 4J8XB 5B1LA 5BNVA 3REHB 4H9SC 3UTBB 5JRGC 3KXBB 4UUZB 2RVQD 1Z2CB 2YFVB 5B33B 1KU5A 4WJ3C 2NQBB 5AV6D 3X1VC 1R4VA 1P3FB 4X23D 3O62A 1EQZC 1F1EA 5BO0A 4J8UB 5B40A 5B31C 4Z66D 1ID3C 4KUDC 4QLCB 3KUYC 3MVDB 4LD9A 3X1TC 3C1BC 5B31G 4Z5TD 4J8WB 5AVCA 5C3IC 3AZLC 3MNNA 1P3KD 1KX4A 2CWEA 2NZDC 1HTAA 3MGPC 3AZEA 3AZMA 3H0MC 3AZKC 1P34B 3B6FB 1JFIA 5GT0C 5B24A 5B2IA 1M19B 1KX3D 2Y2NA 3REJA 4WU9C 1W2EA 1TZYB 3H0LC 3RELC 3AZIB 3LZ1C 5F99C 3C1CB 3WKJD 3AYWB 4XZQD 4KHAA 1AOIA 2HIOC 3AFAC 3VH6W 2Y2QA 3X1UA 1P3MD 2CV5C 3WA9A 2Y2MA 2FJ7B 4M6BA 5GXQA 1P3AC 3W99B 1EQZA 3B6GD 3AZFD 2AROB 5CPKD 1KX5C 5AV9D 2PYOD 5BT1C 3AV2C 2BG1A 4NE5A 5B31A 5AV5D 3MGRA 3AZND 5AVBD 4G91C 4KUDA 3LZ0C 3B0DB 5B32A 3AN2C 1M18C 5AY8C 5GT3D 4H9PB 3C1BA 5CPID 5JA4A 1BH9B 4XUJA 1S32C 3LJAB 5B1MA 3UT9D 1P3LC 3AZLA 4YM6D 3B0CT 1U35B 3W97D 2NZDA 3MGPA 5E5AB 1P3BC 4H9RA 4CAYB 3AZKA 5B1LC 1P3ID 4H9OA 5B40B 3WTPD 1P3GA 5CPJD 4AWLB 5B0ZB 3AL0C 5FUGA 5DNMA 2IO5C 2YFWA 3AV1A 2LY8A 5AV8B 4G92C 5F99A 2F8ND 3UTAD 3REHD 4LD9B 3O62C 3UTBD 2HIOA 1H3OB 3LELD 3KXBD 3AFAA 3MGSA 2BYMB 5B33D 5AVCB 1P3PA 1HQ3D 2NQBD 4ZUXA 3AZEB 3AZMB 3MGQA 4WU8B 4JJNB 1JFIB 1P3AA 2BYKA 5B0YA 5BNXA 3AZHB 3MNNC 1BH8A 1KX4C 3A6NA 3MVDD 4KGCD 3WAAA 4J8VB 4ZBJC 4J8WD 3AN2A 5B2IC 3REKD 5AY8A 3REJC 1Q9CA 1B67A 5JRGB 1P34D 3B6FD 2Y2PA 3W98D 5AV6A 3X1VB 1M19D 1EQZB 1TZYD 2ZY2A 3X1UC 4X23A 3AZID 4R8PD 5CPKC 3W96B 5AV9C 2PYOC 3WA9C 3AYWD 5AV5C 1ID3B 4Z66A 4KUDB 3V9RB 1N1JA 2W8SA 3A1KA 5GXQC 3KUYB 5B2JC 5GT3C 3NQJA 3X1TB 3EPLA 3C1BB 4Z5TA 3MGRC 2FJ7D 5C3IB 3UT9C 3AZLB 5B32C 1P3KA 4H9NA 3MGPB 3W99D 3AZKB 5KDMA 2AROD 2Y2HA 1P3IC 5GT0B 4DRAA 4XUJC 5CPJC 5B32G 2HUEB 5B1MC 1KX3A 3X1SD 4WU9B 3R45A 3RELB 3KWQD 3NQUB 5F99B 3LZ1B 4CSRA 3IP4C 3REHC 3UTAC 3WKJA 2HIOB 4XZQA 3LJAD 1P3GC 3AFAB 3LELC 5DNMC 1HQ3C 1U35D 2NQBC 2F2AC 4E45A 5E5AD 1P3MA 3FDDA 3AV1C 2F8NG 2CV5B 1WWSA 4YS3C 3TU4D 5B0ZD 1M1AD 3AZJD 3MGSC 1P3PC 5GSUD 1P3AB 2JCHA 2G5HC 4ZUXC 5BNXB 3B6GA 5AV8D 1BH8B 1KX5B 3AZFA 5CPKA 1P3OC 5AV9A 3AV2B 2PYOA 4KGCC 5AV5A 3MGQC 3EPHA 3AZNA 5AVBA 3LZ0B 1M18B 5AY8B 3REKC 1F66D 5B2JA 5GT3A 5B0YC 5CPIA 3A6NC 1S32B 3W98C 4JJND 4WU8D 1P3LB 2ZY4A 2J8PA 3WAAC 3UT9A 4YM6A 1P3BB 2JSSA 4Z2MG 3AZHD 5B1LB 5BNVB 1P3IA 3WTPA 5CP6D 5CPJA 4R8PC 2RVQC 4J8VD 2IO5B 4WNNA 3AYWC 2ZY5A 5AV6C 4G92B 3REID 3AZGD 3B0CW 1ZLAD 2F8NA 2XD5A 3REHA 3O62B 3UTAA 3A1IA 4X23C 5BO0B 5JRGD 3UTBA 3LELA 5G49A 4UUZA 3KXBA 5B33A 1HQ3A 4NFTA 5DNND 2ZY3A 2NQBA 3EPJA 4Z66C 3X1VD 4DQYB 4J8XD 4YS3A 3W96D 4Z5TC 1ID3D 4KUDD 4UPKA 3MNNB 1KX4B 3X1SC 1P3KC 3KUYD
chains in the Genus database with same CATH topology
3MVDA 1TAFA 1P3FD 3KWQC 3X1TD 4KGCA 4J8UD 3B0BA 4ZBJB 5B24B 5B2IB 4J8WA 3REKA 4QLCD 3REJB 2JE5A 1KX3C 1ULYA 1P34A 3B6FA 3W98A 5GT0D 5BS7A 1AOIB 4KHAB 3WKJC 4XZQC 3TU4C 4WV4B 1M1AC 3AZJC 1M19A 5GSUC 4WU9D 3KFUG 3X1UB 3RELD 1TZYA 1P3MC 3LZ1D 5CPKB 2Y2JA 2Y2KA 3AZIA 5AV9B 4R8PA 3WA9B 5AV5B 3AYWA 4HGAC 5GXQB 5B2JB 5GT3B 1F66C 4H9QA 3B6GC 2CV5D 3AZFC 3H0RC 5B31B 3MGRB 3C1CD 4NE6A 3VH5A 4EO5C 3AZNC 5AVBC 2FJ7A 5B32B 2DF4C 3W99A 2UWXA 1P3IB 1KX5D 2AROA 3AV2D 5JA4B 5CPIC 4XUJB 5CPJB 5CP6C 3LZ0D 5B1MB 3VH5T 4WNNB 3X1SA 4YM6C 4NE3A 1M18D 2F8NH 2NZDB 3W97C 4H9RB 3KWQA 3REIC 2F8NB 3AZGC 2G5IC 3UTAB 4H9PA 1ZLAC 4H9OB 1BH9A 1S32D 3F6TA 1P3GB 3LELB 5G49B 3WTPC 3LJAA 1P3LD 5FUGB 5DNMB 1HQ3B 5DNNC 1U35A 1P3BD 2Y2LA 2YFWB 3AV1B 5E5AA 4CAYA 5B1LD 4J8XC 4YS3B 3UTBC 3TU4A 3W96C 5B0ZA 3KXBC 3MGSB 3AZJA 1P3PB 1M1AA 5B33C 5GSUA 4ZUXB 5AV8A 1P3OB 1TAFB 3O62D 4KGCB 1P3FC 3MGQB 5B40D 4J8UC 1H3OA 4Z2MH 2BYMA 2DQNC 3REKB 1F66A 2BYKB 5B0YB 4QLCC 3A6NB 4LD9D 3MVDC 3W98B 3VH6A 4WU8A 4G91B 4JJNA 3WAAB 5AVCD 3AN2B 4J8WC 1P3OA 2HUEC 1BFMA 3MNND 1KX4D 3AZHA 3AZED 3AZMD 1A7WA 1B6WA 4R8PB 5CP6A 2Y2GA 1P34C 3B6FC 3VH6T 4J8VA 5B24D 5BS7C 5B2ID 5AV6B 3W97A 3REJD 1M19C 3REIA 3AZGA 1ZLAA 4H9SA 4H9QB 4X23B 1TZYC 5JRGA 3AZIC 4E44A 1AOID 5DNNA 5CHLB 3C1CC 4Z66B 3X1VA 1N1JB 4J8XA 3X1UD 3NQJB 3W96A 3WA9D 2YFVA 4Z5TB 1ID3A 2FJ7C 3V9RA 3X1SB 5GXQD 1P3KB 3KUYA 4H9NB 5B2JD 3KWQB 3P5JB 1P3FA 3W99C 1EQZD 3X1TA 5KDMB 4J8UA 2AROC 5B31D 3MGRD 5B32D 1KX3B 4QLCA 3B0DC 3R45B 3EPKA 4CSRB 1PZRA 3C1BD 2Y2IA 5GT0A 3WKJB 4XUJD 4XZQB 3TU4B 3LJAC 5B1MD 3AZJB 1M1AB 3AZLD 5GSUB 4WU9A 2NZDD 1U35C 1P3MB 3MGPD 3RELA 2L5AA 3KSYA 5E5AC 3AZKD 3NQUA 3LZ1A 2F8NK 1P3GD 5B40C 4HGAB 5DNMD 4AWLC 5B0ZC 1F66B 3EG5B 3AV1D 3B6GB 5AV8C 5F99D 3AZFB 2CV5A 2PYOB 4LD9C 4YS3D 3C1CA 2HIOD 4EO5B 5AVBB 3AZNB 3AFAD 4DRBA 3MGSD 1P3PD 5AVCC 4WZSB 4ZUXD 1P3OD 1KX5A 2Y2OA 5CPIB 3AV2A 3AZEC 3MGQD 3AZMC 5CP6B 3LZ0A 4JJNC 3UT9B 4WU8C 4YM6B 5B24C 3WTPE 1M18A 3W97B 2XD1A 1P3AD 5B0YD 2VQRA 3REIB 3AZGB 1ZLAB 3AZHC 3A6ND 5BT1D 2FFFB 1S32A 3WTPB 1WWIA 1P3LA 3WAAD 1T3UA 5DNNB 4J8VC 1AOIC 3AN2D 1P3BA 5AY8D 3VH5W 2ZM5A 2RIQA 4J8XB 5B1LA 5BNVA 3REHB 4H9SC 3UTBB 5JRGC 3KXBB 4UUZB 2RVQD 1Z2CB 2YFVB 5B33B 1KU5A 4WJ3C 2NQBB 5AV6D 3X1VC 1R4VA 1P3FB 4X23D 3O62A 1EQZC 1F1EA 5BO0A 4J8UB 5B40A 5B31C 4Z66D 1ID3C 4KUDC 4QLCB 3KUYC 3MVDB 4LD9A 3X1TC 3C1BC 5B31G 4Z5TD 4J8WB 5AVCA 5C3IC 3AZLC 3MNNA 1P3KD 1KX4A 2CWEA 2NZDC 1HTAA 3MGPC 3AZEA 3AZMA 3H0MC 3AZKC 1P34B 3B6FB 1JFIA 5GT0C 5B24A 5B2IA 1M19B 1KX3D 2Y2NA 3REJA 4WU9C 1W2EA 1TZYB 3H0LC 3RELC 3AZIB 3LZ1C 5F99C 3C1CB 3WKJD 3AYWB 4XZQD 4KHAA 1AOIA 2HIOC 3AFAC 3VH6W 2Y2QA 3X1UA 1P3MD 2CV5C 3WA9A 2Y2MA 2FJ7B 4M6BA 5GXQA 1P3AC 3W99B 1EQZA 3B6GD 3AZFD 2AROB 5CPKD 1KX5C 5AV9D 2PYOD 5BT1C 3AV2C 2BG1A 4NE5A 5B31A 5AV5D 3MGRA 3AZND 5AVBD 4G91C 4KUDA 3LZ0C 3B0DB 5B32A 3AN2C 1M18C 5AY8C 5GT3D 4H9PB 3C1BA 5CPID 5JA4A 1BH9B 4XUJA 1S32C 3LJAB 5B1MA 3UT9D 1P3LC 3AZLA 4YM6D 3B0CT 1U35B 3W97D 2NZDA 3MGPA 5E5AB 1P3BC 4H9RA 4CAYB 3AZKA 5B1LC 1P3ID 4H9OA 5B40B 3WTPD 1P3GA 5CPJD 4AWLB 5B0ZB 3AL0C 5FUGA 5DNMA 2IO5C 2YFWA 3AV1A 2LY8A 5AV8B 4G92C 5F99A 2F8ND 3UTAD 3REHD 4LD9B 3O62C 3UTBD 2HIOA 1H3OB 3LELD 3KXBD 3AFAA 3MGSA 2BYMB 5B33D 5AVCB 1P3PA 1HQ3D 2NQBD 4ZUXA 3AZEB 3AZMB 3MGQA 4WU8B 4JJNB 1JFIB 1P3AA 2BYKA 5B0YA 5BNXA 3AZHB 3MNNC 1BH8A 1KX4C 3A6NA 3MVDD 4KGCD 3WAAA 4J8VB 4ZBJC 4J8WD 3AN2A 5B2IC 3REKD 5AY8A 3REJC 1Q9CA 1B67A 5JRGB 1P34D 3B6FD 2Y2PA 3W98D 5AV6A 3X1VB 1M19D 1EQZB 1TZYD 2ZY2A 3X1UC 4X23A 3AZID 4R8PD 5CPKC 3W96B 5AV9C 2PYOC 3WA9C 3AYWD 5AV5C 1ID3B 4Z66A 4KUDB 3V9RB 1N1JA 2W8SA 3A1KA 5GXQC 3KUYB 5B2JC 5GT3C 3NQJA 3X1TB 3EPLA 3C1BB 4Z5TA 3MGRC 2FJ7D 5C3IB 3UT9C 3AZLB 5B32C 1P3KA 4H9NA 3MGPB 3W99D 3AZKB 5KDMA 2AROD 2Y2HA 1P3IC 5GT0B 4DRAA 4XUJC 5CPJC 5B32G 2HUEB 5B1MC 1KX3A 3X1SD 4WU9B 3R45A 3RELB 3KWQD 3NQUB 5F99B 3LZ1B 4CSRA 3IP4C 3REHC 3UTAC 3WKJA 2HIOB 4XZQA 3LJAD 1P3GC 3AFAB 3LELC 5DNMC 1HQ3C 1U35D 2NQBC 2F2AC 4E45A 5E5AD 1P3MA 3FDDA 3AV1C 2F8NG 2CV5B 1WWSA 4YS3C 3TU4D 5B0ZD 1M1AD 3AZJD 3MGSC 1P3PC 5GSUD 1P3AB 2JCHA 2G5HC 4ZUXC 5BNXB 3B6GA 5AV8D 1BH8B 1KX5B 3AZFA 5CPKA 1P3OC 5AV9A 3AV2B 2PYOA 4KGCC 5AV5A 3MGQC 3EPHA 3AZNA 5AVBA 3LZ0B 1M18B 5AY8B 3REKC 1F66D 5B2JA 5GT3A 5B0YC 5CPIA 3A6NC 1S32B 3W98C 4JJND 4WU8D 1P3LB 2ZY4A 2J8PA 3WAAC 3UT9A 4YM6A 1P3BB 2JSSA 4Z2MG 3AZHD 5B1LB 5BNVB 1P3IA 3WTPA 5CP6D 5CPJA 4R8PC 2RVQC 4J8VD 2IO5B 4WNNA 3AYWC 2ZY5A 5AV6C 4G92B 3REID 3AZGD 3B0CW 1ZLAD 2F8NA 2XD5A 3REHA 3O62B 3UTAA 3A1IA 4X23C 5BO0B 5JRGD 3UTBA 3LELA 5G49A 4UUZA 3KXBA 5B33A 1HQ3A 4NFTA 5DNND 2ZY3A 2NQBA 3EPJA 4Z66C 3X1VD 4DQYB 4J8XD 4YS3A 3W96D 4Z5TC 1ID3D 4KUDD 4UPKA 3MNNB 1KX4B 3X1SC 1P3KC 3KUYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD A;  1TAF A;  1P3F D;  3KWQ C;  3X1T D;  4KGC A;  4J8U D;  3B0B A;  4ZBJ B;  5B24 B;  5B2I B;  4J8W A;  3REK A;  4QLC D;  3REJ B;  1KX3 C;  1ULY A;  1P34 A;  3B6F A;  3W98 A;  5GT0 D;  5BS7 A;  1AOI B;  4KHA B;  3WKJ C;  4XZQ C;  3TU4 C;  4WV4 B;  1M1A C;  3AZJ C;  1M19 A;  5GSU C;  4WU9 D;  3X1U B;  3REL D;  1TZY A;  1P3M C;  3LZ1 D;  5CPK B;  3AZI A;  5AV9 B;  4R8P A;  3WA9 B;  5AV5 B;  3AYW A;  4HGA C;  5GXQ B;  5B2J B;  5GT3 B;  1F66 C;  4H9Q A;  3B6G C;  2CV5 D;  3AZF C;  5B31 B;  3MGR B;  3C1C D;  4NE6 A;  3VH5 A;  4EO5 C;  3AZN C;  5AVB C;  2FJ7 A;  5B32 B;  3W99 A;  1P3I B;  1KX5 D;  2ARO A;  3AV2 D;  5JA4 B;  5CPI C;  4XUJ B;  5CPJ B;  5CP6 C;  3LZ0 D;  5B1M B;  3VH5 T;  4WNN B;  3X1S A;  4YM6 C;  4NE3 A;  1M18 D;  2F8N H;  2NZD B;  3W97 C;  4H9R B;  3KWQ A;  3REI C;  2F8N B;  3AZG C;  3UTA B;  1ZLA C;  4H9P A;  4H9O B;  1BH9 A;  1S32 D;  1P3G B;  3LEL B;  5G49 B;  3WTP C;  3LJA A;  1P3L D;  5FUG B;  5DNM B;  1HQ3 B;  5DNN C;  1U35 A;  1P3B D;  2YFW B;  3AV1 B;  5E5A A;  4CAY A;  5B1L D;  4J8X C;  4YS3 B;  3UTB C;  3TU4 A;  3W96 C;  5B0Z A;  3KXB C;  3MGS B;  3AZJ A;  1P3P B;  1M1A A;  5B33 C;  5GSU A;  4ZUX B;  5AV8 A;  1P3O B;  1TAF B;  3O62 D;  4KGC B;  1P3F C;  3MGQ B;  5B40 D;  4J8U C;  1H3O A;  4Z2M H;  2BYM A;  3REK B;  1F66 A;  2BYK B;  5B0Y B;  4QLC C;  3A6N B;  4LD9 D;  3MVD C;  3W98 B;  3VH6 A;  4WU8 A;  4G91 B;  4JJN A;  3WAA B;  5AVC D;  3AN2 B;  4J8W C;  1P3O A;  2HUE C;  1BFM A;  3MNN D;  1KX4 D;  3AZH A;  3AZE D;  3AZM D;  1A7W A;  1B6W A;  4R8P B;  5CP6 A;  1P34 C;  3B6F C;  3VH6 T;  4J8V A;  5B24 D;  5BS7 C;  5B2I D;  5AV6 B;  3W97 A;  3REJ D;  1M19 C;  3REI A;  3AZG A;  1ZLA A;  4H9S A;  4H9Q B;  4X23 B;  1TZY C;  5JRG A;  3AZI C;  4E44 A;  1AOI D;  5DNN A;  5CHL B;  3C1C C;  4Z66 B;  3X1V A;  1N1J B;  4J8X A;  3X1U D;  3NQJ B;  3W96 A;  3WA9 D;  2YFV A;  4Z5T B;  1ID3 A;  2FJ7 C;  3V9R A;  3X1S B;  5GXQ D;  1P3K B;  3KUY A;  4H9N B;  5B2J D;  3KWQ B;  1P3F A;  1EQZ D;  3W99 C;  3X1T A;  5KDM B;  4J8U A;  2ARO C;  5B31 D;  3MGR D;  5B32 D;  1KX3 B;  4QLC A;  3B0D C;  3R45 B;  4CSR B;  3C1B D;  5GT0 A;  3WKJ B;  4XUJ D;  4XZQ B;  3TU4 B;  3LJA C;  5B1M D;  3AZJ B;  1M1A B;  3AZL D;  5GSU B;  4WU9 A;  2NZD D;  1U35 C;  1P3M B;  3MGP D;  3REL A;  2L5A A;  3KSY A;  5E5A C;  3AZK D;  3NQU A;  3LZ1 A;  2F8N K;  1P3G D;  5B40 C;  4HGA B;  5DNM D;  4AWL C;  5B0Z C;  1F66 B;  3AV1 D;  3B6G B;  5AV8 C;  5F99 D;  3AZF B;  2CV5 A;  2PYO B;  4LD9 C;  4YS3 D;  3C1C A;  2HIO D;  4EO5 B;  5AVB B;  3AZN B;  3AFA D;  4DRB A;  3MGS D;  1P3P D;  5AVC C;  4WZS B;  4ZUX D;  1P3O D;  1KX5 A;  5CPI B;  3AV2 A;  3AZE C;  3MGQ D;  3AZM C;  5CP6 B;  3LZ0 A;  4JJN C;  3UT9 B;  4WU8 C;  4YM6 B;  5B24 C;  3WTP E;  1M18 A;  3W97 B;  1P3A D;  5B0Y D;  3REI B;  3AZG B;  1ZLA B;  3AZH C;  3A6N D;  5BT1 D;  1S32 A;  3WTP B;  1WWI A;  1P3L A;  3WAA D;  5DNN B;  4J8V C;  1AOI C;  3AN2 D;  1P3B A;  5AY8 D;  3VH5 W;  4J8X B;  5B1L A;  5BNV A;  3REH B;  4H9S C;  3UTB B;  5JRG C;  3KXB B;  4UUZ B;  2RVQ D;  2YFV B;  5B33 B;  1KU5 A;  2NQB B;  5AV6 D;  3X1V C;  1R4V A;  1P3F B;  4X23 D;  3O62 A;  1EQZ C;  1F1E A;  5BO0 A;  4J8U B;  5B40 A;  5B31 C;  4Z66 D;  1ID3 C;  4KUD C;  4QLC B;  3KUY C;  3MVD B;  4LD9 A;  3X1T C;  3C1B C;  5B31 G;  4Z5T D;  4J8W B;  5AVC A;  5C3I C;  3AZL C;  3MNN A;  1P3K D;  1KX4 A;  2CWE A;  2NZD C;  1HTA A;  3MGP C;  3AZE A;  3AZM A;  1P34 B;  3AZK C;  3B6F B;  1JFI A;  5GT0 C;  5B24 A;  5B2I A;  1M19 B;  1KX3 D;  3REJ A;  4WU9 C;  1TZY B;  3REL C;  3AZI B;  3LZ1 C;  5F99 C;  3C1C B;  3WKJ D;  3AYW B;  4XZQ D;  4KHA A;  1AOI A;  2HIO C;  3AFA C;  3VH6 W;  3X1U A;  1P3M D;  2CV5 C;  3WA9 A;  2FJ7 B;  4M6B A;  5GXQ A;  1P3A C;  3W99 B;  1EQZ A;  3B6G D;  3AZF D;  2ARO B;  5CPK D;  1KX5 C;  5AV9 D;  2PYO D;  5BT1 C;  3AV2 C;  5B31 A;  4NE5 A;  5AV5 D;  3MGR A;  3AZN D;  5AVB D;  4G91 C;  4KUD A;  3LZ0 C;  3B0D B;  5B32 A;  3AN2 C;  1M18 C;  5AY8 C;  5GT3 D;  4H9P B;  3C1B A;  5CPI D;  5JA4 A;  1BH9 B;  4XUJ A;  1S32 C;  3LJA B;  5B1M A;  3UT9 D;  1P3L C;  3AZL A;  4YM6 D;  3B0C T;  1U35 B;  3W97 D;  2NZD A;  3MGP A;  5E5A B;  1P3B C;  4H9R A;  4CAY B;  3AZK A;  5B1L C;  1P3I D;  4H9O A;  5B40 B;  3WTP D;  1P3G A;  5CPJ D;  4AWL B;  5B0Z B;  5FUG A;  5DNM A;  2IO5 C;  2YFW A;  3AV1 A;  2LY8 A;  5AV8 B;  4G92 C;  5F99 A;  2F8N D;  3UTA D;  3REH D;  4LD9 B;  3O62 C;  3UTB D;  2HIO A;  1H3O B;  3LEL D;  3KXB D;  3AFA A;  3MGS A;  2BYM B;  5B33 D;  5AVC B;  1P3P A;  1HQ3 D;  2NQB D;  4ZUX A;  3AZE B;  3AZM B;  3MGQ A;  4WU8 B;  4JJN B;  1JFI B;  1P3A A;  2BYK A;  5B0Y A;  5BNX A;  3AZH B;  3MNN C;  1BH8 A;  1KX4 C;  3A6N A;  3MVD D;  4KGC D;  3WAA A;  4J8V B;  4ZBJ C;  4J8W D;  3AN2 A;  5B2I C;  3REK D;  5AY8 A;  3REJ C;  1Q9C A;  1B67 A;  5JRG B;  1P34 D;  3B6F D;  3W98 D;  5AV6 A;  3X1V B;  1M19 D;  1EQZ B;  1TZY D;  3X1U C;  4X23 A;  3AZI D;  4R8P D;  5CPK C;  3W96 B;  5AV9 C;  2PYO C;  3WA9 C;  3AYW D;  5AV5 C;  1ID3 B;  4Z66 A;  4KUD B;  3V9R B;  1N1J A;  5GXQ C;  3KUY B;  5B2J C;  5GT3 C;  3NQJ A;  3X1T B;  3C1B B;  4Z5T A;  3MGR C;  2FJ7 D;  5C3I B;  3UT9 C;  3AZL B;  5B32 C;  1P3K A;  4H9N A;  3MGP B;  3W99 D;  3AZK B;  5KDM A;  2ARO D;  1P3I C;  5GT0 B;  4DRA A;  4XUJ C;  5CPJ C;  5B32 G;  2HUE B;  5B1M C;  1KX3 A;  3X1S D;  4WU9 B;  3R45 A;  3REL B;  3KWQ D;  3NQU B;  5F99 B;  3LZ1 B;  4CSR A;  3UTA C;  3REH C;  3WKJ A;  2HIO B;  4XZQ A;  3LJA D;  1P3G C;  3AFA B;  3LEL C;  5DNM C;  1HQ3 C;  1U35 D;  2NQB C;  4E45 A;  1P3M A;  5E5A D;  3AV1 C;  2F8N G;  2CV5 B;  1WWS A;  4YS3 C;  3TU4 D;  5B0Z D;  1M1A D;  3AZJ D;  3MGS C;  1P3P C;  5GSU D;  1P3A B;  4ZUX C;  5BNX B;  3B6G A;  5AV8 D;  1BH8 B;  1KX5 B;  3AZF A;  5CPK A;  1P3O C;  5AV9 A;  3AV2 B;  2PYO A;  4KGC C;  5AV5 A;  3MGQ C;  3AZN A;  5AVB A;  3LZ0 B;  1M18 B;  5AY8 B;  3REK C;  1F66 D;  5B2J A;  5GT3 A;  5B0Y C;  5CPI A;  3A6N C;  1S32 B;  3W98 C;  4JJN D;  4WU8 D;  1P3L B;  3WAA C;  3UT9 A;  4YM6 A;  1P3B B;  2JSS A;  4Z2M G;  3AZH D;  5B1L B;  5BNV B;  1P3I A;  3WTP A;  5CP6 D;  5CPJ A;  4R8P C;  2RVQ C;  4J8V D;  2IO5 B;  4WNN A;  3AYW C;  5AV6 C;  4G92 B;  3REI D;  3AZG D;  3B0C W;  1ZLA D;  2F8N A;  3UTA A;  3REH A;  3O62 B;  4X23 C;  5BO0 B;  5JRG D;  3UTB A;  3LEL A;  5G49 A;  4UUZ A;  3KXB A;  5B33 A;  1HQ3 A;  4NFT A;  5DNN D;  2NQB A;  4Z66 C;  3X1V D;  4J8X D;  4YS3 A;  3W96 D;  4Z5T C;  1ID3 D;  4KUD D;  3MNN B;  1KX4 B;  3X1S C;  1P3K C;  3KUY D; 
#chains in the Genus database with same CATH topology
 3MVD A;  1TAF A;  1P3F D;  3KWQ C;  3X1T D;  4KGC A;  4J8U D;  3B0B A;  4ZBJ B;  5B24 B;  5B2I B;  4J8W A;  3REK A;  4QLC D;  3REJ B;  2JE5 A;  1KX3 C;  1ULY A;  1P34 A;  3B6F A;  3W98 A;  5GT0 D;  5BS7 A;  1AOI B;  4KHA B;  3WKJ C;  4XZQ C;  3TU4 C;  4WV4 B;  1M1A C;  3AZJ C;  1M19 A;  5GSU C;  4WU9 D;  3KFU G;  3X1U B;  3REL D;  1TZY A;  1P3M C;  3LZ1 D;  5CPK B;  2Y2J A;  2Y2K A;  3AZI A;  5AV9 B;  4R8P A;  3WA9 B;  5AV5 B;  3AYW A;  4HGA C;  5GXQ B;  5B2J B;  5GT3 B;  1F66 C;  4H9Q A;  3B6G C;  2CV5 D;  3AZF C;  3H0R C;  5B31 B;  3MGR B;  3C1C D;  4NE6 A;  3VH5 A;  4EO5 C;  3AZN C;  5AVB C;  2FJ7 A;  5B32 B;  2DF4 C;  3W99 A;  2UWX A;  1P3I B;  1KX5 D;  2ARO A;  3AV2 D;  5JA4 B;  5CPI C;  4XUJ B;  5CPJ B;  5CP6 C;  3LZ0 D;  5B1M B;  3VH5 T;  4WNN B;  3X1S A;  4YM6 C;  4NE3 A;  1M18 D;  2F8N H;  2NZD B;  3W97 C;  4H9R B;  3KWQ A;  3REI C;  2F8N B;  3AZG C;  2G5I C;  3UTA B;  4H9P A;  1ZLA C;  4H9O B;  1BH9 A;  1S32 D;  3F6T A;  1P3G B;  3LEL B;  5G49 B;  3WTP C;  3LJA A;  1P3L D;  5FUG B;  5DNM B;  1HQ3 B;  5DNN C;  1U35 A;  1P3B D;  2Y2L A;  2YFW B;  3AV1 B;  5E5A A;  4CAY A;  5B1L D;  4J8X C;  4YS3 B;  3UTB C;  3TU4 A;  3W96 C;  5B0Z A;  3KXB C;  3MGS B;  3AZJ A;  1P3P B;  1M1A A;  5B33 C;  5GSU A;  4ZUX B;  5AV8 A;  1P3O B;  1TAF B;  3O62 D;  4KGC B;  1P3F C;  3MGQ B;  5B40 D;  4J8U C;  1H3O A;  4Z2M H;  2BYM A;  2DQN C;  3REK B;  1F66 A;  2BYK B;  5B0Y B;  4QLC C;  3A6N B;  4LD9 D;  3MVD C;  3W98 B;  3VH6 A;  4WU8 A;  4G91 B;  4JJN A;  3WAA B;  5AVC D;  3AN2 B;  4J8W C;  1P3O A;  2HUE C;  1BFM A;  3MNN D;  1KX4 D;  3AZH A;  3AZE D;  3AZM D;  1A7W A;  1B6W A;  4R8P B;  5CP6 A;  2Y2G A;  1P34 C;  3B6F C;  3VH6 T;  4J8V A;  5B24 D;  5BS7 C;  5B2I D;  5AV6 B;  3W97 A;  3REJ D;  1M19 C;  3REI A;  3AZG A;  1ZLA A;  4H9S A;  4H9Q B;  4X23 B;  1TZY C;  5JRG A;  3AZI C;  4E44 A;  1AOI D;  5DNN A;  5CHL B;  3C1C C;  4Z66 B;  3X1V A;  1N1J B;  4J8X A;  3X1U D;  3NQJ B;  3W96 A;  3WA9 D;  2YFV A;  4Z5T B;  1ID3 A;  2FJ7 C;  3V9R A;  3X1S B;  5GXQ D;  1P3K B;  3KUY A;  4H9N B;  5B2J D;  3KWQ B;  3P5J B;  1P3F A;  3W99 C;  1EQZ D;  3X1T A;  5KDM B;  4J8U A;  2ARO C;  5B31 D;  3MGR D;  5B32 D;  1KX3 B;  4QLC A;  3B0D C;  3R45 B;  3EPK A;  4CSR B;  1PZR A;  3C1B D;  2Y2I A;  5GT0 A;  3WKJ B;  4XUJ D;  4XZQ B;  3TU4 B;  3LJA C;  5B1M D;  3AZJ B;  1M1A B;  3AZL D;  5GSU B;  4WU9 A;  2NZD D;  1U35 C;  1P3M B;  3MGP D;  3REL A;  2L5A A;  3KSY A;  5E5A C;  3AZK D;  3NQU A;  3LZ1 A;  2F8N K;  1P3G D;  5B40 C;  4HGA B;  5DNM D;  4AWL C;  5B0Z C;  1F66 B;  3EG5 B;  3AV1 D;  3B6G B;  5AV8 C;  5F99 D;  3AZF B;  2CV5 A;  2PYO B;  4LD9 C;  4YS3 D;  3C1C A;  2HIO D;  4EO5 B;  5AVB B;  3AZN B;  3AFA D;  4DRB A;  3MGS D;  1P3P D;  5AVC C;  4WZS B;  4ZUX D;  1P3O D;  1KX5 A;  2Y2O A;  5CPI B;  3AV2 A;  3AZE C;  3MGQ D;  3AZM C;  5CP6 B;  3LZ0 A;  4JJN C;  3UT9 B;  4WU8 C;  4YM6 B;  5B24 C;  3WTP E;  1M18 A;  3W97 B;  2XD1 A;  1P3A D;  5B0Y D;  2VQR A;  3REI B;  3AZG B;  1ZLA B;  3AZH C;  3A6N D;  5BT1 D;  2FFF B;  1S32 A;  3WTP B;  1WWI A;  1P3L A;  3WAA D;  1T3U A;  5DNN B;  4J8V C;  1AOI C;  3AN2 D;  1P3B A;  5AY8 D;  3VH5 W;  2ZM5 A;  2RIQ A;  4J8X B;  5B1L A;  5BNV A;  3REH B;  4H9S C;  3UTB B;  5JRG C;  3KXB B;  4UUZ B;  2RVQ D;  1Z2C B;  2YFV B;  5B33 B;  1KU5 A;  4WJ3 C;  2NQB B;  5AV6 D;  3X1V C;  1R4V A;  1P3F B;  4X23 D;  3O62 A;  1EQZ C;  1F1E A;  5BO0 A;  4J8U B;  5B40 A;  5B31 C;  4Z66 D;  1ID3 C;  4KUD C;  4QLC B;  3KUY C;  3MVD B;  4LD9 A;  3X1T C;  3C1B C;  5B31 G;  4Z5T D;  4J8W B;  5AVC A;  5C3I C;  3AZL C;  3MNN A;  1P3K D;  1KX4 A;  2CWE A;  2NZD C;  1HTA A;  3MGP C;  3AZE A;  3AZM A;  3H0M C;  3AZK C;  1P34 B;  3B6F B;  1JFI A;  5GT0 C;  5B24 A;  5B2I A;  1M19 B;  1KX3 D;  2Y2N A;  3REJ A;  4WU9 C;  1W2E A;  1TZY B;  3H0L C;  3REL C;  3AZI B;  3LZ1 C;  5F99 C;  3C1C B;  3WKJ D;  3AYW B;  4XZQ D;  4KHA A;  1AOI A;  2HIO C;  3AFA C;  3VH6 W;  2Y2Q A;  3X1U A;  1P3M D;  2CV5 C;  3WA9 A;  2Y2M A;  2FJ7 B;  4M6B A;  5GXQ A;  1P3A C;  3W99 B;  1EQZ A;  3B6G D;  3AZF D;  2ARO B;  5CPK D;  1KX5 C;  5AV9 D;  2PYO D;  5BT1 C;  3AV2 C;  2BG1 A;  4NE5 A;  5B31 A;  5AV5 D;  3MGR A;  3AZN D;  5AVB D;  4G91 C;  4KUD A;  3LZ0 C;  3B0D B;  5B32 A;  3AN2 C;  1M18 C;  5AY8 C;  5GT3 D;  4H9P B;  3C1B A;  5CPI D;  5JA4 A;  1BH9 B;  4XUJ A;  1S32 C;  3LJA B;  5B1M A;  3UT9 D;  1P3L C;  3AZL A;  4YM6 D;  3B0C T;  1U35 B;  3W97 D;  2NZD A;  3MGP A;  5E5A B;  1P3B C;  4H9R A;  4CAY B;  3AZK A;  5B1L C;  1P3I D;  4H9O A;  5B40 B;  3WTP D;  1P3G A;  5CPJ D;  4AWL B;  5B0Z B;  3AL0 C;  5FUG A;  5DNM A;  2IO5 C;  2YFW A;  3AV1 A;  2LY8 A;  5AV8 B;  4G92 C;  5F99 A;  2F8N D;  3UTA D;  3REH D;  4LD9 B;  3O62 C;  3UTB D;  2HIO A;  1H3O B;  3LEL D;  3KXB D;  3AFA A;  3MGS A;  2BYM B;  5B33 D;  5AVC B;  1P3P A;  1HQ3 D;  2NQB D;  4ZUX A;  3AZE B;  3AZM B;  3MGQ A;  4WU8 B;  4JJN B;  1JFI B;  1P3A A;  2BYK A;  5B0Y A;  5BNX A;  3AZH B;  3MNN C;  1BH8 A;  1KX4 C;  3A6N A;  3MVD D;  4KGC D;  3WAA A;  4J8V B;  4ZBJ C;  4J8W D;  3AN2 A;  5B2I C;  3REK D;  5AY8 A;  3REJ C;  1Q9C A;  1B67 A;  5JRG B;  1P34 D;  3B6F D;  2Y2P A;  3W98 D;  5AV6 A;  3X1V B;  1M19 D;  1EQZ B;  1TZY D;  2ZY2 A;  3X1U C;  4X23 A;  3AZI D;  4R8P D;  5CPK C;  3W96 B;  5AV9 C;  2PYO C;  3WA9 C;  3AYW D;  5AV5 C;  1ID3 B;  4Z66 A;  4KUD B;  3V9R B;  1N1J A;  2W8S A;  3A1K A;  5GXQ C;  3KUY B;  5B2J C;  5GT3 C;  3NQJ A;  3X1T B;  3EPL A;  3C1B B;  4Z5T A;  3MGR C;  2FJ7 D;  5C3I B;  3UT9 C;  3AZL B;  5B32 C;  1P3K A;  4H9N A;  3MGP B;  3W99 D;  3AZK B;  5KDM A;  2ARO D;  2Y2H A;  1P3I C;  5GT0 B;  4DRA A;  4XUJ C;  5CPJ C;  5B32 G;  2HUE B;  5B1M C;  1KX3 A;  3X1S D;  4WU9 B;  3R45 A;  3REL B;  3KWQ D;  3NQU B;  5F99 B;  3LZ1 B;  4CSR A;  3IP4 C;  3REH C;  3UTA C;  3WKJ A;  2HIO B;  4XZQ A;  3LJA D;  1P3G C;  3AFA B;  3LEL C;  5DNM C;  1HQ3 C;  1U35 D;  2NQB C;  2F2A C;  4E45 A;  5E5A D;  1P3M A;  3FDD A;  3AV1 C;  2F8N G;  2CV5 B;  1WWS A;  4YS3 C;  3TU4 D;  5B0Z D;  1M1A D;  3AZJ D;  3MGS C;  1P3P C;  5GSU D;  1P3A B;  2JCH A;  2G5H C;  4ZUX C;  5BNX B;  3B6G A;  5AV8 D;  1BH8 B;  1KX5 B;  3AZF A;  5CPK A;  1P3O C;  5AV9 A;  3AV2 B;  2PYO A;  4KGC C;  5AV5 A;  3MGQ C;  3EPH A;  3AZN A;  5AVB A;  3LZ0 B;  1M18 B;  5AY8 B;  3REK C;  1F66 D;  5B2J A;  5GT3 A;  5B0Y C;  5CPI A;  3A6N C;  1S32 B;  3W98 C;  4JJN D;  4WU8 D;  1P3L B;  2ZY4 A;  2J8P A;  3WAA C;  3UT9 A;  4YM6 A;  1P3B B;  2JSS A;  4Z2M G;  3AZH D;  5B1L B;  5BNV B;  1P3I A;  3WTP A;  5CP6 D;  5CPJ A;  4R8P C;  2RVQ C;  4J8V D;  2IO5 B;  4WNN A;  3AYW C;  2ZY5 A;  5AV6 C;  4G92 B;  3REI D;  3AZG D;  3B0C W;  1ZLA D;  2F8N A;  2XD5 A;  3REH A;  3O62 B;  3UTA A;  3A1I A;  4X23 C;  5BO0 B;  5JRG D;  3UTB A;  3LEL A;  5G49 A;  4UUZ A;  3KXB A;  5B33 A;  1HQ3 A;  4NFT A;  5DNN D;  2ZY3 A;  2NQB A;  3EPJ A;  4Z66 C;  3X1V D;  4DQY B;  4J8X D;  4YS3 A;  3W96 D;  4Z5T C;  1ID3 D;  4KUD D;  4UPK A;  3MNN B;  1KX4 B;  3X1S C;  1P3K C;  3KUY D; 
#chains in the Genus database with same CATH homology
 3MVD A;  1TAF A;  1P3F D;  3KWQ C;  3X1T D;  4KGC A;  4J8U D;  3B0B A;  4ZBJ B;  5B24 B;  5B2I B;  4J8W A;  3REK A;  4QLC D;  3REJ B;  2JE5 A;  1KX3 C;  1ULY A;  1P34 A;  3B6F A;  3W98 A;  5GT0 D;  5BS7 A;  1AOI B;  4KHA B;  3WKJ C;  4XZQ C;  3TU4 C;  4WV4 B;  1M1A C;  3AZJ C;  1M19 A;  5GSU C;  4WU9 D;  3KFU G;  3X1U B;  3REL D;  1TZY A;  1P3M C;  3LZ1 D;  5CPK B;  2Y2J A;  2Y2K A;  3AZI A;  5AV9 B;  4R8P A;  3WA9 B;  5AV5 B;  3AYW A;  4HGA C;  5GXQ B;  5B2J B;  5GT3 B;  1F66 C;  4H9Q A;  3B6G C;  2CV5 D;  3AZF C;  3H0R C;  5B31 B;  3MGR B;  3C1C D;  4NE6 A;  3VH5 A;  4EO5 C;  3AZN C;  5AVB C;  2FJ7 A;  5B32 B;  2DF4 C;  3W99 A;  2UWX A;  1P3I B;  1KX5 D;  2ARO A;  3AV2 D;  5JA4 B;  5CPI C;  4XUJ B;  5CPJ B;  5CP6 C;  3LZ0 D;  5B1M B;  3VH5 T;  4WNN B;  3X1S A;  4YM6 C;  4NE3 A;  1M18 D;  2F8N H;  2NZD B;  3W97 C;  4H9R B;  3KWQ A;  3REI C;  2F8N B;  3AZG C;  2G5I C;  3UTA B;  4H9P A;  1ZLA C;  4H9O B;  1BH9 A;  1S32 D;  3F6T A;  1P3G B;  3LEL B;  5G49 B;  3WTP C;  3LJA A;  1P3L D;  5FUG B;  5DNM B;  1HQ3 B;  5DNN C;  1U35 A;  1P3B D;  2Y2L A;  2YFW B;  3AV1 B;  5E5A A;  4CAY A;  5B1L D;  4J8X C;  4YS3 B;  3UTB C;  3TU4 A;  3W96 C;  5B0Z A;  3KXB C;  3MGS B;  3AZJ A;  1P3P B;  1M1A A;  5B33 C;  5GSU A;  4ZUX B;  5AV8 A;  1P3O B;  1TAF B;  3O62 D;  4KGC B;  1P3F C;  3MGQ B;  5B40 D;  4J8U C;  1H3O A;  4Z2M H;  2BYM A;  2DQN C;  3REK B;  1F66 A;  2BYK B;  5B0Y B;  4QLC C;  3A6N B;  4LD9 D;  3MVD C;  3W98 B;  3VH6 A;  4WU8 A;  4G91 B;  4JJN A;  3WAA B;  5AVC D;  3AN2 B;  4J8W C;  1P3O A;  2HUE C;  1BFM A;  3MNN D;  1KX4 D;  3AZH A;  3AZE D;  3AZM D;  1A7W A;  1B6W A;  4R8P B;  5CP6 A;  2Y2G A;  1P34 C;  3B6F C;  3VH6 T;  4J8V A;  5B24 D;  5BS7 C;  5B2I D;  5AV6 B;  3W97 A;  3REJ D;  1M19 C;  3REI A;  3AZG A;  1ZLA A;  4H9S A;  4H9Q B;  4X23 B;  1TZY C;  5JRG A;  3AZI C;  4E44 A;  1AOI D;  5DNN A;  5CHL B;  3C1C C;  4Z66 B;  3X1V A;  1N1J B;  4J8X A;  3X1U D;  3NQJ B;  3W96 A;  3WA9 D;  2YFV A;  4Z5T B;  1ID3 A;  2FJ7 C;  3V9R A;  3X1S B;  5GXQ D;  1P3K B;  3KUY A;  4H9N B;  5B2J D;  3KWQ B;  3P5J B;  1P3F A;  3W99 C;  1EQZ D;  3X1T A;  5KDM B;  4J8U A;  2ARO C;  5B31 D;  3MGR D;  5B32 D;  1KX3 B;  4QLC A;  3B0D C;  3R45 B;  3EPK A;  4CSR B;  1PZR A;  3C1B D;  2Y2I A;  5GT0 A;  3WKJ B;  4XUJ D;  4XZQ B;  3TU4 B;  3LJA C;  5B1M D;  3AZJ B;  1M1A B;  3AZL D;  5GSU B;  4WU9 A;  2NZD D;  1U35 C;  1P3M B;  3MGP D;  3REL A;  2L5A A;  3KSY A;  5E5A C;  3AZK D;  3NQU A;  3LZ1 A;  2F8N K;  1P3G D;  5B40 C;  4HGA B;  5DNM D;  4AWL C;  5B0Z C;  1F66 B;  3EG5 B;  3AV1 D;  3B6G B;  5AV8 C;  5F99 D;  3AZF B;  2CV5 A;  2PYO B;  4LD9 C;  4YS3 D;  3C1C A;  2HIO D;  4EO5 B;  5AVB B;  3AZN B;  3AFA D;  4DRB A;  3MGS D;  1P3P D;  5AVC C;  4WZS B;  4ZUX D;  1P3O D;  1KX5 A;  2Y2O A;  5CPI B;  3AV2 A;  3AZE C;  3MGQ D;  3AZM C;  5CP6 B;  3LZ0 A;  4JJN C;  3UT9 B;  4WU8 C;  4YM6 B;  5B24 C;  3WTP E;  1M18 A;  3W97 B;  2XD1 A;  1P3A D;  5B0Y D;  2VQR A;  3REI B;  3AZG B;  1ZLA B;  3AZH C;  3A6N D;  5BT1 D;  2FFF B;  1S32 A;  3WTP B;  1WWI A;  1P3L A;  3WAA D;  1T3U A;  5DNN B;  4J8V C;  1AOI C;  3AN2 D;  1P3B A;  5AY8 D;  3VH5 W;  2ZM5 A;  2RIQ A;  4J8X B;  5B1L A;  5BNV A;  3REH B;  4H9S C;  3UTB B;  5JRG C;  3KXB B;  4UUZ B;  2RVQ D;  1Z2C B;  2YFV B;  5B33 B;  1KU5 A;  4WJ3 C;  2NQB B;  5AV6 D;  3X1V C;  1R4V A;  1P3F B;  4X23 D;  3O62 A;  1EQZ C;  1F1E A;  5BO0 A;  4J8U B;  5B40 A;  5B31 C;  4Z66 D;  1ID3 C;  4KUD C;  4QLC B;  3KUY C;  3MVD B;  4LD9 A;  3X1T C;  3C1B C;  5B31 G;  4Z5T D;  4J8W B;  5AVC A;  5C3I C;  3AZL C;  3MNN A;  1P3K D;  1KX4 A;  2CWE A;  2NZD C;  1HTA A;  3MGP C;  3AZE A;  3AZM A;  3H0M C;  3AZK C;  1P34 B;  3B6F B;  1JFI A;  5GT0 C;  5B24 A;  5B2I A;  1M19 B;  1KX3 D;  2Y2N A;  3REJ A;  4WU9 C;  1W2E A;  1TZY B;  3H0L C;  3REL C;  3AZI B;  3LZ1 C;  5F99 C;  3C1C B;  3WKJ D;  3AYW B;  4XZQ D;  4KHA A;  1AOI A;  2HIO C;  3AFA C;  3VH6 W;  2Y2Q A;  3X1U A;  1P3M D;  2CV5 C;  3WA9 A;  2Y2M A;  2FJ7 B;  4M6B A;  5GXQ A;  1P3A C;  3W99 B;  1EQZ A;  3B6G D;  3AZF D;  2ARO B;  5CPK D;  1KX5 C;  5AV9 D;  2PYO D;  5BT1 C;  3AV2 C;  2BG1 A;  4NE5 A;  5B31 A;  5AV5 D;  3MGR A;  3AZN D;  5AVB D;  4G91 C;  4KUD A;  3LZ0 C;  3B0D B;  5B32 A;  3AN2 C;  1M18 C;  5AY8 C;  5GT3 D;  4H9P B;  3C1B A;  5CPI D;  5JA4 A;  1BH9 B;  4XUJ A;  1S32 C;  3LJA B;  5B1M A;  3UT9 D;  1P3L C;  3AZL A;  4YM6 D;  3B0C T;  1U35 B;  3W97 D;  2NZD A;  3MGP A;  5E5A B;  1P3B C;  4H9R A;  4CAY B;  3AZK A;  5B1L C;  1P3I D;  4H9O A;  5B40 B;  3WTP D;  1P3G A;  5CPJ D;  4AWL B;  5B0Z B;  3AL0 C;  5FUG A;  5DNM A;  2IO5 C;  2YFW A;  3AV1 A;  2LY8 A;  5AV8 B;  4G92 C;  5F99 A;  2F8N D;  3UTA D;  3REH D;  4LD9 B;  3O62 C;  3UTB D;  2HIO A;  1H3O B;  3LEL D;  3KXB D;  3AFA A;  3MGS A;  2BYM B;  5B33 D;  5AVC B;  1P3P A;  1HQ3 D;  2NQB D;  4ZUX A;  3AZE B;  3AZM B;  3MGQ A;  4WU8 B;  4JJN B;  1JFI B;  1P3A A;  2BYK A;  5B0Y A;  5BNX A;  3AZH B;  3MNN C;  1BH8 A;  1KX4 C;  3A6N A;  3MVD D;  4KGC D;  3WAA A;  4J8V B;  4ZBJ C;  4J8W D;  3AN2 A;  5B2I C;  3REK D;  5AY8 A;  3REJ C;  1Q9C A;  1B67 A;  5JRG B;  1P34 D;  3B6F D;  2Y2P A;  3W98 D;  5AV6 A;  3X1V B;  1M19 D;  1EQZ B;  1TZY D;  2ZY2 A;  3X1U C;  4X23 A;  3AZI D;  4R8P D;  5CPK C;  3W96 B;  5AV9 C;  2PYO C;  3WA9 C;  3AYW D;  5AV5 C;  1ID3 B;  4Z66 A;  4KUD B;  3V9R B;  1N1J A;  2W8S A;  3A1K A;  5GXQ C;  3KUY B;  5B2J C;  5GT3 C;  3NQJ A;  3X1T B;  3EPL A;  3C1B B;  4Z5T A;  3MGR C;  2FJ7 D;  5C3I B;  3UT9 C;  3AZL B;  5B32 C;  1P3K A;  4H9N A;  3MGP B;  3W99 D;  3AZK B;  5KDM A;  2ARO D;  2Y2H A;  1P3I C;  5GT0 B;  4DRA A;  4XUJ C;  5CPJ C;  5B32 G;  2HUE B;  5B1M C;  1KX3 A;  3X1S D;  4WU9 B;  3R45 A;  3REL B;  3KWQ D;  3NQU B;  5F99 B;  3LZ1 B;  4CSR A;  3IP4 C;  3REH C;  3UTA C;  3WKJ A;  2HIO B;  4XZQ A;  3LJA D;  1P3G C;  3AFA B;  3LEL C;  5DNM C;  1HQ3 C;  1U35 D;  2NQB C;  2F2A C;  4E45 A;  5E5A D;  1P3M A;  3FDD A;  3AV1 C;  2F8N G;  2CV5 B;  1WWS A;  4YS3 C;  3TU4 D;  5B0Z D;  1M1A D;  3AZJ D;  3MGS C;  1P3P C;  5GSU D;  1P3A B;  2JCH A;  2G5H C;  4ZUX C;  5BNX B;  3B6G A;  5AV8 D;  1BH8 B;  1KX5 B;  3AZF A;  5CPK A;  1P3O C;  5AV9 A;  3AV2 B;  2PYO A;  4KGC C;  5AV5 A;  3MGQ C;  3EPH A;  3AZN A;  5AVB A;  3LZ0 B;  1M18 B;  5AY8 B;  3REK C;  1F66 D;  5B2J A;  5GT3 A;  5B0Y C;  5CPI A;  3A6N C;  1S32 B;  3W98 C;  4JJN D;  4WU8 D;  1P3L B;  2ZY4 A;  2J8P A;  3WAA C;  3UT9 A;  4YM6 A;  1P3B B;  2JSS A;  4Z2M G;  3AZH D;  5B1L B;  5BNV B;  1P3I A;  3WTP A;  5CP6 D;  5CPJ A;  4R8P C;  2RVQ C;  4J8V D;  2IO5 B;  4WNN A;  3AYW C;  2ZY5 A;  5AV6 C;  4G92 B;  3REI D;  3AZG D;  3B0C W;  1ZLA D;  2F8N A;  2XD5 A;  3REH A;  3O62 B;  3UTA A;  3A1I A;  4X23 C;  5BO0 B;  5JRG D;  3UTB A;  3LEL A;  5G49 A;  4UUZ A;  3KXB A;  5B33 A;  1HQ3 A;  4NFT A;  5DNN D;  2ZY3 A;  2NQB A;  3EPJ A;  4Z66 C;  3X1V D;  4DQY B;  4J8X D;  4YS3 A;  3W96 D;  4Z5T C;  1ID3 D;  4KUD D;  4UPK A;  3MNN B;  1KX4 B;  3X1S C;  1P3K C;  3KUY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...