5AVCA

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcA00
4R8PB 4KHAB 1P3PC 3LZ0C 1HQ3A 4XUJC 2RVQC 1KX3D 1HQ3C 2HIOB 4G91B 1M18C 3B6FB 5B0YD 3AZHC 5CPKD 4LD9D 5AVBD 5AV9B 4J8WB 3REID 5CPJD 4WU8A 3REKD 4UUZA 3X1UB 1ID3D 4WV4B 2AROD 5BT1D 1M19B 4H9QA 3LZ1B 1KX5A 4J8VD 5JA4A 3AV1C 1ULYA 5B31C 1P3PD 5BNVA 3LZ0D 1EQZA 3AFAA 3C1CC 5B32A 4XUJD 4KHAA 2RVQD 1HQ3D 5E5AC 3AFAC 5AVCB 5B32C 1M18D 3O62C 3MGRB 3AZHD 3X1SB 5F99B 3TU4B 2HIOA 1P3KD 3B6FA 4J8WA 1B67A 5AV9A 3AZJC 3REHB 1Q9CA 3AN2D 3X1TB 5B0ZB 4G91C 3X1UA 3LJAB 3B6GB 3B6FC 4J8WC 5AV9C 2HUEB 1P3IC 1M19A 1U35A 5B2JB 3AV1D 3AZEB 3LZ1A 3W96C 3X1UC 3KXBC 5B31D 1M19C 3C1CD 1U35C 3AZKC 5AV6B 5E5AD 3AFAD 5B32D 3O62D 5AVCA 3MGRA 2IO5B 3AZJD 2F8NK 5F99A 3TU4A 2YFVB 3WKJB 3B6FD 3MGRC 4LD9B 4J8WD 5AV9D 3VH5W 5B0YB 4NE3A 5AVBB 3REHA 5CPKB 1P3ID 5F99C 3X1TA 5B0ZA 3REIB 3LJAA 3REKB 3B6GA 3W96D 3KXBD 2PYOB 1ID3B 5B2JA 3B0CT 3AZEA 4AWLB 1U35D 1M19D 5B0ZC 4JJNB 3AZKD 3LJAC 3B6GC 4J8VB 3W99C 3B0DC 5AV6A 1P3PB 5B1LC 1P3GB 4XUJB 1BH8B 5AV6C 1R4VA 3MGRD 1P3FA 1M18B 3AZHB 3V9RB 2YFVA 3WKJA 5F99D 5CPIC 2CV5B 1P3KB 4LD9A 4DRBA 2IO5C 5B0YA 1P3FC 1TAFB 5AVBA 3WTPC 3REIA 5B2IA 3WKJC 3REKA 5B0ZD 3AN2B 3LJAD 3B6GD 2PYOA 3B0BA 3W99D 5B2IC 4JJNA 3RELB 3AZIB 3AV1B 3X1VB 3WAAB 4H9QB 2PYOC 4J8VA 5B31B 3LELB 5B1LD 4AWLC 3C1CB 4JJNC 5BNXB 1P3BC 1P3PA 5AV6D 4Z66C 1P3GA 4XUJA 5E5AB 1BH8A 2L5AA 3O62B 3W98C 3C1BB 5B24C 5CPID 1P3GC 1M18A 3AZHA 3V9RA 1P3FD 3AZJB 3WTPD 3WKJD 2CV5A 1P3KA 1TAFA 5CP6C 5B40C 5DNMC 1P3IB 5B2ID 3AN2A 3NQJA 2CV5C 1P3KC 3W96B 2PYOD 4H9RB 3KXBB 3RELA 3AV1A 3X1VA 3AZIA 2LY8A 1U35B 4JJND 3AN2C 1TZYC 3WAAA 3AZKB 1BH9A 1P3BD 5B31A 3LELA 4Z66D 3C1CA 3RELC 3X1VC 3AZIC 5BNXA 3AZLB 5FUGB 3WAAC 3AV2C 3W98D 3LELC 5B24D 5E5AA 1P3GD 3O62A 1P3AB 3C1BA 5AV8C 4E44A 3VH6W 5CP6D 3AZJA 3AZMC 4QLCB 3C1BC 5B40D 5DNMD 1P3LC 1M1AB 2CV5D 4KGCB 5B32G 5AV5B 1P3IA 3UT9C 2F8NG 5GSUC 1TZYD 3W96A 4H9RA 3KXBA 4DRAA 3AZNB 3RELD 1P34B 3X1VD 3AZID 5GT0B 3W99B 3AZKA 3WAAD 3AV2D 3B0DB 3LELD 1ZLAB 5B1LB 3AZLA 5FUGA 3A6NB 5AV8D 2CWEA 1P3AA 3AZLC 3AZMD 3C1BD 1P3LD 5CPIB 3MVDB 1HTAA 1P3AC 4QLCA 3UTAB 1P3FB 3UT9D 1M1AA 3WTPB 3MNNC 4KGCA 5GSUD 5AV5A 4QLCC 4YS3C 2YFWB 4YM6B 1M1AC 4KGCC 5B2IB 5JRGB 3REJC 5AV5C 3AZNA 1P34A 3W99A 5GT0A 1P3OC 1P3BB 1ZLAA 5DNNC 3AZNC 5B1LA 4Z66B 1P34C 3VH6A 5GT0C 3A6NA 3AZLD 5GXQC 2BYKB 3W98B 1ZLAC 4WNNB 1B6WA 5B24B 1P3AD 3A6NC 1WWIA 3MNND 5CPIA 3MVDA 3UTAA 4H9SC 5CP6B 4QLCD 3AZFD 4YS3D 3WTPA 5B40B 5DNMB 1M1AD 4KGCD 4NE5A 3MVDC 3UTAC 3REJD 5AV5D 2YFWA 4YM6A 3WTPE 5AY8B 1P3OD 5JRGA 4WU9C 3NQJB 1TZYB 3UTBC 5DNND 3AZND 1AOIB 2BYMB 4YM6C 1P34D 4CAYB 5GT0D 3MGPD 1KX4C 5JRGC 1P3BA 1BFMA 5GXQD 3AV2B 1BH9B 3MGSD 4Z66A 1ZLAD 3WA9B 4WZSB 1F66B 4M6BA 3B0CW 3KSYA 3A6ND 2BYKA 3W98A 4WNNA 5AV8B 5B24A 4Z5TB 3VH5A 3AZMB 1P3LB 4ZBJC 3MVDD 5CP6A 3UTAD 5B40A 5DNMA 3UT9B 5B1MB 4KUDB 5GSUB 4WU9D 3UTBD 5AY8A 4ZUXD 4YM6D 2F8NH 2FJ7C 1TZYA 5GT3B 5JRGD 1KX4D 1AOIA 3W97C 2BYMA 4HGAB 4CAYA 3VH6T 5AY8C 4X23B 3AV2A 1AOIC 3MGQB 1F66A 2F8NB 3WA9A 4XZQB 4E45A 3AYWB 1A7WA 4G92C 2NQBA 5AV8A 4H9PB 3WA9C 1F66C 4Z5TA 3AZMA 1JFIB 3KWQA 5B33D 2NQBC 1P3LA 5B31G 3MNNB 4Z5TC 4H9NB 4EO5C 3KWQC 3AZFB 3UT9A 4YS3B 5B1MA 1H3OB 4J8UB 1P3MB 4KUDA 5GSUA 2FJ7D 4Z2MG 5BO0B 3KUYB 4WU8C 3REJB 3W97D 4NFTA 5B1MC 4KUDC 5AY8D 5GT3A 1P3OB 1AOID 5DNNB 1KX5C 5GT3C 4X23A 3MGPB 4R8PA 3MGQA 2F8NA 5GXQB 4HGAC 4XZQA 3MGSB 1F66D 3WA9D 3AYWA 1EQZC 4X23C 3VH5T 4H9PA 4R8PC 2NQBD 3MGQC 2NZDB 4XZQC 4Z5TD 3AYWC 1JFIA 4H9OB 3KWQD 5CHLB 3MNNA 4H9NA 4WU8D 2HIOC 3AZFA 4YS3A 1H3OA 5G49B 4J8UA 1P3MA 5B1MD 4KUDD 5BO0A 3KUYA 2JSSA 5BS7A 3REJA 4WU9B 1S32B 3AZFC 3AZGB 3UTBB 1KX5D 4J8UC 1P3MC 5C3IB 4ZUXB 1P3OA 3KUYC 5GT3D 1KX4B 5BS7C 3LZ1C 5DNNA 1EQZD 3MGPA 1KU5A 4X23D 4J8XB 5GXQA 4R8PD 3MGSA 3MGQD 5KDMB 2F8ND 4XZQD 3AYWD 3MGPC 3R45B 2NZDA 3X1SA 3MGSC 5AVCC 4ZBJB 4H9SA 4H9OA 2HIOD 1KX3B 2NZDC 5B33B 3X1SC 3TU4C 5CPJB 3X1UD 5G49A 4J8UD 3REHC 1P3MD 2AROB 3KUYD 3X1TC 1S32A 4WU9A 2FJ7B 3LZ1D 1N1JB 3UTBA 3AZGA 2HUEC 3W97B 4ZUXA 5B2JC 3NQUB 3AZEC 1KX4A 1S32C 3AZGC 5C3IC 3LZ0B 4ZUXC 4J8XA 4CSRB 5KDMA 4G92B 5AVCD 1HQ3B 4J8XC 3R45A 2NZDD 3X1SD 2NQBB 3TU4D 1KX3A 4NE6A 5CPKA 5B33A 4EO5B 3KWQB 3REHD 5CPJA 3X1TD 1KX3C 4WU8B 4LD9C 5B0YC 5CPKC 5B33C 4UUZB 5AVBC 1ID3A 1F1EA 2AROA 5B2JD 2FJ7A 3REIC 3AZED 5CPJC 4Z2MH 3REKC 1S32D 1N1JA 3W97A 3AZGD 1ID3C 3NQUA 2AROC 1KX5B 5BT1C 5JA4B 3LZ0A 4J8VC 5BNVB 4CSRA 1EQZB 1WWSA 4J8XD 3AFAB 5B32B
chains in the Genus database with same CATH superfamily
4R8PB 4KHAB 1P3PC 3LZ0C 1HQ3A 4XUJC 2RVQC 2ZY5A 1KX3D 1HQ3C 2HIOB 4G91B 1M18C 3B6FB 5B0YD 3AZHC 2Y2PA 5CPKD 5AVBD 5AV9B 4J8WB 4LD9D 3REID 5CPJD 4WU8A 3REKD 4UUZA 3X1UB 1ID3D 4WV4B 2AROD 5BT1D 1M19B 4H9QA 3LZ1B 1KX5A 4J8VD 5JA4A 3AV1C 3H0RC 1ULYA 5B31C 1P3PD 5BNVA 3LZ0D 1EQZA 3AFAA 3C1CC 5B32A 4XUJD 4KHAA 2RVQD 1HQ3D 5E5AC 3AFAC 5AVCB 5B32C 1M18D 3O62C 3MGRB 3AZHD 3X1SB 5F99B 3TU4B 2HIOA 1P3KD 3B6FA 4J8WA 1B67A 5AV9A 3AZJC 3REHB 1Q9CA 3AN2D 3X1TB 5B0ZB 4G91C 3X1UA 3LJAB 3B6GB 3B6FC 4J8WC 5AV9C 2HUEB 1P3IC 1M19A 1U35A 5B2JB 3AV1D 3AZEB 3LZ1A 3W96C 2Y2LA 3X1UC 3KXBC 5B31D 1M19C 3C1CD 1U35C 2G5IC 3AZKC 5AV6B 5E5AD 2W8SA 3AFAD 5B32D 3O62D 5AVCA 3MGRA 2IO5B 3AZJD 2F8NK 5F99A 3TU4A 2YFVB 3WKJB 2DQNC 3MGRC 3B6FD 4LD9B 4J8WD 5AV9D 3VH5W 5B0YB 4NE3A 5AVBB 3REHA 5CPKB 1P3ID 5F99C 3X1TA 5B0ZA 3REIB 3LJAA 3REKB 3B6GA 3W96D 3KXBD 2PYOB 1ID3B 5B2JA 3B0CT 3AZEA 4AWLB 1U35D 1M19D 5B0ZC 4JJNB 3H0MC 3AZKD 3LJAC 3B6GC 3F6TA 4J8VB 3W99C 3B0DC 5AV6A 1P3PB 5B1LC 1P3GB 4XUJB 1BH8B 3P5JB 5AV6C 1R4VA 3MGRD 1P3FA 1M18B 3AZHB 3V9RB 2YFVA 3WKJA 5F99D 5CPIC 2CV5B 1P3KB 2F2AC 4DRBA 2IO5C 5B0YA 1P3FC 1TAFB 5AVBA 4LD9A 3WTPC 3REIA 5B2IA 3WKJC 3REKA 5B0ZD 3AN2B 3LJAD 3B6GD 2PYOA 3B0BA 3W99D 2Y2GA 5B2IC 4JJNA 3RELB 3AZIB 3AV1B 3X1VB 4DQYB 3WAAB 4H9QB 2PYOC 4J8VA 5B31B 3LELB 5B1LD 4AWLC 3C1CB 4JJNC 5BNXB 1P3BC 1P3PA 5AV6D 4Z66C 1P3GA 4XUJA 5E5AB 1BH8A 2L5AA 3O62B 3W98C 3C1BB 5B24C 5CPID 1P3GC 1M18A 3AZHA 3V9RA 1P3FD 3AZJB 3WTPD 3WKJD 2CV5A 1P3KA 1TAFA 5CP6C 5B40C 5DNMC 1P3IB 1T3UA 5B2ID 3AN2A 3NQJA 2CV5C 1P3KC 3W96B 2PYOD 4H9RB 3KXBB 3RELA 3AV1A 3X1VA 3AZIA 2LY8A 1U35B 4JJND 3AN2C 2JCHA 1TZYC 3AZKB 3WAAA 1BH9A 1P3BD 5B31A 3LELA 3EPLA 4Z66D 3C1CA 3RELC 3X1VC 3AZIC 5BNXA 3AZLB 5FUGB 3WAAC 3AV2C 3W98D 3LELC 5B24D 5E5AA 3EPKA 1P3GD 3O62A 1P3AB 2ZY2A 3C1BA 5AV8C 4E44A 3VH6W 5CP6D 3AZJA 3AZMC 4QLCB 3C1BC 5B40D 5DNMD 1P3LC 2VQRA 1M1AB 2CV5D 4KGCB 5B32G 5AV5B 1P3IA 3UT9C 2F8NG 5GSUC 1TZYD 3W96A 4H9RA 3KXBA 4DRAA 3AZNB 3RELD 1P34B 3X1VD 3AZID 5GT0B 3W99B 3AZKA 3WAAD 3AV2D 3B0DB 3LELD 1ZLAB 5B1LB 3AZLA 2RIQA 5FUGA 3A6NB 5AV8D 2CWEA 1P3AA 3AZLC 3AZMD 3C1BD 1P3LD 5CPIB 2XD5A 3MVDB 1HTAA 1P3AC 4QLCA 3UTAB 2Y2QA 1P3FB 3UT9D 1M1AA 3WTPB 3MNNC 4KGCA 5GSUD 5AV5A 4QLCC 4YS3C 2YFWB 2JE5A 4YM6B 1M1AC 2ZM5A 5B2IB 4KGCC 5JRGB 3REJC 5AV5C 3AZNA 1P34A 3W99A 5GT0A 1P3OC 1P3BB 1ZLAA 5DNNC 3AZNC 5B1LA 4Z66B 1P34C 3VH6A 5GT0C 3A6NA 3AZLD 5GXQC 2BYKB 3W98B 1ZLAC 4WNNB 1B6WA 5B24B 1P3AD 3EPHA 3A6NC 1PZRA 2Y2JA 1WWIA 3MNND 5CPIA 3MVDA 3UTAA 4H9SC 5CP6B 4QLCD 3AZFD 4YS3D 3WTPA 3A1KA 5B40B 5DNMB 1M1AD 2DF4C 4KGCD 4NE5A 2J8PA 3MVDC 3UTAC 3REJD 5AV5D 2YFWA 4YM6A 3WTPE 5AY8B 1P3OD 5JRGA 4WU9C 3NQJB 1TZYB 3UTBC 5DNND 3AZND 1AOIB 2BYMB 4YM6C 1P34D 4CAYB 5GT0D 3MGPD 1KX4C 5JRGC 1P3BA 1BFMA 5GXQD 3AV2B 1BH9B 3MGSD 4Z66A 1ZLAD 3WA9B 4WZSB 1F66B 4M6BA 3EPJA 3B0CW 3KSYA 3A6ND 2BYKA 3W98A 4WNNA 5AV8B 5B24A 4Z5TB 3VH5A 3AZMB 1P3LB 4ZBJC 3MVDD 2BG1A 5CP6A 3UTAD 5B40A 5DNMA 3UT9B 5B1MB 4KUDB 5GSUB 4WU9D 3UTBD 5AY8A 4ZUXD 4YM6D 2F8NH 2FJ7C 1TZYA 5GT3B 5JRGD 1KX4D 2ZY4A 1AOIA 3W97C 2BYMA 4HGAB 4CAYA 3VH6T 5AY8C 4X23B 3AV2A 3IP4C 1AOIC 3MGQB 1F66A 2F8NB 3WA9A 4XZQB 4E45A 3AYWB 1A7WA 4G92C 2NQBA 5AV8A 4H9PB 3WA9C 1F66C 4Z5TA 3AZMA 2XD1A 1JFIB 3KWQA 5B33D 2NQBC 1P3LA 5B31G 3MNNB 4Z5TC 4H9NB 3AL0C 4EO5C 3KWQC 3AZFB 3UT9A 4YS3B 5B1MA 1H3OB 4J8UB 1P3MB 4KUDA 5GSUA 2FJ7D 4Z2MG 5BO0B 3KUYB 2UWXA 4WU8C 3REJB 3W97D 4NFTA 5B1MC 4KUDC 5AY8D 5GT3A 1P3OB 1AOID 5DNNB 1KX5C 4UPKA 5GT3C 4X23A 3MGPB 4R8PA 3MGQA 2F8NA 5GXQB 4HGAC 4XZQA 3MGSB 1F66D 3WA9D 3AYWA 1EQZC 4X23C 3VH5T 4H9PA 4R8PC 2NQBD 3MGQC 2NZDB 4XZQC 4Z5TD 3AYWC 1JFIA 2FFFB 4H9OB 3KWQD 5CHLB 3MNNA 4H9NA 4WU8D 2HIOC 3AZFA 4YS3A 1H3OA 5G49B 2Y2NA 1Z2CB 4J8UA 5B1MD 1P3MA 4KUDD 5BO0A 3KUYA 2JSSA 5BS7A 3REJA 4WU9B 1S32B 3AZFC 2Y2IA 3AZGB 3UTBB 1KX5D 4J8UC 1P3MC 5C3IB 4ZUXB 1P3OA 3KUYC 5GT3D 4WJ3C 1KX4B 5BS7C 3LZ1C 5DNNA 1EQZD 2Y2MA 3MGPA 1KU5A 3FDDA 2ZY3A 4X23D 4J8XB 5GXQA 4R8PD 3MGSA 3MGQD 5KDMB 2F8ND 4XZQD 3AYWD 3KFUG 3MGPC 3A1IA 3R45B 2NZDA 3X1SA 3MGSC 4ZBJB 4H9SA 5AVCC 2HIOD 1W2EA 4H9OA 1KX3B 2NZDC 5B33B 3X1SC 3TU4C 5CPJB 3X1UD 5G49A 4J8UD 3REHC 1P3MD 2AROB 3KUYD 3X1TC 1S32A 4WU9A 2FJ7B 3LZ1D 1N1JB 3UTBA 3AZGA 2HUEC 3W97B 4ZUXA 3H0LC 5B2JC 3NQUB 3AZEC 1KX4A 1S32C 3AZGC 5C3IC 3LZ0B 4ZUXC 4J8XA 4CSRB 5KDMA 4G92B 2G5HC 5AVCD 1HQ3B 4J8XC 3R45A 2Y2KA 3EG5B 2NZDD 3X1SD 2NQBB 3TU4D 1KX3A 4NE6A 5CPKA 5B33A 4EO5B 3KWQB 3REHD 5CPJA 3X1TD 1KX3C 4WU8B 4LD9C 5B0YC 5CPKC 5B33C 4UUZB 5AVBC 1ID3A 1F1EA 2AROA 5B2JD 2FJ7A 3REIC 3AZED 5CPJC 4Z2MH 3REKC 1S32D 1N1JA 3W97A 2Y2HA 3AZGD 1ID3C 3NQUA 2AROC 1KX5B 5BT1C 5JA4B 3LZ0A 4J8VC 5BNVB 4CSRA 1EQZB 1WWSA 4J8XD 3AFAB 5B32B 2Y2OA
chains in the Genus database with same CATH topology
4R8PB 4KHAB 1P3PC 3LZ0C 1HQ3A 4XUJC 2RVQC 2ZY5A 1KX3D 1HQ3C 2HIOB 4G91B 1M18C 3B6FB 5B0YD 3AZHC 2Y2PA 5CPKD 5AVBD 5AV9B 4J8WB 4LD9D 3REID 5CPJD 4WU8A 3REKD 4UUZA 3X1UB 1ID3D 4WV4B 2AROD 5BT1D 1M19B 4H9QA 3LZ1B 1KX5A 4J8VD 5JA4A 3AV1C 3H0RC 1ULYA 5B31C 1P3PD 5BNVA 3LZ0D 1EQZA 3AFAA 3C1CC 5B32A 4XUJD 4KHAA 2RVQD 1HQ3D 5E5AC 3AFAC 5AVCB 5B32C 1M18D 3O62C 3MGRB 3AZHD 3X1SB 5F99B 3TU4B 2HIOA 1P3KD 3B6FA 4J8WA 1B67A 5AV9A 3AZJC 3REHB 1Q9CA 3AN2D 3X1TB 5B0ZB 4G91C 3X1UA 3LJAB 3B6GB 3B6FC 4J8WC 5AV9C 2HUEB 1P3IC 1M19A 1U35A 5B2JB 3AV1D 3AZEB 3LZ1A 3W96C 2Y2LA 3X1UC 3KXBC 5B31D 1M19C 3C1CD 1U35C 2G5IC 3AZKC 5AV6B 5E5AD 2W8SA 3AFAD 5B32D 3O62D 5AVCA 3MGRA 2IO5B 3AZJD 2F8NK 5F99A 3TU4A 2YFVB 3WKJB 2DQNC 3MGRC 3B6FD 4LD9B 4J8WD 5AV9D 3VH5W 5B0YB 4NE3A 5AVBB 3REHA 5CPKB 1P3ID 5F99C 3X1TA 5B0ZA 3REIB 3LJAA 3REKB 3B6GA 3W96D 3KXBD 2PYOB 1ID3B 5B2JA 3B0CT 3AZEA 4AWLB 1U35D 1M19D 5B0ZC 4JJNB 3H0MC 3AZKD 3LJAC 3B6GC 3F6TA 4J8VB 3W99C 3B0DC 5AV6A 1P3PB 5B1LC 1P3GB 4XUJB 1BH8B 3P5JB 5AV6C 1R4VA 3MGRD 1P3FA 1M18B 3AZHB 3V9RB 2YFVA 3WKJA 5F99D 5CPIC 2CV5B 1P3KB 2F2AC 4DRBA 2IO5C 5B0YA 1P3FC 1TAFB 5AVBA 4LD9A 3WTPC 3REIA 5B2IA 3WKJC 3REKA 5B0ZD 3AN2B 3LJAD 3B6GD 2PYOA 3B0BA 3W99D 2Y2GA 5B2IC 4JJNA 3RELB 3AZIB 3AV1B 3X1VB 4DQYB 3WAAB 4H9QB 2PYOC 4J8VA 5B31B 3LELB 5B1LD 4AWLC 3C1CB 4JJNC 5BNXB 1P3BC 1P3PA 5AV6D 4Z66C 1P3GA 4XUJA 5E5AB 1BH8A 2L5AA 3O62B 3W98C 3C1BB 5B24C 5CPID 1P3GC 1M18A 3AZHA 3V9RA 1P3FD 3AZJB 3WTPD 3WKJD 2CV5A 1P3KA 1TAFA 5CP6C 5B40C 5DNMC 1P3IB 1T3UA 5B2ID 3AN2A 3NQJA 2CV5C 1P3KC 3W96B 2PYOD 4H9RB 3KXBB 3RELA 3AV1A 3X1VA 3AZIA 2LY8A 1U35B 4JJND 3AN2C 2JCHA 1TZYC 3AZKB 3WAAA 1BH9A 1P3BD 5B31A 3LELA 3EPLA 4Z66D 3C1CA 3RELC 3X1VC 3AZIC 5BNXA 3AZLB 5FUGB 3WAAC 3AV2C 3W98D 3LELC 5B24D 5E5AA 3EPKA 1P3GD 3O62A 1P3AB 2ZY2A 3C1BA 5AV8C 4E44A 3VH6W 5CP6D 3AZJA 3AZMC 4QLCB 3C1BC 5B40D 5DNMD 1P3LC 2VQRA 1M1AB 2CV5D 4KGCB 5B32G 5AV5B 1P3IA 3UT9C 2F8NG 5GSUC 1TZYD 3W96A 4H9RA 3KXBA 4DRAA 3AZNB 3RELD 1P34B 3X1VD 3AZID 5GT0B 3W99B 3AZKA 3WAAD 3AV2D 3B0DB 3LELD 1ZLAB 5B1LB 3AZLA 2RIQA 5FUGA 3A6NB 5AV8D 2CWEA 1P3AA 3AZLC 3AZMD 3C1BD 1P3LD 5CPIB 2XD5A 3MVDB 1HTAA 1P3AC 4QLCA 3UTAB 2Y2QA 1P3FB 3UT9D 1M1AA 3WTPB 3MNNC 4KGCA 5GSUD 5AV5A 4QLCC 4YS3C 2YFWB 2JE5A 4YM6B 1M1AC 2ZM5A 5B2IB 4KGCC 5JRGB 3REJC 5AV5C 3AZNA 1P34A 3W99A 5GT0A 1P3OC 1P3BB 1ZLAA 5DNNC 3AZNC 5B1LA 4Z66B 1P34C 3VH6A 5GT0C 3A6NA 3AZLD 5GXQC 2BYKB 3W98B 1ZLAC 4WNNB 1B6WA 5B24B 1P3AD 3EPHA 3A6NC 1PZRA 2Y2JA 1WWIA 3MNND 5CPIA 3MVDA 3UTAA 4H9SC 5CP6B 4QLCD 3AZFD 4YS3D 3WTPA 3A1KA 5B40B 5DNMB 1M1AD 2DF4C 4KGCD 4NE5A 2J8PA 3MVDC 3UTAC 3REJD 5AV5D 2YFWA 4YM6A 3WTPE 5AY8B 1P3OD 5JRGA 4WU9C 3NQJB 1TZYB 3UTBC 5DNND 3AZND 1AOIB 2BYMB 4YM6C 1P34D 4CAYB 5GT0D 3MGPD 1KX4C 5JRGC 1P3BA 1BFMA 5GXQD 3AV2B 1BH9B 3MGSD 4Z66A 1ZLAD 3WA9B 4WZSB 1F66B 4M6BA 3EPJA 3B0CW 3KSYA 3A6ND 2BYKA 3W98A 4WNNA 5AV8B 5B24A 4Z5TB 3VH5A 3AZMB 1P3LB 4ZBJC 3MVDD 2BG1A 5CP6A 3UTAD 5B40A 5DNMA 3UT9B 5B1MB 4KUDB 5GSUB 4WU9D 3UTBD 5AY8A 4ZUXD 4YM6D 2F8NH 2FJ7C 1TZYA 5GT3B 5JRGD 1KX4D 2ZY4A 1AOIA 3W97C 2BYMA 4HGAB 4CAYA 3VH6T 5AY8C 4X23B 3AV2A 3IP4C 1AOIC 3MGQB 1F66A 2F8NB 3WA9A 4XZQB 4E45A 3AYWB 1A7WA 4G92C 2NQBA 5AV8A 4H9PB 3WA9C 1F66C 4Z5TA 3AZMA 2XD1A 1JFIB 3KWQA 5B33D 2NQBC 1P3LA 5B31G 3MNNB 4Z5TC 4H9NB 3AL0C 4EO5C 3KWQC 3AZFB 3UT9A 4YS3B 5B1MA 1H3OB 4J8UB 1P3MB 4KUDA 5GSUA 2FJ7D 4Z2MG 5BO0B 3KUYB 2UWXA 4WU8C 3REJB 3W97D 4NFTA 5B1MC 4KUDC 5AY8D 5GT3A 1P3OB 1AOID 5DNNB 1KX5C 4UPKA 5GT3C 4X23A 3MGPB 4R8PA 3MGQA 2F8NA 5GXQB 4HGAC 4XZQA 3MGSB 1F66D 3WA9D 3AYWA 1EQZC 4X23C 3VH5T 4H9PA 4R8PC 2NQBD 3MGQC 2NZDB 4XZQC 4Z5TD 3AYWC 1JFIA 2FFFB 4H9OB 3KWQD 5CHLB 3MNNA 4H9NA 4WU8D 2HIOC 3AZFA 4YS3A 1H3OA 5G49B 2Y2NA 1Z2CB 4J8UA 5B1MD 1P3MA 4KUDD 5BO0A 3KUYA 2JSSA 5BS7A 3REJA 4WU9B 1S32B 3AZFC 2Y2IA 3AZGB 3UTBB 1KX5D 4J8UC 1P3MC 5C3IB 4ZUXB 1P3OA 3KUYC 5GT3D 4WJ3C 1KX4B 5BS7C 3LZ1C 5DNNA 1EQZD 2Y2MA 3MGPA 1KU5A 3FDDA 2ZY3A 4X23D 4J8XB 5GXQA 4R8PD 3MGSA 3MGQD 5KDMB 2F8ND 4XZQD 3AYWD 3KFUG 3MGPC 3A1IA 3R45B 2NZDA 3X1SA 3MGSC 4ZBJB 4H9SA 5AVCC 2HIOD 1W2EA 4H9OA 1KX3B 2NZDC 5B33B 3X1SC 3TU4C 5CPJB 3X1UD 5G49A 4J8UD 3REHC 1P3MD 2AROB 3KUYD 3X1TC 1S32A 4WU9A 2FJ7B 3LZ1D 1N1JB 3UTBA 3AZGA 2HUEC 3W97B 4ZUXA 3H0LC 5B2JC 3NQUB 3AZEC 1KX4A 1S32C 3AZGC 5C3IC 3LZ0B 4ZUXC 4J8XA 4CSRB 5KDMA 4G92B 2G5HC 5AVCD 1HQ3B 4J8XC 3R45A 2Y2KA 3EG5B 2NZDD 3X1SD 2NQBB 3TU4D 1KX3A 4NE6A 5CPKA 5B33A 4EO5B 3KWQB 3REHD 5CPJA 3X1TD 1KX3C 4WU8B 4LD9C 5B0YC 5CPKC 5B33C 4UUZB 5AVBC 1ID3A 1F1EA 2AROA 5B2JD 2FJ7A 3REIC 3AZED 5CPJC 4Z2MH 3REKC 1S32D 1N1JA 3W97A 2Y2HA 3AZGD 1ID3C 3NQUA 2AROC 1KX5B 5BT1C 5JA4B 3LZ0A 4J8VC 5BNVB 4CSRA 1EQZB 1WWSA 4J8XD 3AFAB 5B32B 2Y2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P B;  4KHA B;  1P3P C;  3LZ0 C;  1HQ3 A;  4XUJ C;  2RVQ C;  1KX3 D;  1HQ3 C;  2HIO B;  4G91 B;  1M18 C;  3B6F B;  5B0Y D;  3AZH C;  5CPK D;  4LD9 D;  5AVB D;  5AV9 B;  4J8W B;  3REI D;  5CPJ D;  4WU8 A;  3REK D;  4UUZ A;  3X1U B;  1ID3 D;  4WV4 B;  2ARO D;  5BT1 D;  1M19 B;  4H9Q A;  3LZ1 B;  1KX5 A;  4J8V D;  5JA4 A;  3AV1 C;  1ULY A;  5B31 C;  1P3P D;  5BNV A;  3LZ0 D;  1EQZ A;  3AFA A;  3C1C C;  5B32 A;  4XUJ D;  4KHA A;  2RVQ D;  1HQ3 D;  5E5A C;  3AFA C;  5AVC B;  5B32 C;  1M18 D;  3O62 C;  3MGR B;  3AZH D;  3X1S B;  5F99 B;  3TU4 B;  2HIO A;  1P3K D;  3B6F A;  4J8W A;  1B67 A;  5AV9 A;  3AZJ C;  3REH B;  1Q9C A;  3AN2 D;  3X1T B;  5B0Z B;  4G91 C;  3X1U A;  3LJA B;  3B6G B;  3B6F C;  4J8W C;  5AV9 C;  2HUE B;  1P3I C;  1M19 A;  1U35 A;  5B2J B;  3AV1 D;  3AZE B;  3LZ1 A;  3W96 C;  3X1U C;  3KXB C;  5B31 D;  1M19 C;  3C1C D;  1U35 C;  3AZK C;  5AV6 B;  5E5A D;  3AFA D;  5B32 D;  3O62 D;  5AVC A;  3MGR A;  2IO5 B;  3AZJ D;  2F8N K;  5F99 A;  3TU4 A;  2YFV B;  3WKJ B;  3B6F D;  3MGR C;  4LD9 B;  4J8W D;  5AV9 D;  3VH5 W;  5B0Y B;  4NE3 A;  5AVB B;  3REH A;  5CPK B;  1P3I D;  5F99 C;  3X1T A;  5B0Z A;  3REI B;  3LJA A;  3REK B;  3B6G A;  3W96 D;  3KXB D;  2PYO B;  1ID3 B;  5B2J A;  3B0C T;  3AZE A;  4AWL B;  1U35 D;  1M19 D;  5B0Z C;  4JJN B;  3AZK D;  3LJA C;  3B6G C;  4J8V B;  3W99 C;  3B0D C;  5AV6 A;  1P3P B;  5B1L C;  1P3G B;  4XUJ B;  1BH8 B;  5AV6 C;  1R4V A;  3MGR D;  1P3F A;  1M18 B;  3AZH B;  3V9R B;  2YFV A;  3WKJ A;  5F99 D;  5CPI C;  2CV5 B;  1P3K B;  4LD9 A;  4DRB A;  2IO5 C;  5B0Y A;  1P3F C;  1TAF B;  5AVB A;  3WTP C;  3REI A;  5B2I A;  3WKJ C;  3REK A;  5B0Z D;  3AN2 B;  3LJA D;  3B6G D;  2PYO A;  3B0B A;  3W99 D;  5B2I C;  4JJN A;  3REL B;  3AZI B;  3AV1 B;  3X1V B;  3WAA B;  4H9Q B;  2PYO C;  4J8V A;  5B31 B;  3LEL B;  5B1L D;  4AWL C;  3C1C B;  4JJN C;  5BNX B;  1P3B C;  1P3P A;  5AV6 D;  4Z66 C;  1P3G A;  4XUJ A;  5E5A B;  1BH8 A;  2L5A A;  3O62 B;  3W98 C;  3C1B B;  5B24 C;  5CPI D;  1P3G C;  1M18 A;  3AZH A;  3V9R A;  1P3F D;  3AZJ B;  3WTP D;  3WKJ D;  2CV5 A;  1P3K A;  1TAF A;  5CP6 C;  5B40 C;  5DNM C;  1P3I B;  5B2I D;  3AN2 A;  3NQJ A;  2CV5 C;  1P3K C;  3W96 B;  2PYO D;  4H9R B;  3KXB B;  3REL A;  3AV1 A;  3X1V A;  3AZI A;  2LY8 A;  1U35 B;  4JJN D;  3AN2 C;  1TZY C;  3WAA A;  3AZK B;  1BH9 A;  1P3B D;  5B31 A;  3LEL A;  4Z66 D;  3C1C A;  3REL C;  3X1V C;  3AZI C;  5BNX A;  3AZL B;  5FUG B;  3WAA C;  3AV2 C;  3W98 D;  3LEL C;  5B24 D;  5E5A A;  1P3G D;  3O62 A;  1P3A B;  3C1B A;  5AV8 C;  4E44 A;  3VH6 W;  5CP6 D;  3AZJ A;  3AZM C;  4QLC B;  3C1B C;  5B40 D;  5DNM D;  1P3L C;  1M1A B;  2CV5 D;  4KGC B;  5B32 G;  5AV5 B;  1P3I A;  3UT9 C;  2F8N G;  5GSU C;  1TZY D;  3W96 A;  4H9R A;  3KXB A;  4DRA A;  3AZN B;  3REL D;  1P34 B;  3X1V D;  3AZI D;  5GT0 B;  3W99 B;  3AZK A;  3WAA D;  3AV2 D;  3B0D B;  3LEL D;  1ZLA B;  5B1L B;  3AZL A;  5FUG A;  3A6N B;  5AV8 D;  2CWE A;  1P3A A;  3AZL C;  3AZM D;  3C1B D;  1P3L D;  5CPI B;  3MVD B;  1HTA A;  1P3A C;  4QLC A;  3UTA B;  1P3F B;  3UT9 D;  1M1A A;  3WTP B;  3MNN C;  4KGC A;  5GSU D;  5AV5 A;  4QLC C;  4YS3 C;  2YFW B;  4YM6 B;  1M1A C;  4KGC C;  5B2I B;  5JRG B;  3REJ C;  5AV5 C;  3AZN A;  1P34 A;  3W99 A;  5GT0 A;  1P3O C;  1P3B B;  1ZLA A;  5DNN C;  3AZN C;  5B1L A;  4Z66 B;  1P34 C;  3VH6 A;  5GT0 C;  3A6N A;  3AZL D;  5GXQ C;  2BYK B;  3W98 B;  1ZLA C;  4WNN B;  1B6W A;  5B24 B;  1P3A D;  3A6N C;  1WWI A;  3MNN D;  5CPI A;  3MVD A;  3UTA A;  4H9S C;  5CP6 B;  4QLC D;  3AZF D;  4YS3 D;  3WTP A;  5B40 B;  5DNM B;  1M1A D;  4KGC D;  4NE5 A;  3MVD C;  3UTA C;  3REJ D;  5AV5 D;  2YFW A;  4YM6 A;  3WTP E;  5AY8 B;  1P3O D;  5JRG A;  4WU9 C;  3NQJ B;  1TZY B;  3UTB C;  5DNN D;  3AZN D;  1AOI B;  2BYM B;  4YM6 C;  1P34 D;  4CAY B;  5GT0 D;  3MGP D;  1KX4 C;  5JRG C;  1P3B A;  1BFM A;  5GXQ D;  3AV2 B;  1BH9 B;  3MGS D;  4Z66 A;  1ZLA D;  3WA9 B;  4WZS B;  1F66 B;  4M6B A;  3B0C W;  3KSY A;  3A6N D;  2BYK A;  3W98 A;  4WNN A;  5AV8 B;  5B24 A;  4Z5T B;  3VH5 A;  3AZM B;  1P3L B;  4ZBJ C;  3MVD D;  5CP6 A;  3UTA D;  5B40 A;  5DNM A;  3UT9 B;  5B1M B;  4KUD B;  5GSU B;  4WU9 D;  3UTB D;  5AY8 A;  4ZUX D;  4YM6 D;  2F8N H;  2FJ7 C;  1TZY A;  5GT3 B;  5JRG D;  1KX4 D;  1AOI A;  3W97 C;  2BYM A;  4HGA B;  4CAY A;  3VH6 T;  5AY8 C;  4X23 B;  3AV2 A;  1AOI C;  3MGQ B;  1F66 A;  2F8N B;  3WA9 A;  4XZQ B;  4E45 A;  3AYW B;  1A7W A;  4G92 C;  2NQB A;  5AV8 A;  4H9P B;  3WA9 C;  1F66 C;  4Z5T A;  3AZM A;  1JFI B;  3KWQ A;  5B33 D;  2NQB C;  1P3L A;  5B31 G;  3MNN B;  4Z5T C;  4H9N B;  4EO5 C;  3KWQ C;  3AZF B;  3UT9 A;  4YS3 B;  5B1M A;  1H3O B;  4J8U B;  1P3M B;  4KUD A;  5GSU A;  2FJ7 D;  4Z2M G;  5BO0 B;  3KUY B;  4WU8 C;  3REJ B;  3W97 D;  4NFT A;  5B1M C;  4KUD C;  5AY8 D;  5GT3 A;  1P3O B;  1AOI D;  5DNN B;  1KX5 C;  5GT3 C;  4X23 A;  3MGP B;  4R8P A;  3MGQ A;  2F8N A;  5GXQ B;  4HGA C;  4XZQ A;  3MGS B;  1F66 D;  3WA9 D;  3AYW A;  1EQZ C;  4X23 C;  3VH5 T;  4H9P A;  4R8P C;  2NQB D;  3MGQ C;  2NZD B;  4XZQ C;  4Z5T D;  3AYW C;  1JFI A;  4H9O B;  3KWQ D;  5CHL B;  3MNN A;  4H9N A;  4WU8 D;  2HIO C;  3AZF A;  4YS3 A;  1H3O A;  5G49 B;  4J8U A;  1P3M A;  5B1M D;  4KUD D;  5BO0 A;  3KUY A;  2JSS A;  5BS7 A;  3REJ A;  4WU9 B;  1S32 B;  3AZF C;  3AZG B;  3UTB B;  1KX5 D;  4J8U C;  1P3M C;  5C3I B;  4ZUX B;  1P3O A;  3KUY C;  5GT3 D;  1KX4 B;  5BS7 C;  3LZ1 C;  5DNN A;  1EQZ D;  3MGP A;  1KU5 A;  4X23 D;  4J8X B;  5GXQ A;  4R8P D;  3MGS A;  3MGQ D;  5KDM B;  2F8N D;  4XZQ D;  3AYW D;  3MGP C;  3R45 B;  2NZD A;  3X1S A;  3MGS C;  5AVC C;  4ZBJ B;  4H9S A;  4H9O A;  2HIO D;  1KX3 B;  2NZD C;  5B33 B;  3X1S C;  3TU4 C;  5CPJ B;  3X1U D;  5G49 A;  4J8U D;  3REH C;  1P3M D;  2ARO B;  3KUY D;  3X1T C;  1S32 A;  4WU9 A;  2FJ7 B;  3LZ1 D;  1N1J B;  3UTB A;  3AZG A;  2HUE C;  3W97 B;  4ZUX A;  5B2J C;  3NQU B;  3AZE C;  1KX4 A;  1S32 C;  3AZG C;  5C3I C;  3LZ0 B;  4ZUX C;  4J8X A;  4CSR B;  5KDM A;  4G92 B;  5AVC D;  1HQ3 B;  4J8X C;  3R45 A;  2NZD D;  3X1S D;  2NQB B;  3TU4 D;  1KX3 A;  4NE6 A;  5CPK A;  5B33 A;  4EO5 B;  3KWQ B;  3REH D;  5CPJ A;  3X1T D;  1KX3 C;  4WU8 B;  4LD9 C;  5B0Y C;  5CPK C;  5B33 C;  4UUZ B;  5AVB C;  1ID3 A;  1F1E A;  2ARO A;  5B2J D;  2FJ7 A;  3REI C;  3AZE D;  5CPJ C;  4Z2M H;  3REK C;  1S32 D;  1N1J A;  3W97 A;  3AZG D;  1ID3 C;  3NQU A;  2ARO C;  1KX5 B;  5BT1 C;  5JA4 B;  3LZ0 A;  4J8V C;  5BNV B;  4CSR A;  1EQZ B;  1WWS A;  4J8X D;  3AFA B;  5B32 B; 
#chains in the Genus database with same CATH topology
 4R8P B;  4KHA B;  1P3P C;  3LZ0 C;  1HQ3 A;  4XUJ C;  2RVQ C;  2ZY5 A;  1KX3 D;  1HQ3 C;  2HIO B;  4G91 B;  1M18 C;  3B6F B;  5B0Y D;  3AZH C;  2Y2P A;  5CPK D;  5AVB D;  5AV9 B;  4J8W B;  4LD9 D;  3REI D;  5CPJ D;  4WU8 A;  3REK D;  4UUZ A;  3X1U B;  1ID3 D;  4WV4 B;  2ARO D;  5BT1 D;  1M19 B;  4H9Q A;  3LZ1 B;  1KX5 A;  4J8V D;  5JA4 A;  3AV1 C;  3H0R C;  1ULY A;  5B31 C;  1P3P D;  5BNV A;  3LZ0 D;  1EQZ A;  3AFA A;  3C1C C;  5B32 A;  4XUJ D;  4KHA A;  2RVQ D;  1HQ3 D;  5E5A C;  3AFA C;  5AVC B;  5B32 C;  1M18 D;  3O62 C;  3MGR B;  3AZH D;  3X1S B;  5F99 B;  3TU4 B;  2HIO A;  1P3K D;  3B6F A;  4J8W A;  1B67 A;  5AV9 A;  3AZJ C;  3REH B;  1Q9C A;  3AN2 D;  3X1T B;  5B0Z B;  4G91 C;  3X1U A;  3LJA B;  3B6G B;  3B6F C;  4J8W C;  5AV9 C;  2HUE B;  1P3I C;  1M19 A;  1U35 A;  5B2J B;  3AV1 D;  3AZE B;  3LZ1 A;  3W96 C;  2Y2L A;  3X1U C;  3KXB C;  5B31 D;  1M19 C;  3C1C D;  1U35 C;  2G5I C;  3AZK C;  5AV6 B;  5E5A D;  2W8S A;  3AFA D;  5B32 D;  3O62 D;  5AVC A;  3MGR A;  2IO5 B;  3AZJ D;  2F8N K;  5F99 A;  3TU4 A;  2YFV B;  3WKJ B;  2DQN C;  3MGR C;  3B6F D;  4LD9 B;  4J8W D;  5AV9 D;  3VH5 W;  5B0Y B;  4NE3 A;  5AVB B;  3REH A;  5CPK B;  1P3I D;  5F99 C;  3X1T A;  5B0Z A;  3REI B;  3LJA A;  3REK B;  3B6G A;  3W96 D;  3KXB D;  2PYO B;  1ID3 B;  5B2J A;  3B0C T;  3AZE A;  4AWL B;  1U35 D;  1M19 D;  5B0Z C;  4JJN B;  3H0M C;  3AZK D;  3LJA C;  3B6G C;  3F6T A;  4J8V B;  3W99 C;  3B0D C;  5AV6 A;  1P3P B;  5B1L C;  1P3G B;  4XUJ B;  1BH8 B;  3P5J B;  5AV6 C;  1R4V A;  3MGR D;  1P3F A;  1M18 B;  3AZH B;  3V9R B;  2YFV A;  3WKJ A;  5F99 D;  5CPI C;  2CV5 B;  1P3K B;  2F2A C;  4DRB A;  2IO5 C;  5B0Y A;  1P3F C;  1TAF B;  5AVB A;  4LD9 A;  3WTP C;  3REI A;  5B2I A;  3WKJ C;  3REK A;  5B0Z D;  3AN2 B;  3LJA D;  3B6G D;  2PYO A;  3B0B A;  3W99 D;  2Y2G A;  5B2I C;  4JJN A;  3REL B;  3AZI B;  3AV1 B;  3X1V B;  4DQY B;  3WAA B;  4H9Q B;  2PYO C;  4J8V A;  5B31 B;  3LEL B;  5B1L D;  4AWL C;  3C1C B;  4JJN C;  5BNX B;  1P3B C;  1P3P A;  5AV6 D;  4Z66 C;  1P3G A;  4XUJ A;  5E5A B;  1BH8 A;  2L5A A;  3O62 B;  3W98 C;  3C1B B;  5B24 C;  5CPI D;  1P3G C;  1M18 A;  3AZH A;  3V9R A;  1P3F D;  3AZJ B;  3WTP D;  3WKJ D;  2CV5 A;  1P3K A;  1TAF A;  5CP6 C;  5B40 C;  5DNM C;  1P3I B;  1T3U A;  5B2I D;  3AN2 A;  3NQJ A;  2CV5 C;  1P3K C;  3W96 B;  2PYO D;  4H9R B;  3KXB B;  3REL A;  3AV1 A;  3X1V A;  3AZI A;  2LY8 A;  1U35 B;  4JJN D;  3AN2 C;  2JCH A;  1TZY C;  3AZK B;  3WAA A;  1BH9 A;  1P3B D;  5B31 A;  3LEL A;  3EPL A;  4Z66 D;  3C1C A;  3REL C;  3X1V C;  3AZI C;  5BNX A;  3AZL B;  5FUG B;  3WAA C;  3AV2 C;  3W98 D;  3LEL C;  5B24 D;  5E5A A;  3EPK A;  1P3G D;  3O62 A;  1P3A B;  2ZY2 A;  3C1B A;  5AV8 C;  4E44 A;  3VH6 W;  5CP6 D;  3AZJ A;  3AZM C;  4QLC B;  3C1B C;  5B40 D;  5DNM D;  1P3L C;  2VQR A;  1M1A B;  2CV5 D;  4KGC B;  5B32 G;  5AV5 B;  1P3I A;  3UT9 C;  2F8N G;  5GSU C;  1TZY D;  3W96 A;  4H9R A;  3KXB A;  4DRA A;  3AZN B;  3REL D;  1P34 B;  3X1V D;  3AZI D;  5GT0 B;  3W99 B;  3AZK A;  3WAA D;  3AV2 D;  3B0D B;  3LEL D;  1ZLA B;  5B1L B;  3AZL A;  2RIQ A;  5FUG A;  3A6N B;  5AV8 D;  2CWE A;  1P3A A;  3AZL C;  3AZM D;  3C1B D;  1P3L D;  5CPI B;  2XD5 A;  3MVD B;  1HTA A;  1P3A C;  4QLC A;  3UTA B;  2Y2Q A;  1P3F B;  3UT9 D;  1M1A A;  3WTP B;  3MNN C;  4KGC A;  5GSU D;  5AV5 A;  4QLC C;  4YS3 C;  2YFW B;  2JE5 A;  4YM6 B;  1M1A C;  2ZM5 A;  5B2I B;  4KGC C;  5JRG B;  3REJ C;  5AV5 C;  3AZN A;  1P34 A;  3W99 A;  5GT0 A;  1P3O C;  1P3B B;  1ZLA A;  5DNN C;  3AZN C;  5B1L A;  4Z66 B;  1P34 C;  3VH6 A;  5GT0 C;  3A6N A;  3AZL D;  5GXQ C;  2BYK B;  3W98 B;  1ZLA C;  4WNN B;  1B6W A;  5B24 B;  1P3A D;  3EPH A;  3A6N C;  1PZR A;  2Y2J A;  1WWI A;  3MNN D;  5CPI A;  3MVD A;  3UTA A;  4H9S C;  5CP6 B;  4QLC D;  3AZF D;  4YS3 D;  3WTP A;  3A1K A;  5B40 B;  5DNM B;  1M1A D;  2DF4 C;  4KGC D;  4NE5 A;  2J8P A;  3MVD C;  3UTA C;  3REJ D;  5AV5 D;  2YFW A;  4YM6 A;  3WTP E;  5AY8 B;  1P3O D;  5JRG A;  4WU9 C;  3NQJ B;  1TZY B;  3UTB C;  5DNN D;  3AZN D;  1AOI B;  2BYM B;  4YM6 C;  1P34 D;  4CAY B;  5GT0 D;  3MGP D;  1KX4 C;  5JRG C;  1P3B A;  1BFM A;  5GXQ D;  3AV2 B;  1BH9 B;  3MGS D;  4Z66 A;  1ZLA D;  3WA9 B;  4WZS B;  1F66 B;  4M6B A;  3EPJ A;  3B0C W;  3KSY A;  3A6N D;  2BYK A;  3W98 A;  4WNN A;  5AV8 B;  5B24 A;  4Z5T B;  3VH5 A;  3AZM B;  1P3L B;  4ZBJ C;  3MVD D;  2BG1 A;  5CP6 A;  3UTA D;  5B40 A;  5DNM A;  3UT9 B;  5B1M B;  4KUD B;  5GSU B;  4WU9 D;  3UTB D;  5AY8 A;  4ZUX D;  4YM6 D;  2F8N H;  2FJ7 C;  1TZY A;  5GT3 B;  5JRG D;  1KX4 D;  2ZY4 A;  1AOI A;  3W97 C;  2BYM A;  4HGA B;  4CAY A;  3VH6 T;  5AY8 C;  4X23 B;  3AV2 A;  3IP4 C;  1AOI C;  3MGQ B;  1F66 A;  2F8N B;  3WA9 A;  4XZQ B;  4E45 A;  3AYW B;  1A7W A;  4G92 C;  2NQB A;  5AV8 A;  4H9P B;  3WA9 C;  1F66 C;  4Z5T A;  3AZM A;  2XD1 A;  1JFI B;  3KWQ A;  5B33 D;  2NQB C;  1P3L A;  5B31 G;  3MNN B;  4Z5T C;  4H9N B;  3AL0 C;  4EO5 C;  3KWQ C;  3AZF B;  3UT9 A;  4YS3 B;  5B1M A;  1H3O B;  4J8U B;  1P3M B;  4KUD A;  5GSU A;  2FJ7 D;  4Z2M G;  5BO0 B;  3KUY B;  2UWX A;  4WU8 C;  3REJ B;  3W97 D;  4NFT A;  5B1M C;  4KUD C;  5AY8 D;  5GT3 A;  1P3O B;  1AOI D;  5DNN B;  1KX5 C;  4UPK A;  5GT3 C;  4X23 A;  3MGP B;  4R8P A;  3MGQ A;  2F8N A;  5GXQ B;  4HGA C;  4XZQ A;  3MGS B;  1F66 D;  3WA9 D;  3AYW A;  1EQZ C;  4X23 C;  3VH5 T;  4H9P A;  4R8P C;  2NQB D;  3MGQ C;  2NZD B;  4XZQ C;  4Z5T D;  3AYW C;  1JFI A;  2FFF B;  4H9O B;  3KWQ D;  5CHL B;  3MNN A;  4H9N A;  4WU8 D;  2HIO C;  3AZF A;  4YS3 A;  1H3O A;  5G49 B;  2Y2N A;  1Z2C B;  4J8U A;  5B1M D;  1P3M A;  4KUD D;  5BO0 A;  3KUY A;  2JSS A;  5BS7 A;  3REJ A;  4WU9 B;  1S32 B;  3AZF C;  2Y2I A;  3AZG B;  3UTB B;  1KX5 D;  4J8U C;  1P3M C;  5C3I B;  4ZUX B;  1P3O A;  3KUY C;  5GT3 D;  4WJ3 C;  1KX4 B;  5BS7 C;  3LZ1 C;  5DNN A;  1EQZ D;  2Y2M A;  3MGP A;  1KU5 A;  3FDD A;  2ZY3 A;  4X23 D;  4J8X B;  5GXQ A;  4R8P D;  3MGS A;  3MGQ D;  5KDM B;  2F8N D;  4XZQ D;  3AYW D;  3KFU G;  3MGP C;  3A1I A;  3R45 B;  2NZD A;  3X1S A;  3MGS C;  4ZBJ B;  4H9S A;  5AVC C;  2HIO D;  1W2E A;  4H9O A;  1KX3 B;  2NZD C;  5B33 B;  3X1S C;  3TU4 C;  5CPJ B;  3X1U D;  5G49 A;  4J8U D;  3REH C;  1P3M D;  2ARO B;  3KUY D;  3X1T C;  1S32 A;  4WU9 A;  2FJ7 B;  3LZ1 D;  1N1J B;  3UTB A;  3AZG A;  2HUE C;  3W97 B;  4ZUX A;  3H0L C;  5B2J C;  3NQU B;  3AZE C;  1KX4 A;  1S32 C;  3AZG C;  5C3I C;  3LZ0 B;  4ZUX C;  4J8X A;  4CSR B;  5KDM A;  4G92 B;  2G5H C;  5AVC D;  1HQ3 B;  4J8X C;  3R45 A;  2Y2K A;  3EG5 B;  2NZD D;  3X1S D;  2NQB B;  3TU4 D;  1KX3 A;  4NE6 A;  5CPK A;  5B33 A;  4EO5 B;  3KWQ B;  3REH D;  5CPJ A;  3X1T D;  1KX3 C;  4WU8 B;  4LD9 C;  5B0Y C;  5CPK C;  5B33 C;  4UUZ B;  5AVB C;  1ID3 A;  1F1E A;  2ARO A;  5B2J D;  2FJ7 A;  3REI C;  3AZE D;  5CPJ C;  4Z2M H;  3REK C;  1S32 D;  1N1J A;  3W97 A;  2Y2H A;  3AZG D;  1ID3 C;  3NQU A;  2ARO C;  1KX5 B;  5BT1 C;  5JA4 B;  3LZ0 A;  4J8V C;  5BNV B;  4CSR A;  1EQZ B;  1WWS A;  4J8X D;  3AFA B;  5B32 B;  2Y2O A; 
#chains in the Genus database with same CATH homology
 4R8P B;  4KHA B;  1P3P C;  3LZ0 C;  1HQ3 A;  4XUJ C;  2RVQ C;  2ZY5 A;  1KX3 D;  1HQ3 C;  2HIO B;  4G91 B;  1M18 C;  3B6F B;  5B0Y D;  3AZH C;  2Y2P A;  5CPK D;  5AVB D;  5AV9 B;  4J8W B;  4LD9 D;  3REI D;  5CPJ D;  4WU8 A;  3REK D;  4UUZ A;  3X1U B;  1ID3 D;  4WV4 B;  2ARO D;  5BT1 D;  1M19 B;  4H9Q A;  3LZ1 B;  1KX5 A;  4J8V D;  5JA4 A;  3AV1 C;  3H0R C;  1ULY A;  5B31 C;  1P3P D;  5BNV A;  3LZ0 D;  1EQZ A;  3AFA A;  3C1C C;  5B32 A;  4XUJ D;  4KHA A;  2RVQ D;  1HQ3 D;  5E5A C;  3AFA C;  5AVC B;  5B32 C;  1M18 D;  3O62 C;  3MGR B;  3AZH D;  3X1S B;  5F99 B;  3TU4 B;  2HIO A;  1P3K D;  3B6F A;  4J8W A;  1B67 A;  5AV9 A;  3AZJ C;  3REH B;  1Q9C A;  3AN2 D;  3X1T B;  5B0Z B;  4G91 C;  3X1U A;  3LJA B;  3B6G B;  3B6F C;  4J8W C;  5AV9 C;  2HUE B;  1P3I C;  1M19 A;  1U35 A;  5B2J B;  3AV1 D;  3AZE B;  3LZ1 A;  3W96 C;  2Y2L A;  3X1U C;  3KXB C;  5B31 D;  1M19 C;  3C1C D;  1U35 C;  2G5I C;  3AZK C;  5AV6 B;  5E5A D;  2W8S A;  3AFA D;  5B32 D;  3O62 D;  5AVC A;  3MGR A;  2IO5 B;  3AZJ D;  2F8N K;  5F99 A;  3TU4 A;  2YFV B;  3WKJ B;  2DQN C;  3MGR C;  3B6F D;  4LD9 B;  4J8W D;  5AV9 D;  3VH5 W;  5B0Y B;  4NE3 A;  5AVB B;  3REH A;  5CPK B;  1P3I D;  5F99 C;  3X1T A;  5B0Z A;  3REI B;  3LJA A;  3REK B;  3B6G A;  3W96 D;  3KXB D;  2PYO B;  1ID3 B;  5B2J A;  3B0C T;  3AZE A;  4AWL B;  1U35 D;  1M19 D;  5B0Z C;  4JJN B;  3H0M C;  3AZK D;  3LJA C;  3B6G C;  3F6T A;  4J8V B;  3W99 C;  3B0D C;  5AV6 A;  1P3P B;  5B1L C;  1P3G B;  4XUJ B;  1BH8 B;  3P5J B;  5AV6 C;  1R4V A;  3MGR D;  1P3F A;  1M18 B;  3AZH B;  3V9R B;  2YFV A;  3WKJ A;  5F99 D;  5CPI C;  2CV5 B;  1P3K B;  2F2A C;  4DRB A;  2IO5 C;  5B0Y A;  1P3F C;  1TAF B;  5AVB A;  4LD9 A;  3WTP C;  3REI A;  5B2I A;  3WKJ C;  3REK A;  5B0Z D;  3AN2 B;  3LJA D;  3B6G D;  2PYO A;  3B0B A;  3W99 D;  2Y2G A;  5B2I C;  4JJN A;  3REL B;  3AZI B;  3AV1 B;  3X1V B;  4DQY B;  3WAA B;  4H9Q B;  2PYO C;  4J8V A;  5B31 B;  3LEL B;  5B1L D;  4AWL C;  3C1C B;  4JJN C;  5BNX B;  1P3B C;  1P3P A;  5AV6 D;  4Z66 C;  1P3G A;  4XUJ A;  5E5A B;  1BH8 A;  2L5A A;  3O62 B;  3W98 C;  3C1B B;  5B24 C;  5CPI D;  1P3G C;  1M18 A;  3AZH A;  3V9R A;  1P3F D;  3AZJ B;  3WTP D;  3WKJ D;  2CV5 A;  1P3K A;  1TAF A;  5CP6 C;  5B40 C;  5DNM C;  1P3I B;  1T3U A;  5B2I D;  3AN2 A;  3NQJ A;  2CV5 C;  1P3K C;  3W96 B;  2PYO D;  4H9R B;  3KXB B;  3REL A;  3AV1 A;  3X1V A;  3AZI A;  2LY8 A;  1U35 B;  4JJN D;  3AN2 C;  2JCH A;  1TZY C;  3AZK B;  3WAA A;  1BH9 A;  1P3B D;  5B31 A;  3LEL A;  3EPL A;  4Z66 D;  3C1C A;  3REL C;  3X1V C;  3AZI C;  5BNX A;  3AZL B;  5FUG B;  3WAA C;  3AV2 C;  3W98 D;  3LEL C;  5B24 D;  5E5A A;  3EPK A;  1P3G D;  3O62 A;  1P3A B;  2ZY2 A;  3C1B A;  5AV8 C;  4E44 A;  3VH6 W;  5CP6 D;  3AZJ A;  3AZM C;  4QLC B;  3C1B C;  5B40 D;  5DNM D;  1P3L C;  2VQR A;  1M1A B;  2CV5 D;  4KGC B;  5B32 G;  5AV5 B;  1P3I A;  3UT9 C;  2F8N G;  5GSU C;  1TZY D;  3W96 A;  4H9R A;  3KXB A;  4DRA A;  3AZN B;  3REL D;  1P34 B;  3X1V D;  3AZI D;  5GT0 B;  3W99 B;  3AZK A;  3WAA D;  3AV2 D;  3B0D B;  3LEL D;  1ZLA B;  5B1L B;  3AZL A;  2RIQ A;  5FUG A;  3A6N B;  5AV8 D;  2CWE A;  1P3A A;  3AZL C;  3AZM D;  3C1B D;  1P3L D;  5CPI B;  2XD5 A;  3MVD B;  1HTA A;  1P3A C;  4QLC A;  3UTA B;  2Y2Q A;  1P3F B;  3UT9 D;  1M1A A;  3WTP B;  3MNN C;  4KGC A;  5GSU D;  5AV5 A;  4QLC C;  4YS3 C;  2YFW B;  2JE5 A;  4YM6 B;  1M1A C;  2ZM5 A;  5B2I B;  4KGC C;  5JRG B;  3REJ C;  5AV5 C;  3AZN A;  1P34 A;  3W99 A;  5GT0 A;  1P3O C;  1P3B B;  1ZLA A;  5DNN C;  3AZN C;  5B1L A;  4Z66 B;  1P34 C;  3VH6 A;  5GT0 C;  3A6N A;  3AZL D;  5GXQ C;  2BYK B;  3W98 B;  1ZLA C;  4WNN B;  1B6W A;  5B24 B;  1P3A D;  3EPH A;  3A6N C;  1PZR A;  2Y2J A;  1WWI A;  3MNN D;  5CPI A;  3MVD A;  3UTA A;  4H9S C;  5CP6 B;  4QLC D;  3AZF D;  4YS3 D;  3WTP A;  3A1K A;  5B40 B;  5DNM B;  1M1A D;  2DF4 C;  4KGC D;  4NE5 A;  2J8P A;  3MVD C;  3UTA C;  3REJ D;  5AV5 D;  2YFW A;  4YM6 A;  3WTP E;  5AY8 B;  1P3O D;  5JRG A;  4WU9 C;  3NQJ B;  1TZY B;  3UTB C;  5DNN D;  3AZN D;  1AOI B;  2BYM B;  4YM6 C;  1P34 D;  4CAY B;  5GT0 D;  3MGP D;  1KX4 C;  5JRG C;  1P3B A;  1BFM A;  5GXQ D;  3AV2 B;  1BH9 B;  3MGS D;  4Z66 A;  1ZLA D;  3WA9 B;  4WZS B;  1F66 B;  4M6B A;  3EPJ A;  3B0C W;  3KSY A;  3A6N D;  2BYK A;  3W98 A;  4WNN A;  5AV8 B;  5B24 A;  4Z5T B;  3VH5 A;  3AZM B;  1P3L B;  4ZBJ C;  3MVD D;  2BG1 A;  5CP6 A;  3UTA D;  5B40 A;  5DNM A;  3UT9 B;  5B1M B;  4KUD B;  5GSU B;  4WU9 D;  3UTB D;  5AY8 A;  4ZUX D;  4YM6 D;  2F8N H;  2FJ7 C;  1TZY A;  5GT3 B;  5JRG D;  1KX4 D;  2ZY4 A;  1AOI A;  3W97 C;  2BYM A;  4HGA B;  4CAY A;  3VH6 T;  5AY8 C;  4X23 B;  3AV2 A;  3IP4 C;  1AOI C;  3MGQ B;  1F66 A;  2F8N B;  3WA9 A;  4XZQ B;  4E45 A;  3AYW B;  1A7W A;  4G92 C;  2NQB A;  5AV8 A;  4H9P B;  3WA9 C;  1F66 C;  4Z5T A;  3AZM A;  2XD1 A;  1JFI B;  3KWQ A;  5B33 D;  2NQB C;  1P3L A;  5B31 G;  3MNN B;  4Z5T C;  4H9N B;  3AL0 C;  4EO5 C;  3KWQ C;  3AZF B;  3UT9 A;  4YS3 B;  5B1M A;  1H3O B;  4J8U B;  1P3M B;  4KUD A;  5GSU A;  2FJ7 D;  4Z2M G;  5BO0 B;  3KUY B;  2UWX A;  4WU8 C;  3REJ B;  3W97 D;  4NFT A;  5B1M C;  4KUD C;  5AY8 D;  5GT3 A;  1P3O B;  1AOI D;  5DNN B;  1KX5 C;  4UPK A;  5GT3 C;  4X23 A;  3MGP B;  4R8P A;  3MGQ A;  2F8N A;  5GXQ B;  4HGA C;  4XZQ A;  3MGS B;  1F66 D;  3WA9 D;  3AYW A;  1EQZ C;  4X23 C;  3VH5 T;  4H9P A;  4R8P C;  2NQB D;  3MGQ C;  2NZD B;  4XZQ C;  4Z5T D;  3AYW C;  1JFI A;  2FFF B;  4H9O B;  3KWQ D;  5CHL B;  3MNN A;  4H9N A;  4WU8 D;  2HIO C;  3AZF A;  4YS3 A;  1H3O A;  5G49 B;  2Y2N A;  1Z2C B;  4J8U A;  5B1M D;  1P3M A;  4KUD D;  5BO0 A;  3KUY A;  2JSS A;  5BS7 A;  3REJ A;  4WU9 B;  1S32 B;  3AZF C;  2Y2I A;  3AZG B;  3UTB B;  1KX5 D;  4J8U C;  1P3M C;  5C3I B;  4ZUX B;  1P3O A;  3KUY C;  5GT3 D;  4WJ3 C;  1KX4 B;  5BS7 C;  3LZ1 C;  5DNN A;  1EQZ D;  2Y2M A;  3MGP A;  1KU5 A;  3FDD A;  2ZY3 A;  4X23 D;  4J8X B;  5GXQ A;  4R8P D;  3MGS A;  3MGQ D;  5KDM B;  2F8N D;  4XZQ D;  3AYW D;  3KFU G;  3MGP C;  3A1I A;  3R45 B;  2NZD A;  3X1S A;  3MGS C;  4ZBJ B;  4H9S A;  5AVC C;  2HIO D;  1W2E A;  4H9O A;  1KX3 B;  2NZD C;  5B33 B;  3X1S C;  3TU4 C;  5CPJ B;  3X1U D;  5G49 A;  4J8U D;  3REH C;  1P3M D;  2ARO B;  3KUY D;  3X1T C;  1S32 A;  4WU9 A;  2FJ7 B;  3LZ1 D;  1N1J B;  3UTB A;  3AZG A;  2HUE C;  3W97 B;  4ZUX A;  3H0L C;  5B2J C;  3NQU B;  3AZE C;  1KX4 A;  1S32 C;  3AZG C;  5C3I C;  3LZ0 B;  4ZUX C;  4J8X A;  4CSR B;  5KDM A;  4G92 B;  2G5H C;  5AVC D;  1HQ3 B;  4J8X C;  3R45 A;  2Y2K A;  3EG5 B;  2NZD D;  3X1S D;  2NQB B;  3TU4 D;  1KX3 A;  4NE6 A;  5CPK A;  5B33 A;  4EO5 B;  3KWQ B;  3REH D;  5CPJ A;  3X1T D;  1KX3 C;  4WU8 B;  4LD9 C;  5B0Y C;  5CPK C;  5B33 C;  4UUZ B;  5AVB C;  1ID3 A;  1F1E A;  2ARO A;  5B2J D;  2FJ7 A;  3REI C;  3AZE D;  5CPJ C;  4Z2M H;  3REK C;  1S32 D;  1N1J A;  3W97 A;  2Y2H A;  3AZG D;  1ID3 C;  3NQU A;  2ARO C;  1KX5 B;  5BT1 C;  5JA4 B;  3LZ0 A;  4J8V C;  5BNV B;  4CSR A;  1EQZ B;  1WWS A;  4J8X D;  3AFA B;  5B32 B;  2Y2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...