3MNNB

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnB00
3REHC 4J8UD 3KWQB 1S32A 1P3GA 3MVDB 5BS7A 4HGAB 5B0YC 3VH5A 3WKJC 1P3OA 3A6ND 5AY8A 1S32B 1P3GB 5B31D 4YS3A 3UT9A 1P3OB 5AVCC 5AY8B 2YFWA 1R4VA 4J8VD 3UT9B 1ID3A 4KGCC 2HUEB 2YFWB 3LELA 3REID 4KUDC 3AZHD 5B40C 5GT3C 5CP6C 1ID3B 4WU8A 1KX3D 3W99C 4YS3D 3AYWD 3LELB 3X1UA 4WU8B 3UTBD 3AZLA 3NQJA 3AZKD 1HTAA 1P3KD 4H9NA 3X1UB 3AZLB 3B0CW 3NQJB 1P3BC 3WA9A 4Z66D 3UTAD 4XUJA 2NQBC 5B2JC 3LJAD 5AV9A 3MGPA 3WA9B 4WU9C 3B6GC 5GSUC 4WNNA 4XUJB 1P3ID 5B32C 5AV9B 3MGPB 5B32G 1TZYD 2HIOA 4WNNB 5CPJA 1P34A 1P3PA 3X1TD 3AZGA 2CV5A 5GT0C 2HIOB 1M19A 5CPJB 5BNXA 1P34B 1P3PB 1P3MB 3AZGB 2CV5B 1Q9CA 3C1CD 1M19B 5BNXB 1HQ3B 1AOIC 3W97A 1TAFA 4NE6A 3LZ0C 3AFAC 1M19D 1P3AA 1F66C 3KXBC 1TAFB 5CPID 3AZIC 2RVQD 3W96D 1KX4C 1U35D 1P3AB 4Z5TD 3AZJD 4R8PC 4H9SA 4X23C 3REJC 3VH5T 3W97D 2F8NA 5CPKB 1M1AA 4LD9C 5B0ZD 2YFVA 2F8NB 5KDMA 5B2IA 4J8XC 1M1AB 3AV2A 5F99A 2YFVB 5BT1C 5KDMB 3B6FA 3TU4D 3AV2B 4CAYA 5F99B 5DNMC 3MGQA 1ZLAC 5AVBC 3B6FB 1BH8A 3MNND 4AWLB 1BFMA 5E5AA 5DNNA 2CWEA 5B2ID 3MGQB 3REHA 3RELA 1P3LD 4JJNC 1BH8B 5B0YA 5E5AB 5DNNB 3KUYD 3RELB 3REHB 5B1LD 3REKD 1B67A 3LZ1D 3AZMD 3X1SD 2FJ7D 5B0YB 3WKJB 3WAAD 5AVCA 5JRGC 1P3FC 3WTPD 1BH9B 4KGCA 5AVCB 4KUDA 3AV1D 2AROD 5GT3A 5CP6A 3W99A 3X1VC 4KGCB 4J8WD 2PYOC 5B1MC 4KUDB 5B40B 1A7WA 5GT3B 5CP6B 3MGRD 3W99B 1EQZC 1H3OA 4E44A 2NZDD 3AZFD 1KX5C 5C3IC 4G92C 1H3OB 3AZND 1P3BA 3C1BD 4H9PA 2NQBA 1N1JB 5B2JA 4ZUXC 3MGSC 1P3BB 5G49A 3KWQD 4WU9A 3B6GA 5B33C 3R45A 5GSUA 3MVDD 4H9PB 2NQBB 4KHAA 5B2JB 5B32A 4QLCC 5G49B 3W98C 1S32D 1P3GD 4WU9B 3B6GB 3R45B 5GSUB 4KHAB 1P3OD 5B32B 5AY8D 3AN2C 5GT0A 3UT9D 2L5AA 5GT0B 3O62C 1ID3D 1AOIA 1WWIA 3LELD 3KSYA 3AZEC 5B24C 5AV5C 5BNVA 4WU8D 1AOIB 1F66A 4J8UC 5AV6C 3LZ0B 5BNVB 3X1UD 3AZIA 3AZLD 3AFAB 1KX4A 1F66B 3A6NC 3KXBB 5B31C 4R8PA 3AZIB 5B31G 5GXQC 4X23A 3REJA 1KX4B 3WA9D 1P3MA 4R8PB 4XUJD 4J8VC 4X23B 3REJB 5AV9D 1HQ3A 3MGPD 3REIC 3AZHC 1M18C 1KX3C 4J8XA 4YS3C 3AYWC 4LD9B 2HIOD 5CPJD 1P34D 1P3PD 1P3MD 3UTBC 3AZGD 2CV5D 4J8XB 3AZKC 5BO0A 1F1EA 2F8NK 1HQ3D 1P3KC 4NE5A 2BYKA 2IO5C 1ZLAA 5AVBA 5BO0B 3B0CT 4DRBA 4H9OB 4Z66C 5DNMB 3UTAC 2BYKB 1ZLAB 5AVBB 3LJAC 4JJNA 5CPKA 4XZQC 1KU5A 1P3IC 4JJNB 1P3AD 4E45A 1TZYC 2LY8A 3X1TC 4WZSB 5JRGA 1P3FA 4ZBJC 5CPKD 5JRGB 1P3FB 3VH6W 5JA4A 3C1CC 3X1VA 2F8ND 2PYOA 5B1MA 1M1AD 5JA4B 1P3FD 1EQZA 3X1VB 3B0DC 2PYOB 5B1MB 1KX5A 3AV2D 5F99D 1EQZB 1WWSA 5CPIC 3WKJA 2RVQC 3W96C 4WV4B 1U35C 1KX5B 3B6FD 5C3IB 3X1VD 4G91C 4Z5TC 4G92B 3AZJC 4ZUXA 3MGSA 3MGQD 1BH9A 3W97C 4YM6C 4CSRA 3B0BA 5E5AD 5DNND 4ZUXB 3MGSB 3REHD 3RELD 4QLCA 1KX5D 3W98A 5B33B 4CSRB 5B0YD 5B40A 5B0ZC 3WKJD 4QLCB 3W98B 5AV8C 3AN2A 4ZUXD 2F8NH 2BYMB 5AVCD 3AN2B 3O62A 3TU4C 4KGCD 1N1JA 4KUDD 3O62B 5B40D 5B24A 5GT3D 5AV5A 5CP6D 3MNNC 3W99D 1P3LC 5B2IC 4J8UA 3AZEB 5B24B 5AV6A 5AV5B 4H9RA 3KUYC 3A6NA 5B1LC 4J8UB 3REKC 5AV6B 3LZ1C 4H9RB 3AZMC 3X1SC 2FJ7C 5GXQA 1P3BD 3WAAC 3A6NB 5B31B 4EO5C 3WTPC 4J8VA 2NQBD 5B2JD 5GXQB 5AV6D 4WU9D 3REIA 3B6GD 3AV1C 5GSUD 3AZHA 4J8VB 2AROC 1M18A 1KX3A 5B32D 4J8WC 3AYWA 3REIB 4H9QA 5GXQD 3AZHB 4DRAA 1M18B 3MGRC 1KX3B 3UTBA 1ULYA 3LZ0A 3AZKA 4YS3B 3AFAA 3AYWB 2NZDC 4H9QB 5GT0D 3AZFC 1P3KA 3KXBA 3UTBB 3AZNC 3AZKB 3C1BC 1M18D 4Z66A 1P3KB 3UTAA 2IO5B 1AOID 3LJAA 3KWQC 4Z66B 3LZ0D 3MVDC 3UTAB 4XZQA 3AFAD 4HGAC 1P3IA 3LJAB 1F66D 1S32C 3KXBD 1P3GC 1TZYA 3AZID 4XZQB 5BS7C 4LD9A 3X1TA 1P3IB 1KX4D 1P3OC 5CHLB 3VH6A 4H9NB 5AY8C 3V9RA 4R8PD 1TZYB 3VH5W 3UT9C 1JFIA 3X1TB 4X23D 3REJD 3NQUA 2HUEC 3V9RB 4XZQD 4ZBJB 3C1CA 1JFIB 1ID3C 4H9OA 5DNMA 3NQUB 3C1CB 3LELC 4LD9D 4WU8C 4UUZA 4J8XD 4NFTA 3B0DB 5CPIA 3X1UC 4UUZB 5BT1D 3AZLC 3W96A 1U35A 4Z5TA 3AZJA 5DNMD 5CPIB 1ZLAD 5AVBD 3W96B 1U35B 2JSSA 4YM6A 3WA9C 4G91B 4Z5TB 3AZJB 4XUJC 4NE3A 4JJND 3W97B 5AV9C 3MGPC 4YM6B 1B6WA 5B0ZA 5AV8A 5B0ZB 2HIOC 5CPJC 1P34C 4YM6D 1P3PC 5AV8B 5JRGD 3AZGC 1P3MC 2CV5C 5FUGA 3TU4A 1M19C 1HQ3C 5FUGB 3TU4B 3MNNA 5AV8D 1P3LA 2PYOD 5B1MD 4Z2MH 3MNNB 5B33A 3KUYA 1P3LB 5B2IB 1EQZD 5B1LA 3REKA 1P3AC 3AZMA 3LZ1A 3X1SA 2FJ7A 4Z2MG 3KUYB 3WAAA 2BYMA 5B1LB 3REKB 4CAYB 3AZMB 3LZ1B 3WTPA 3X1SB 2FJ7B 3MGSD 4H9SC 3WAAB 5CPKC 5B33D 3WTPB 4EO5B 3AV1A 2AROA 3VH6T 4QLCD 3W98D 4J8WA 2F8NG 3AV1B 3WTPE 1M1AC 2AROB 3AZEA 3MGRA 4J8WB 3AN2D 2NZDA 3AZFA 3AV2C 3MGRB 5F99C 3AZNA 3C1BA 2NZDB 3O62D 3AZFB 3B6FC 5B31A 4AWLC 3AZNB 3MGQC 4M6BA 3C1BB 3AZED 3KWQA 5B24D 3RELC 5AV5D 3MVDA 5E5AC 5DNNC
chains in the Genus database with same CATH superfamily
3REHC 4J8UD 3KWQB 1S32A 1P3GA 3MVDB 5BS7A 4HGAB 5B0YC 3VH5A 3WKJC 2W8SA 1P3OA 3A6ND 5AY8A 1S32B 1P3GB 5B31D 4YS3A 3UT9A 1P3OB 5AVCC 5AY8B 2YFWA 1R4VA 4J8VD 3UT9B 1ID3A 4KGCC 3AL0C 2HUEB 2YFWB 3LELA 3REID 4KUDC 3AZHD 5B40C 5GT3C 5CP6C 1ID3B 4WU8A 1KX3D 3W99C 4YS3D 3AYWD 3LELB 3X1UA 4WU8B 3UTBD 3AZLA 3NQJA 3AZKD 1HTAA 1P3KD 4H9NA 3X1UB 3AZLB 3B0CW 3NQJB 1P3BC 3WA9A 4Z66D 3EPKA 4XUJA 3UTAD 2NQBC 5B2JC 3LJAD 3H0RC 5AV9A 3MGPA 3WA9B 4WU9C 3B6GC 4XUJB 5GSUC 4WNNA 1P3ID 5B32C 5AV9B 3MGPB 2ZM5A 5B32G 1TZYD 2HIOA 4WNNB 5CPJA 1P34A 1P3PA 3X1TD 3AZGA 2CV5A 5GT0C 2HIOB 1M19A 5CPJB 5BNXA 1P34B 1P3PB 1P3MB 3AZGB 2CV5B 1Q9CA 3C1CD 2F2AC 1M19B 5BNXB 1HQ3B 1AOIC 3W97A 1TAFA 4NE6A 3LZ0C 3AFAC 1M19D 1P3AA 1F66C 3KXBC 1TAFB 5CPID 3AZIC 2RVQD 3W96D 1KX4C 1U35D 1P3AB 4Z5TD 3AZJD 4R8PC 4H9SA 4X23C 3REJC 3VH5T 3W97D 2F8NA 5CPKB 3KFUG 1M1AA 4LD9C 5B0ZD 2YFVA 2F8NB 5KDMA 5B2IA 4J8XC 1M1AB 3AV2A 5F99A 2YFVB 4WJ3C 5BT1C 5KDMB 3B6FA 3TU4D 3AV2B 4CAYA 5F99B 5DNMC 3MGQA 2Y2QA 1ZLAC 5AVBC 3B6FB 1BH8A 3MNND 4AWLB 1BFMA 5E5AA 5DNNA 2CWEA 5B2ID 3MGQB 3REHA 2ZY2A 3RELA 1P3LD 4JJNC 1BH8B 5B0YA 5E5AB 5DNNB 3KUYD 3RELB 3REHB 5B1LD 3REKD 1B67A 3LZ1D 3AZMD 3X1SD 2FJ7D 3H0LC 5B0YB 3WKJB 3WAAD 5AVCA 5JRGC 1P3FC 3WTPD 3A1KA 1BH9B 4KGCA 5AVCB 4KUDA 3AV1D 2AROD 5GT3A 5CP6A 3W99A 3X1VC 4KGCB 4J8WD 2PYOC 5B1MC 4KUDB 5B40B 1A7WA 5GT3B 5CP6B 3MGRD 3W99B 1EQZC 1H3OA 4E44A 2NZDD 3AZFD 1KX5C 5C3IC 2ZY4A 4G92C 1H3OB 3AZND 1P3BA 3C1BD 4H9PA 2NQBA 1N1JB 5B2JA 4ZUXC 3MGSC 1P3BB 5G49A 3KWQD 4WU9A 3B6GA 5B33C 3R45A 5GSUA 3MVDD 4H9PB 2NQBB 4KHAA 5B2JB 5B32A 4QLCC 5G49B 3W98C 1S32D 1P3GD 4WU9B 3B6GB 3R45B 5GSUB 2Y2HA 4KHAB 1P3OD 5B32B 5AY8D 3AN2C 5GT0A 3UT9D 2L5AA 5GT0B 3O62C 1ID3D 1AOIA 1WWIA 3LELD 3KSYA 3AZEC 5B24C 5AV5C 5BNVA 4WU8D 1AOIB 1PZRA 3EG5B 1F66A 4J8UC 5AV6C 3LZ0B 5BNVB 3X1UD 3EPJA 3AZIA 3AFAB 3AZLD 1KX4A 2Y2OA 1F66B 3A6NC 3KXBB 5B31C 4R8PA 3AZIB 5B31G 5GXQC 4X23A 3REJA 1KX4B 3WA9D 1P3MA 3F6TA 4R8PB 4XUJD 4J8VC 4X23B 3REJB 5AV9D 1HQ3A 3MGPD 2XD1A 3A1IA 3REIC 3AZHC 1M18C 1KX3C 4J8XA 4YS3C 3AYWC 4LD9B 2HIOD 5CPJD 1P34D 2Y2JA 1P3PD 1P3MD 3UTBC 3AZGD 2CV5D 4J8XB 3AZKC 5BO0A 1F1EA 2F8NK 1HQ3D 1P3KC 4NE5A 2BYKA 2IO5C 1ZLAA 5AVBA 5BO0B 3B0CT 4DRBA 2Y2IA 4H9OB 4Z66C 5DNMB 3UTAC 2BYKB 1ZLAB 5AVBB 3LJAC 4JJNA 5CPKA 4XZQC 1KU5A 1P3IC 4JJNB 1P3AD 4E45A 1TZYC 2LY8A 3X1TC 4WZSB 5JRGA 1P3FA 4ZBJC 3IP4C 5CPKD 5JRGB 1P3FB 3VH6W 5JA4A 3C1CC 3X1VA 2F8ND 2PYOA 5B1MA 1M1AD 5JA4B 1P3FD 1EQZA 3X1VB 3B0DC 2PYOB 5B1MB 2RIQA 2Y2LA 1KX5A 3AV2D 5F99D 3FDDA 1EQZB 1WWSA 5CPIC 2JE5A 3WKJA 2RVQC 3W96C 4WV4B 1U35C 1KX5B 3B6FD 5C3IB 3X1VD 4G91C 4Z5TC 4G92B 3AZJC 4ZUXA 3MGSA 3MGQD 1BH9A 3W97C 4YM6C 4CSRA 2DF4C 3B0BA 5E5AD 5DNND 4ZUXB 3MGSB 3REHD 3RELD 4QLCA 1KX5D 3W98A 1Z2CB 5B33B 2VQRA 4CSRB 5B0YD 5B40A 5B0ZC 3WKJD 4QLCB 3W98B 5AV8C 3AN2A 4DQYB 2BG1A 4ZUXD 2F8NH 2BYMB 5AVCD 3AN2B 3O62A 3TU4C 4KGCD 1N1JA 4KUDD 3O62B 5B40D 5B24A 5GT3D 5AV5A 5CP6D 3MNNC 3W99D 1P3LC 5B2IC 4J8UA 3AZEB 5B24B 5AV6A 5AV5B 4H9RA 2ZY5A 3KUYC 3A6NA 5B1LC 4J8UB 3REKC 5AV6B 3LZ1C 4H9RB 3AZMC 3X1SC 2FJ7C 5GXQA 1P3BD 3WAAC 3A6NB 5B31B 4EO5C 3WTPC 4J8VA 2NQBD 5B2JD 5GXQB 5AV6D 4WU9D 3REIA 3B6GD 3AV1C 5GSUD 3AZHA 4J8VB 2AROC 1M18A 1KX3A 5B32D 2JCHA 4J8WC 3AYWA 3REIB 4H9QA 5GXQD 3AZHB 4DRAA 1M18B 3MGRC 1KX3B 3UTBA 1ULYA 3LZ0A 3AZKA 3P5JB 4YS3B 3AFAA 3AYWB 2NZDC 4H9QB 5GT0D 3AZFC 1P3KA 3KXBA 3UTBB 3AZNC 3AZKB 3C1BC 1M18D 4Z66A 1P3KB 3UTAA 2IO5B 1AOID 3LJAA 3KWQC 4Z66B 3LZ0D 3MVDC 3UTAB 2UWXA 4XZQA 3AFAD 4HGAC 1P3IA 3LJAB 1F66D 1S32C 3KXBD 1P3GC 1TZYA 3AZID 4XZQB 5BS7C 4LD9A 3X1TA 1P3IB 1KX4D 1P3OC 5CHLB 3VH6A 2ZY3A 4H9NB 5AY8C 3V9RA 4R8PD 1TZYB 2DQNC 3VH5W 3UT9C 1JFIA 3X1TB 4X23D 3REJD 3NQUA 2HUEC 3V9RB 4XZQD 4ZBJB 3C1CA 1JFIB 1ID3C 4H9OA 5DNMA 1T3UA 2Y2KA 3NQUB 3C1CB 3LELC 4LD9D 2Y2PA 4WU8C 4UUZA 4J8XD 2FFFB 4NFTA 3B0DB 5CPIA 3X1UC 4UUZB 5BT1D 3AZLC 3W96A 1U35A 4Z5TA 3AZJA 5DNMD 5CPIB 3EPLA 1ZLAD 5AVBD 3W96B 1U35B 2JSSA 4YM6A 3WA9C 4G91B 4Z5TB 3AZJB 4XUJC 4NE3A 4JJND 3W97B 5AV9C 3MGPC 4YM6B 1B6WA 5B0ZA 5AV8A 2Y2NA 5B0ZB 2HIOC 5CPJC 1P34C 4YM6D 1P3PC 5AV8B 3H0MC 5JRGD 3AZGC 2CV5C 1P3MC 5FUGA 3TU4A 1M19C 1W2EA 1HQ3C 5FUGB 3TU4B 3MNNA 5AV8D 1P3LA 2PYOD 5B1MD 4Z2MH 3MNNB 5B33A 3KUYA 1P3LB 5B2IB 1EQZD 2J8PA 5B1LA 3REKA 3EPHA 1P3AC 3AZMA 3LZ1A 3X1SA 2FJ7A 4Z2MG 3KUYB 2Y2GA 3WAAA 2BYMA 5B1LB 3REKB 4CAYB 3AZMB 3LZ1B 3WTPA 3X1SB 2FJ7B 3MGSD 4H9SC 3WAAB 2G5HC 5CPKC 5B33D 3WTPB 4EO5B 3AV1A 2AROA 3VH6T 2XD5A 4QLCD 3W98D 4J8WA 2F8NG 3AV1B 3WTPE 1M1AC 2AROB 3AZEA 4UPKA 3MGRA 4J8WB 3AN2D 2NZDA 3AZFA 3AV2C 3MGRB 5F99C 3AZNA 3C1BA 2NZDB 3O62D 3AZFB 3B6FC 2G5IC 5B31A 4AWLC 3AZNB 3MGQC 4M6BA 3C1BB 3AZED 3KWQA 5B24D 3RELC 5AV5D 3MVDA 2Y2MA 5E5AC 5DNNC
chains in the Genus database with same CATH topology
3REHC 4J8UD 3KWQB 1S32A 1P3GA 3MVDB 5BS7A 4HGAB 5B0YC 3VH5A 3WKJC 2W8SA 1P3OA 3A6ND 5AY8A 1S32B 1P3GB 5B31D 4YS3A 3UT9A 1P3OB 5AVCC 5AY8B 2YFWA 1R4VA 4J8VD 3UT9B 1ID3A 4KGCC 3AL0C 2HUEB 2YFWB 3LELA 3REID 4KUDC 3AZHD 5B40C 5GT3C 5CP6C 1ID3B 4WU8A 1KX3D 3W99C 4YS3D 3AYWD 3LELB 3X1UA 4WU8B 3UTBD 3AZLA 3NQJA 3AZKD 1HTAA 1P3KD 4H9NA 3X1UB 3AZLB 3B0CW 3NQJB 1P3BC 3WA9A 4Z66D 3EPKA 4XUJA 3UTAD 2NQBC 5B2JC 3LJAD 3H0RC 5AV9A 3MGPA 3WA9B 4WU9C 3B6GC 4XUJB 5GSUC 4WNNA 1P3ID 5B32C 5AV9B 3MGPB 2ZM5A 5B32G 1TZYD 2HIOA 4WNNB 5CPJA 1P34A 1P3PA 3X1TD 3AZGA 2CV5A 5GT0C 2HIOB 1M19A 5CPJB 5BNXA 1P34B 1P3PB 1P3MB 3AZGB 2CV5B 1Q9CA 3C1CD 2F2AC 1M19B 5BNXB 1HQ3B 1AOIC 3W97A 1TAFA 4NE6A 3LZ0C 3AFAC 1M19D 1P3AA 1F66C 3KXBC 1TAFB 5CPID 3AZIC 2RVQD 3W96D 1KX4C 1U35D 1P3AB 4Z5TD 3AZJD 4R8PC 4H9SA 4X23C 3REJC 3VH5T 3W97D 2F8NA 5CPKB 3KFUG 1M1AA 4LD9C 5B0ZD 2YFVA 2F8NB 5KDMA 5B2IA 4J8XC 1M1AB 3AV2A 5F99A 2YFVB 4WJ3C 5BT1C 5KDMB 3B6FA 3TU4D 3AV2B 4CAYA 5F99B 5DNMC 3MGQA 2Y2QA 1ZLAC 5AVBC 3B6FB 1BH8A 3MNND 4AWLB 1BFMA 5E5AA 5DNNA 2CWEA 5B2ID 3MGQB 3REHA 2ZY2A 3RELA 1P3LD 4JJNC 1BH8B 5B0YA 5E5AB 5DNNB 3KUYD 3RELB 3REHB 5B1LD 3REKD 1B67A 3LZ1D 3AZMD 3X1SD 2FJ7D 3H0LC 5B0YB 3WKJB 3WAAD 5AVCA 5JRGC 1P3FC 3WTPD 3A1KA 1BH9B 4KGCA 5AVCB 4KUDA 3AV1D 2AROD 5GT3A 5CP6A 3W99A 3X1VC 4KGCB 4J8WD 2PYOC 5B1MC 4KUDB 5B40B 1A7WA 5GT3B 5CP6B 3MGRD 3W99B 1EQZC 1H3OA 4E44A 2NZDD 3AZFD 1KX5C 5C3IC 2ZY4A 4G92C 1H3OB 3AZND 1P3BA 3C1BD 4H9PA 2NQBA 1N1JB 5B2JA 4ZUXC 3MGSC 1P3BB 5G49A 3KWQD 4WU9A 3B6GA 5B33C 3R45A 5GSUA 3MVDD 4H9PB 2NQBB 4KHAA 5B2JB 5B32A 4QLCC 5G49B 3W98C 1S32D 1P3GD 4WU9B 3B6GB 3R45B 5GSUB 2Y2HA 4KHAB 1P3OD 5B32B 5AY8D 3AN2C 5GT0A 3UT9D 2L5AA 5GT0B 3O62C 1ID3D 1AOIA 1WWIA 3LELD 3KSYA 3AZEC 5B24C 5AV5C 5BNVA 4WU8D 1AOIB 1PZRA 3EG5B 1F66A 4J8UC 5AV6C 3LZ0B 5BNVB 3X1UD 3EPJA 3AZIA 3AFAB 3AZLD 1KX4A 2Y2OA 1F66B 3A6NC 3KXBB 5B31C 4R8PA 3AZIB 5B31G 5GXQC 4X23A 3REJA 1KX4B 3WA9D 1P3MA 3F6TA 4R8PB 4XUJD 4J8VC 4X23B 3REJB 5AV9D 1HQ3A 3MGPD 2XD1A 3A1IA 3REIC 3AZHC 1M18C 1KX3C 4J8XA 4YS3C 3AYWC 4LD9B 2HIOD 5CPJD 1P34D 2Y2JA 1P3PD 1P3MD 3UTBC 3AZGD 2CV5D 4J8XB 3AZKC 5BO0A 1F1EA 2F8NK 1HQ3D 1P3KC 4NE5A 2BYKA 2IO5C 1ZLAA 5AVBA 5BO0B 3B0CT 4DRBA 2Y2IA 4H9OB 4Z66C 5DNMB 3UTAC 2BYKB 1ZLAB 5AVBB 3LJAC 4JJNA 5CPKA 4XZQC 1KU5A 1P3IC 4JJNB 1P3AD 4E45A 1TZYC 2LY8A 3X1TC 4WZSB 5JRGA 1P3FA 4ZBJC 3IP4C 5CPKD 5JRGB 1P3FB 3VH6W 5JA4A 3C1CC 3X1VA 2F8ND 2PYOA 5B1MA 1M1AD 5JA4B 1P3FD 1EQZA 3X1VB 3B0DC 2PYOB 5B1MB 2RIQA 2Y2LA 1KX5A 3AV2D 5F99D 3FDDA 1EQZB 1WWSA 5CPIC 2JE5A 3WKJA 2RVQC 3W96C 4WV4B 1U35C 1KX5B 3B6FD 5C3IB 3X1VD 4G91C 4Z5TC 4G92B 3AZJC 4ZUXA 3MGSA 3MGQD 1BH9A 3W97C 4YM6C 4CSRA 2DF4C 3B0BA 5E5AD 5DNND 4ZUXB 3MGSB 3REHD 3RELD 4QLCA 1KX5D 3W98A 1Z2CB 5B33B 2VQRA 4CSRB 5B0YD 5B40A 5B0ZC 3WKJD 4QLCB 3W98B 5AV8C 3AN2A 4DQYB 2BG1A 4ZUXD 2F8NH 2BYMB 5AVCD 3AN2B 3O62A 3TU4C 4KGCD 1N1JA 4KUDD 3O62B 5B40D 5B24A 5GT3D 5AV5A 5CP6D 3MNNC 3W99D 1P3LC 5B2IC 4J8UA 3AZEB 5B24B 5AV6A 5AV5B 4H9RA 2ZY5A 3KUYC 3A6NA 5B1LC 4J8UB 3REKC 5AV6B 3LZ1C 4H9RB 3AZMC 3X1SC 2FJ7C 5GXQA 1P3BD 3WAAC 3A6NB 5B31B 4EO5C 3WTPC 4J8VA 2NQBD 5B2JD 5GXQB 5AV6D 4WU9D 3REIA 3B6GD 3AV1C 5GSUD 3AZHA 4J8VB 2AROC 1M18A 1KX3A 5B32D 2JCHA 4J8WC 3AYWA 3REIB 4H9QA 5GXQD 3AZHB 4DRAA 1M18B 3MGRC 1KX3B 3UTBA 1ULYA 3LZ0A 3AZKA 3P5JB 4YS3B 3AFAA 3AYWB 2NZDC 4H9QB 5GT0D 3AZFC 1P3KA 3KXBA 3UTBB 3AZNC 3AZKB 3C1BC 1M18D 4Z66A 1P3KB 3UTAA 2IO5B 1AOID 3LJAA 3KWQC 4Z66B 3LZ0D 3MVDC 3UTAB 2UWXA 4XZQA 3AFAD 4HGAC 1P3IA 3LJAB 1F66D 1S32C 3KXBD 1P3GC 1TZYA 3AZID 4XZQB 5BS7C 4LD9A 3X1TA 1P3IB 1KX4D 1P3OC 5CHLB 3VH6A 2ZY3A 4H9NB 5AY8C 3V9RA 4R8PD 1TZYB 2DQNC 3VH5W 3UT9C 1JFIA 3X1TB 4X23D 3REJD 3NQUA 2HUEC 3V9RB 4XZQD 4ZBJB 3C1CA 1JFIB 1ID3C 4H9OA 5DNMA 1T3UA 2Y2KA 3NQUB 3C1CB 3LELC 4LD9D 2Y2PA 4WU8C 4UUZA 4J8XD 2FFFB 4NFTA 3B0DB 5CPIA 3X1UC 4UUZB 5BT1D 3AZLC 3W96A 1U35A 4Z5TA 3AZJA 5DNMD 5CPIB 3EPLA 1ZLAD 5AVBD 3W96B 1U35B 2JSSA 4YM6A 3WA9C 4G91B 4Z5TB 3AZJB 4XUJC 4NE3A 4JJND 3W97B 5AV9C 3MGPC 4YM6B 1B6WA 5B0ZA 5AV8A 2Y2NA 5B0ZB 2HIOC 5CPJC 1P34C 4YM6D 1P3PC 5AV8B 3H0MC 5JRGD 3AZGC 2CV5C 1P3MC 5FUGA 3TU4A 1M19C 1W2EA 1HQ3C 5FUGB 3TU4B 3MNNA 5AV8D 1P3LA 2PYOD 5B1MD 4Z2MH 3MNNB 5B33A 3KUYA 1P3LB 5B2IB 1EQZD 2J8PA 5B1LA 3REKA 3EPHA 1P3AC 3AZMA 3LZ1A 3X1SA 2FJ7A 4Z2MG 3KUYB 2Y2GA 3WAAA 2BYMA 5B1LB 3REKB 4CAYB 3AZMB 3LZ1B 3WTPA 3X1SB 2FJ7B 3MGSD 4H9SC 3WAAB 2G5HC 5CPKC 5B33D 3WTPB 4EO5B 3AV1A 2AROA 3VH6T 2XD5A 4QLCD 3W98D 4J8WA 2F8NG 3AV1B 3WTPE 1M1AC 2AROB 3AZEA 4UPKA 3MGRA 4J8WB 3AN2D 2NZDA 3AZFA 3AV2C 3MGRB 5F99C 3AZNA 3C1BA 2NZDB 3O62D 3AZFB 3B6FC 2G5IC 5B31A 4AWLC 3AZNB 3MGQC 4M6BA 3C1BB 3AZED 3KWQA 5B24D 3RELC 5AV5D 3MVDA 2Y2MA 5E5AC 5DNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH C;  4J8U D;  3KWQ B;  1S32 A;  1P3G A;  3MVD B;  5BS7 A;  4HGA B;  5B0Y C;  3VH5 A;  3WKJ C;  1P3O A;  3A6N D;  5AY8 A;  1S32 B;  1P3G B;  5B31 D;  4YS3 A;  3UT9 A;  1P3O B;  5AVC C;  5AY8 B;  2YFW A;  1R4V A;  4J8V D;  3UT9 B;  1ID3 A;  4KGC C;  2HUE B;  2YFW B;  3LEL A;  3REI D;  4KUD C;  3AZH D;  5B40 C;  5GT3 C;  5CP6 C;  1ID3 B;  4WU8 A;  1KX3 D;  3W99 C;  4YS3 D;  3AYW D;  3LEL B;  3X1U A;  4WU8 B;  3UTB D;  3AZL A;  3NQJ A;  3AZK D;  1HTA A;  1P3K D;  4H9N A;  3X1U B;  3AZL B;  3B0C W;  3NQJ B;  1P3B C;  3WA9 A;  4Z66 D;  3UTA D;  4XUJ A;  2NQB C;  5B2J C;  3LJA D;  5AV9 A;  3MGP A;  3WA9 B;  4WU9 C;  3B6G C;  5GSU C;  4WNN A;  4XUJ B;  1P3I D;  5B32 C;  5AV9 B;  3MGP B;  5B32 G;  1TZY D;  2HIO A;  4WNN B;  5CPJ A;  1P34 A;  1P3P A;  3X1T D;  3AZG A;  2CV5 A;  5GT0 C;  2HIO B;  1M19 A;  5CPJ B;  5BNX A;  1P34 B;  1P3P B;  1P3M B;  3AZG B;  2CV5 B;  1Q9C A;  3C1C D;  1M19 B;  5BNX B;  1HQ3 B;  1AOI C;  3W97 A;  1TAF A;  4NE6 A;  3LZ0 C;  3AFA C;  1M19 D;  1P3A A;  1F66 C;  3KXB C;  1TAF B;  5CPI D;  3AZI C;  2RVQ D;  3W96 D;  1KX4 C;  1U35 D;  1P3A B;  4Z5T D;  3AZJ D;  4R8P C;  4H9S A;  4X23 C;  3REJ C;  3VH5 T;  3W97 D;  2F8N A;  5CPK B;  1M1A A;  4LD9 C;  5B0Z D;  2YFV A;  2F8N B;  5KDM A;  5B2I A;  4J8X C;  1M1A B;  3AV2 A;  5F99 A;  2YFV B;  5BT1 C;  5KDM B;  3B6F A;  3TU4 D;  3AV2 B;  4CAY A;  5F99 B;  5DNM C;  3MGQ A;  1ZLA C;  5AVB C;  3B6F B;  1BH8 A;  3MNN D;  4AWL B;  1BFM A;  5E5A A;  5DNN A;  2CWE A;  5B2I D;  3MGQ B;  3REH A;  3REL A;  1P3L D;  4JJN C;  1BH8 B;  5B0Y A;  5E5A B;  5DNN B;  3KUY D;  3REL B;  3REH B;  5B1L D;  3REK D;  1B67 A;  3LZ1 D;  3AZM D;  3X1S D;  2FJ7 D;  5B0Y B;  3WKJ B;  3WAA D;  5AVC A;  5JRG C;  1P3F C;  3WTP D;  1BH9 B;  4KGC A;  5AVC B;  4KUD A;  3AV1 D;  2ARO D;  5GT3 A;  5CP6 A;  3W99 A;  3X1V C;  4KGC B;  4J8W D;  2PYO C;  5B1M C;  4KUD B;  5B40 B;  1A7W A;  5GT3 B;  5CP6 B;  3MGR D;  3W99 B;  1EQZ C;  1H3O A;  4E44 A;  2NZD D;  3AZF D;  1KX5 C;  5C3I C;  4G92 C;  1H3O B;  3AZN D;  1P3B A;  3C1B D;  4H9P A;  2NQB A;  1N1J B;  5B2J A;  4ZUX C;  3MGS C;  1P3B B;  5G49 A;  3KWQ D;  4WU9 A;  3B6G A;  5B33 C;  3R45 A;  5GSU A;  3MVD D;  4H9P B;  2NQB B;  4KHA A;  5B2J B;  5B32 A;  4QLC C;  5G49 B;  3W98 C;  1S32 D;  1P3G D;  4WU9 B;  3B6G B;  3R45 B;  5GSU B;  4KHA B;  1P3O D;  5B32 B;  5AY8 D;  3AN2 C;  5GT0 A;  3UT9 D;  2L5A A;  5GT0 B;  3O62 C;  1ID3 D;  1AOI A;  1WWI A;  3LEL D;  3KSY A;  3AZE C;  5B24 C;  5AV5 C;  5BNV A;  4WU8 D;  1AOI B;  1F66 A;  4J8U C;  5AV6 C;  3LZ0 B;  5BNV B;  3X1U D;  3AZI A;  3AZL D;  3AFA B;  1KX4 A;  1F66 B;  3A6N C;  3KXB B;  5B31 C;  4R8P A;  3AZI B;  5B31 G;  5GXQ C;  4X23 A;  3REJ A;  1KX4 B;  3WA9 D;  1P3M A;  4R8P B;  4XUJ D;  4J8V C;  4X23 B;  3REJ B;  5AV9 D;  1HQ3 A;  3MGP D;  3REI C;  3AZH C;  1M18 C;  1KX3 C;  4J8X A;  4YS3 C;  3AYW C;  4LD9 B;  2HIO D;  5CPJ D;  1P34 D;  1P3P D;  1P3M D;  3UTB C;  3AZG D;  2CV5 D;  4J8X B;  3AZK C;  5BO0 A;  1F1E A;  2F8N K;  1HQ3 D;  1P3K C;  4NE5 A;  2BYK A;  2IO5 C;  1ZLA A;  5AVB A;  5BO0 B;  3B0C T;  4DRB A;  4H9O B;  4Z66 C;  5DNM B;  3UTA C;  2BYK B;  1ZLA B;  5AVB B;  3LJA C;  4JJN A;  5CPK A;  4XZQ C;  1KU5 A;  1P3I C;  4JJN B;  1P3A D;  4E45 A;  1TZY C;  2LY8 A;  3X1T C;  4WZS B;  5JRG A;  1P3F A;  4ZBJ C;  5CPK D;  5JRG B;  1P3F B;  3VH6 W;  5JA4 A;  3C1C C;  3X1V A;  2F8N D;  2PYO A;  5B1M A;  1M1A D;  5JA4 B;  1P3F D;  1EQZ A;  3X1V B;  3B0D C;  2PYO B;  5B1M B;  1KX5 A;  3AV2 D;  5F99 D;  1EQZ B;  1WWS A;  5CPI C;  3WKJ A;  2RVQ C;  3W96 C;  4WV4 B;  1U35 C;  1KX5 B;  3B6F D;  5C3I B;  3X1V D;  4G91 C;  4Z5T C;  4G92 B;  3AZJ C;  4ZUX A;  3MGS A;  3MGQ D;  1BH9 A;  3W97 C;  4YM6 C;  4CSR A;  3B0B A;  5E5A D;  5DNN D;  4ZUX B;  3MGS B;  3REH D;  3REL D;  4QLC A;  1KX5 D;  3W98 A;  5B33 B;  4CSR B;  5B0Y D;  5B40 A;  5B0Z C;  3WKJ D;  4QLC B;  3W98 B;  5AV8 C;  3AN2 A;  4ZUX D;  2F8N H;  2BYM B;  5AVC D;  3AN2 B;  3O62 A;  3TU4 C;  4KGC D;  1N1J A;  4KUD D;  3O62 B;  5B40 D;  5B24 A;  5GT3 D;  5AV5 A;  5CP6 D;  3MNN C;  3W99 D;  1P3L C;  5B2I C;  4J8U A;  3AZE B;  5B24 B;  5AV6 A;  5AV5 B;  4H9R A;  3KUY C;  3A6N A;  5B1L C;  4J8U B;  3REK C;  5AV6 B;  3LZ1 C;  4H9R B;  3AZM C;  3X1S C;  2FJ7 C;  5GXQ A;  1P3B D;  3WAA C;  3A6N B;  5B31 B;  4EO5 C;  3WTP C;  4J8V A;  2NQB D;  5B2J D;  5GXQ B;  5AV6 D;  4WU9 D;  3REI A;  3B6G D;  3AV1 C;  5GSU D;  3AZH A;  4J8V B;  2ARO C;  1M18 A;  1KX3 A;  5B32 D;  4J8W C;  3AYW A;  3REI B;  4H9Q A;  5GXQ D;  3AZH B;  4DRA A;  1M18 B;  3MGR C;  1KX3 B;  3UTB A;  1ULY A;  3LZ0 A;  3AZK A;  4YS3 B;  3AFA A;  3AYW B;  2NZD C;  4H9Q B;  5GT0 D;  3AZF C;  1P3K A;  3KXB A;  3UTB B;  3AZN C;  3AZK B;  3C1B C;  1M18 D;  4Z66 A;  1P3K B;  3UTA A;  2IO5 B;  1AOI D;  3LJA A;  3KWQ C;  4Z66 B;  3LZ0 D;  3MVD C;  3UTA B;  4XZQ A;  3AFA D;  4HGA C;  1P3I A;  3LJA B;  1F66 D;  1S32 C;  3KXB D;  1P3G C;  1TZY A;  3AZI D;  4XZQ B;  5BS7 C;  4LD9 A;  3X1T A;  1P3I B;  1KX4 D;  1P3O C;  5CHL B;  3VH6 A;  4H9N B;  5AY8 C;  3V9R A;  4R8P D;  1TZY B;  3VH5 W;  3UT9 C;  1JFI A;  3X1T B;  4X23 D;  3REJ D;  3NQU A;  2HUE C;  3V9R B;  4XZQ D;  4ZBJ B;  3C1C A;  1JFI B;  1ID3 C;  4H9O A;  5DNM A;  3NQU B;  3C1C B;  3LEL C;  4LD9 D;  4WU8 C;  4UUZ A;  4J8X D;  4NFT A;  3B0D B;  5CPI A;  3X1U C;  4UUZ B;  5BT1 D;  3AZL C;  3W96 A;  1U35 A;  4Z5T A;  3AZJ A;  5DNM D;  5CPI B;  1ZLA D;  5AVB D;  3W96 B;  1U35 B;  2JSS A;  4YM6 A;  3WA9 C;  4G91 B;  4Z5T B;  3AZJ B;  4XUJ C;  4NE3 A;  4JJN D;  3W97 B;  5AV9 C;  3MGP C;  4YM6 B;  1B6W A;  5B0Z A;  5AV8 A;  5B0Z B;  2HIO C;  5CPJ C;  1P34 C;  4YM6 D;  1P3P C;  5AV8 B;  5JRG D;  3AZG C;  1P3M C;  2CV5 C;  5FUG A;  3TU4 A;  1M19 C;  1HQ3 C;  5FUG B;  3TU4 B;  3MNN A;  5AV8 D;  1P3L A;  2PYO D;  5B1M D;  4Z2M H;  3MNN B;  5B33 A;  3KUY A;  1P3L B;  5B2I B;  1EQZ D;  5B1L A;  3REK A;  1P3A C;  3AZM A;  3LZ1 A;  3X1S A;  2FJ7 A;  4Z2M G;  3KUY B;  3WAA A;  2BYM A;  5B1L B;  3REK B;  4CAY B;  3AZM B;  3LZ1 B;  3WTP A;  3X1S B;  2FJ7 B;  3MGS D;  4H9S C;  3WAA B;  5CPK C;  5B33 D;  3WTP B;  4EO5 B;  3AV1 A;  2ARO A;  3VH6 T;  4QLC D;  3W98 D;  4J8W A;  2F8N G;  3AV1 B;  3WTP E;  1M1A C;  2ARO B;  3AZE A;  3MGR A;  4J8W B;  3AN2 D;  2NZD A;  3AZF A;  3AV2 C;  3MGR B;  5F99 C;  3AZN A;  3C1B A;  2NZD B;  3O62 D;  3AZF B;  3B6F C;  5B31 A;  4AWL C;  3AZN B;  3MGQ C;  4M6B A;  3C1B B;  3AZE D;  3KWQ A;  5B24 D;  3REL C;  5AV5 D;  3MVD A;  5E5A C;  5DNN C; 
#chains in the Genus database with same CATH topology
 3REH C;  4J8U D;  3KWQ B;  1S32 A;  1P3G A;  3MVD B;  5BS7 A;  4HGA B;  5B0Y C;  3VH5 A;  3WKJ C;  2W8S A;  1P3O A;  3A6N D;  5AY8 A;  1S32 B;  1P3G B;  5B31 D;  4YS3 A;  3UT9 A;  1P3O B;  5AVC C;  5AY8 B;  2YFW A;  1R4V A;  4J8V D;  3UT9 B;  1ID3 A;  4KGC C;  3AL0 C;  2HUE B;  2YFW B;  3LEL A;  3REI D;  4KUD C;  3AZH D;  5B40 C;  5GT3 C;  5CP6 C;  1ID3 B;  4WU8 A;  1KX3 D;  3W99 C;  4YS3 D;  3AYW D;  3LEL B;  3X1U A;  4WU8 B;  3UTB D;  3AZL A;  3NQJ A;  3AZK D;  1HTA A;  1P3K D;  4H9N A;  3X1U B;  3AZL B;  3B0C W;  3NQJ B;  1P3B C;  3WA9 A;  4Z66 D;  3EPK A;  4XUJ A;  3UTA D;  2NQB C;  5B2J C;  3LJA D;  3H0R C;  5AV9 A;  3MGP A;  3WA9 B;  4WU9 C;  3B6G C;  4XUJ B;  5GSU C;  4WNN A;  1P3I D;  5B32 C;  5AV9 B;  3MGP B;  2ZM5 A;  5B32 G;  1TZY D;  2HIO A;  4WNN B;  5CPJ A;  1P34 A;  1P3P A;  3X1T D;  3AZG A;  2CV5 A;  5GT0 C;  2HIO B;  1M19 A;  5CPJ B;  5BNX A;  1P34 B;  1P3P B;  1P3M B;  3AZG B;  2CV5 B;  1Q9C A;  3C1C D;  2F2A C;  1M19 B;  5BNX B;  1HQ3 B;  1AOI C;  3W97 A;  1TAF A;  4NE6 A;  3LZ0 C;  3AFA C;  1M19 D;  1P3A A;  1F66 C;  3KXB C;  1TAF B;  5CPI D;  3AZI C;  2RVQ D;  3W96 D;  1KX4 C;  1U35 D;  1P3A B;  4Z5T D;  3AZJ D;  4R8P C;  4H9S A;  4X23 C;  3REJ C;  3VH5 T;  3W97 D;  2F8N A;  5CPK B;  3KFU G;  1M1A A;  4LD9 C;  5B0Z D;  2YFV A;  2F8N B;  5KDM A;  5B2I A;  4J8X C;  1M1A B;  3AV2 A;  5F99 A;  2YFV B;  4WJ3 C;  5BT1 C;  5KDM B;  3B6F A;  3TU4 D;  3AV2 B;  4CAY A;  5F99 B;  5DNM C;  3MGQ A;  2Y2Q A;  1ZLA C;  5AVB C;  3B6F B;  1BH8 A;  3MNN D;  4AWL B;  1BFM A;  5E5A A;  5DNN A;  2CWE A;  5B2I D;  3MGQ B;  3REH A;  2ZY2 A;  3REL A;  1P3L D;  4JJN C;  1BH8 B;  5B0Y A;  5E5A B;  5DNN B;  3KUY D;  3REL B;  3REH B;  5B1L D;  3REK D;  1B67 A;  3LZ1 D;  3AZM D;  3X1S D;  2FJ7 D;  3H0L C;  5B0Y B;  3WKJ B;  3WAA D;  5AVC A;  5JRG C;  1P3F C;  3WTP D;  3A1K A;  1BH9 B;  4KGC A;  5AVC B;  4KUD A;  3AV1 D;  2ARO D;  5GT3 A;  5CP6 A;  3W99 A;  3X1V C;  4KGC B;  4J8W D;  2PYO C;  5B1M C;  4KUD B;  5B40 B;  1A7W A;  5GT3 B;  5CP6 B;  3MGR D;  3W99 B;  1EQZ C;  1H3O A;  4E44 A;  2NZD D;  3AZF D;  1KX5 C;  5C3I C;  2ZY4 A;  4G92 C;  1H3O B;  3AZN D;  1P3B A;  3C1B D;  4H9P A;  2NQB A;  1N1J B;  5B2J A;  4ZUX C;  3MGS C;  1P3B B;  5G49 A;  3KWQ D;  4WU9 A;  3B6G A;  5B33 C;  3R45 A;  5GSU A;  3MVD D;  4H9P B;  2NQB B;  4KHA A;  5B2J B;  5B32 A;  4QLC C;  5G49 B;  3W98 C;  1S32 D;  1P3G D;  4WU9 B;  3B6G B;  3R45 B;  5GSU B;  2Y2H A;  4KHA B;  1P3O D;  5B32 B;  5AY8 D;  3AN2 C;  5GT0 A;  3UT9 D;  2L5A A;  5GT0 B;  3O62 C;  1ID3 D;  1AOI A;  1WWI A;  3LEL D;  3KSY A;  3AZE C;  5B24 C;  5AV5 C;  5BNV A;  4WU8 D;  1AOI B;  1PZR A;  3EG5 B;  1F66 A;  4J8U C;  5AV6 C;  3LZ0 B;  5BNV B;  3X1U D;  3EPJ A;  3AZI A;  3AFA B;  3AZL D;  1KX4 A;  2Y2O A;  1F66 B;  3A6N C;  3KXB B;  5B31 C;  4R8P A;  3AZI B;  5B31 G;  5GXQ C;  4X23 A;  3REJ A;  1KX4 B;  3WA9 D;  1P3M A;  3F6T A;  4R8P B;  4XUJ D;  4J8V C;  4X23 B;  3REJ B;  5AV9 D;  1HQ3 A;  3MGP D;  2XD1 A;  3A1I A;  3REI C;  3AZH C;  1M18 C;  1KX3 C;  4J8X A;  4YS3 C;  3AYW C;  4LD9 B;  2HIO D;  5CPJ D;  1P34 D;  2Y2J A;  1P3P D;  1P3M D;  3UTB C;  3AZG D;  2CV5 D;  4J8X B;  3AZK C;  5BO0 A;  1F1E A;  2F8N K;  1HQ3 D;  1P3K C;  4NE5 A;  2BYK A;  2IO5 C;  1ZLA A;  5AVB A;  5BO0 B;  3B0C T;  4DRB A;  2Y2I A;  4H9O B;  4Z66 C;  5DNM B;  3UTA C;  2BYK B;  1ZLA B;  5AVB B;  3LJA C;  4JJN A;  5CPK A;  4XZQ C;  1KU5 A;  1P3I C;  4JJN B;  1P3A D;  4E45 A;  1TZY C;  2LY8 A;  3X1T C;  4WZS B;  5JRG A;  1P3F A;  4ZBJ C;  3IP4 C;  5CPK D;  5JRG B;  1P3F B;  3VH6 W;  5JA4 A;  3C1C C;  3X1V A;  2F8N D;  2PYO A;  5B1M A;  1M1A D;  5JA4 B;  1P3F D;  1EQZ A;  3X1V B;  3B0D C;  2PYO B;  5B1M B;  2RIQ A;  2Y2L A;  1KX5 A;  3AV2 D;  5F99 D;  3FDD A;  1EQZ B;  1WWS A;  5CPI C;  2JE5 A;  3WKJ A;  2RVQ C;  3W96 C;  4WV4 B;  1U35 C;  1KX5 B;  3B6F D;  5C3I B;  3X1V D;  4G91 C;  4Z5T C;  4G92 B;  3AZJ C;  4ZUX A;  3MGS A;  3MGQ D;  1BH9 A;  3W97 C;  4YM6 C;  4CSR A;  2DF4 C;  3B0B A;  5E5A D;  5DNN D;  4ZUX B;  3MGS B;  3REH D;  3REL D;  4QLC A;  1KX5 D;  3W98 A;  1Z2C B;  5B33 B;  2VQR A;  4CSR B;  5B0Y D;  5B40 A;  5B0Z C;  3WKJ D;  4QLC B;  3W98 B;  5AV8 C;  3AN2 A;  4DQY B;  2BG1 A;  4ZUX D;  2F8N H;  2BYM B;  5AVC D;  3AN2 B;  3O62 A;  3TU4 C;  4KGC D;  1N1J A;  4KUD D;  3O62 B;  5B40 D;  5B24 A;  5GT3 D;  5AV5 A;  5CP6 D;  3MNN C;  3W99 D;  1P3L C;  5B2I C;  4J8U A;  3AZE B;  5B24 B;  5AV6 A;  5AV5 B;  4H9R A;  2ZY5 A;  3KUY C;  3A6N A;  5B1L C;  4J8U B;  3REK C;  5AV6 B;  3LZ1 C;  4H9R B;  3AZM C;  3X1S C;  2FJ7 C;  5GXQ A;  1P3B D;  3WAA C;  3A6N B;  5B31 B;  4EO5 C;  3WTP C;  4J8V A;  2NQB D;  5B2J D;  5GXQ B;  5AV6 D;  4WU9 D;  3REI A;  3B6G D;  3AV1 C;  5GSU D;  3AZH A;  4J8V B;  2ARO C;  1M18 A;  1KX3 A;  5B32 D;  2JCH A;  4J8W C;  3AYW A;  3REI B;  4H9Q A;  5GXQ D;  3AZH B;  4DRA A;  1M18 B;  3MGR C;  1KX3 B;  3UTB A;  1ULY A;  3LZ0 A;  3AZK A;  3P5J B;  4YS3 B;  3AFA A;  3AYW B;  2NZD C;  4H9Q B;  5GT0 D;  3AZF C;  1P3K A;  3KXB A;  3UTB B;  3AZN C;  3AZK B;  3C1B C;  1M18 D;  4Z66 A;  1P3K B;  3UTA A;  2IO5 B;  1AOI D;  3LJA A;  3KWQ C;  4Z66 B;  3LZ0 D;  3MVD C;  3UTA B;  2UWX A;  4XZQ A;  3AFA D;  4HGA C;  1P3I A;  3LJA B;  1F66 D;  1S32 C;  3KXB D;  1P3G C;  1TZY A;  3AZI D;  4XZQ B;  5BS7 C;  4LD9 A;  3X1T A;  1P3I B;  1KX4 D;  1P3O C;  5CHL B;  3VH6 A;  2ZY3 A;  4H9N B;  5AY8 C;  3V9R A;  4R8P D;  1TZY B;  2DQN C;  3VH5 W;  3UT9 C;  1JFI A;  3X1T B;  4X23 D;  3REJ D;  3NQU A;  2HUE C;  3V9R B;  4XZQ D;  4ZBJ B;  3C1C A;  1JFI B;  1ID3 C;  4H9O A;  5DNM A;  1T3U A;  2Y2K A;  3NQU B;  3C1C B;  3LEL C;  4LD9 D;  2Y2P A;  4WU8 C;  4UUZ A;  4J8X D;  2FFF B;  4NFT A;  3B0D B;  5CPI A;  3X1U C;  4UUZ B;  5BT1 D;  3AZL C;  3W96 A;  1U35 A;  4Z5T A;  3AZJ A;  5DNM D;  5CPI B;  3EPL A;  1ZLA D;  5AVB D;  3W96 B;  1U35 B;  2JSS A;  4YM6 A;  3WA9 C;  4G91 B;  4Z5T B;  3AZJ B;  4XUJ C;  4NE3 A;  4JJN D;  3W97 B;  5AV9 C;  3MGP C;  4YM6 B;  1B6W A;  5B0Z A;  5AV8 A;  2Y2N A;  5B0Z B;  2HIO C;  5CPJ C;  1P34 C;  4YM6 D;  1P3P C;  5AV8 B;  3H0M C;  5JRG D;  3AZG C;  2CV5 C;  1P3M C;  5FUG A;  3TU4 A;  1M19 C;  1W2E A;  1HQ3 C;  5FUG B;  3TU4 B;  3MNN A;  5AV8 D;  1P3L A;  2PYO D;  5B1M D;  4Z2M H;  3MNN B;  5B33 A;  3KUY A;  1P3L B;  5B2I B;  1EQZ D;  2J8P A;  5B1L A;  3REK A;  3EPH A;  1P3A C;  3AZM A;  3LZ1 A;  3X1S A;  2FJ7 A;  4Z2M G;  3KUY B;  2Y2G A;  3WAA A;  2BYM A;  5B1L B;  3REK B;  4CAY B;  3AZM B;  3LZ1 B;  3WTP A;  3X1S B;  2FJ7 B;  3MGS D;  4H9S C;  3WAA B;  2G5H C;  5CPK C;  5B33 D;  3WTP B;  4EO5 B;  3AV1 A;  2ARO A;  3VH6 T;  2XD5 A;  4QLC D;  3W98 D;  4J8W A;  2F8N G;  3AV1 B;  3WTP E;  1M1A C;  2ARO B;  3AZE A;  4UPK A;  3MGR A;  4J8W B;  3AN2 D;  2NZD A;  3AZF A;  3AV2 C;  3MGR B;  5F99 C;  3AZN A;  3C1B A;  2NZD B;  3O62 D;  3AZF B;  3B6F C;  2G5I C;  5B31 A;  4AWL C;  3AZN B;  3MGQ C;  4M6B A;  3C1B B;  3AZE D;  3KWQ A;  5B24 D;  3REL C;  5AV5 D;  3MVD A;  2Y2M A;  5E5A C;  5DNN C; 
#chains in the Genus database with same CATH homology
 3REH C;  4J8U D;  3KWQ B;  1S32 A;  1P3G A;  3MVD B;  5BS7 A;  4HGA B;  5B0Y C;  3VH5 A;  3WKJ C;  2W8S A;  1P3O A;  3A6N D;  5AY8 A;  1S32 B;  1P3G B;  5B31 D;  4YS3 A;  3UT9 A;  1P3O B;  5AVC C;  5AY8 B;  2YFW A;  1R4V A;  4J8V D;  3UT9 B;  1ID3 A;  4KGC C;  3AL0 C;  2HUE B;  2YFW B;  3LEL A;  3REI D;  4KUD C;  3AZH D;  5B40 C;  5GT3 C;  5CP6 C;  1ID3 B;  4WU8 A;  1KX3 D;  3W99 C;  4YS3 D;  3AYW D;  3LEL B;  3X1U A;  4WU8 B;  3UTB D;  3AZL A;  3NQJ A;  3AZK D;  1HTA A;  1P3K D;  4H9N A;  3X1U B;  3AZL B;  3B0C W;  3NQJ B;  1P3B C;  3WA9 A;  4Z66 D;  3EPK A;  4XUJ A;  3UTA D;  2NQB C;  5B2J C;  3LJA D;  3H0R C;  5AV9 A;  3MGP A;  3WA9 B;  4WU9 C;  3B6G C;  4XUJ B;  5GSU C;  4WNN A;  1P3I D;  5B32 C;  5AV9 B;  3MGP B;  2ZM5 A;  5B32 G;  1TZY D;  2HIO A;  4WNN B;  5CPJ A;  1P34 A;  1P3P A;  3X1T D;  3AZG A;  2CV5 A;  5GT0 C;  2HIO B;  1M19 A;  5CPJ B;  5BNX A;  1P34 B;  1P3P B;  1P3M B;  3AZG B;  2CV5 B;  1Q9C A;  3C1C D;  2F2A C;  1M19 B;  5BNX B;  1HQ3 B;  1AOI C;  3W97 A;  1TAF A;  4NE6 A;  3LZ0 C;  3AFA C;  1M19 D;  1P3A A;  1F66 C;  3KXB C;  1TAF B;  5CPI D;  3AZI C;  2RVQ D;  3W96 D;  1KX4 C;  1U35 D;  1P3A B;  4Z5T D;  3AZJ D;  4R8P C;  4H9S A;  4X23 C;  3REJ C;  3VH5 T;  3W97 D;  2F8N A;  5CPK B;  3KFU G;  1M1A A;  4LD9 C;  5B0Z D;  2YFV A;  2F8N B;  5KDM A;  5B2I A;  4J8X C;  1M1A B;  3AV2 A;  5F99 A;  2YFV B;  4WJ3 C;  5BT1 C;  5KDM B;  3B6F A;  3TU4 D;  3AV2 B;  4CAY A;  5F99 B;  5DNM C;  3MGQ A;  2Y2Q A;  1ZLA C;  5AVB C;  3B6F B;  1BH8 A;  3MNN D;  4AWL B;  1BFM A;  5E5A A;  5DNN A;  2CWE A;  5B2I D;  3MGQ B;  3REH A;  2ZY2 A;  3REL A;  1P3L D;  4JJN C;  1BH8 B;  5B0Y A;  5E5A B;  5DNN B;  3KUY D;  3REL B;  3REH B;  5B1L D;  3REK D;  1B67 A;  3LZ1 D;  3AZM D;  3X1S D;  2FJ7 D;  3H0L C;  5B0Y B;  3WKJ B;  3WAA D;  5AVC A;  5JRG C;  1P3F C;  3WTP D;  3A1K A;  1BH9 B;  4KGC A;  5AVC B;  4KUD A;  3AV1 D;  2ARO D;  5GT3 A;  5CP6 A;  3W99 A;  3X1V C;  4KGC B;  4J8W D;  2PYO C;  5B1M C;  4KUD B;  5B40 B;  1A7W A;  5GT3 B;  5CP6 B;  3MGR D;  3W99 B;  1EQZ C;  1H3O A;  4E44 A;  2NZD D;  3AZF D;  1KX5 C;  5C3I C;  2ZY4 A;  4G92 C;  1H3O B;  3AZN D;  1P3B A;  3C1B D;  4H9P A;  2NQB A;  1N1J B;  5B2J A;  4ZUX C;  3MGS C;  1P3B B;  5G49 A;  3KWQ D;  4WU9 A;  3B6G A;  5B33 C;  3R45 A;  5GSU A;  3MVD D;  4H9P B;  2NQB B;  4KHA A;  5B2J B;  5B32 A;  4QLC C;  5G49 B;  3W98 C;  1S32 D;  1P3G D;  4WU9 B;  3B6G B;  3R45 B;  5GSU B;  2Y2H A;  4KHA B;  1P3O D;  5B32 B;  5AY8 D;  3AN2 C;  5GT0 A;  3UT9 D;  2L5A A;  5GT0 B;  3O62 C;  1ID3 D;  1AOI A;  1WWI A;  3LEL D;  3KSY A;  3AZE C;  5B24 C;  5AV5 C;  5BNV A;  4WU8 D;  1AOI B;  1PZR A;  3EG5 B;  1F66 A;  4J8U C;  5AV6 C;  3LZ0 B;  5BNV B;  3X1U D;  3EPJ A;  3AZI A;  3AFA B;  3AZL D;  1KX4 A;  2Y2O A;  1F66 B;  3A6N C;  3KXB B;  5B31 C;  4R8P A;  3AZI B;  5B31 G;  5GXQ C;  4X23 A;  3REJ A;  1KX4 B;  3WA9 D;  1P3M A;  3F6T A;  4R8P B;  4XUJ D;  4J8V C;  4X23 B;  3REJ B;  5AV9 D;  1HQ3 A;  3MGP D;  2XD1 A;  3A1I A;  3REI C;  3AZH C;  1M18 C;  1KX3 C;  4J8X A;  4YS3 C;  3AYW C;  4LD9 B;  2HIO D;  5CPJ D;  1P34 D;  2Y2J A;  1P3P D;  1P3M D;  3UTB C;  3AZG D;  2CV5 D;  4J8X B;  3AZK C;  5BO0 A;  1F1E A;  2F8N K;  1HQ3 D;  1P3K C;  4NE5 A;  2BYK A;  2IO5 C;  1ZLA A;  5AVB A;  5BO0 B;  3B0C T;  4DRB A;  2Y2I A;  4H9O B;  4Z66 C;  5DNM B;  3UTA C;  2BYK B;  1ZLA B;  5AVB B;  3LJA C;  4JJN A;  5CPK A;  4XZQ C;  1KU5 A;  1P3I C;  4JJN B;  1P3A D;  4E45 A;  1TZY C;  2LY8 A;  3X1T C;  4WZS B;  5JRG A;  1P3F A;  4ZBJ C;  3IP4 C;  5CPK D;  5JRG B;  1P3F B;  3VH6 W;  5JA4 A;  3C1C C;  3X1V A;  2F8N D;  2PYO A;  5B1M A;  1M1A D;  5JA4 B;  1P3F D;  1EQZ A;  3X1V B;  3B0D C;  2PYO B;  5B1M B;  2RIQ A;  2Y2L A;  1KX5 A;  3AV2 D;  5F99 D;  3FDD A;  1EQZ B;  1WWS A;  5CPI C;  2JE5 A;  3WKJ A;  2RVQ C;  3W96 C;  4WV4 B;  1U35 C;  1KX5 B;  3B6F D;  5C3I B;  3X1V D;  4G91 C;  4Z5T C;  4G92 B;  3AZJ C;  4ZUX A;  3MGS A;  3MGQ D;  1BH9 A;  3W97 C;  4YM6 C;  4CSR A;  2DF4 C;  3B0B A;  5E5A D;  5DNN D;  4ZUX B;  3MGS B;  3REH D;  3REL D;  4QLC A;  1KX5 D;  3W98 A;  1Z2C B;  5B33 B;  2VQR A;  4CSR B;  5B0Y D;  5B40 A;  5B0Z C;  3WKJ D;  4QLC B;  3W98 B;  5AV8 C;  3AN2 A;  4DQY B;  2BG1 A;  4ZUX D;  2F8N H;  2BYM B;  5AVC D;  3AN2 B;  3O62 A;  3TU4 C;  4KGC D;  1N1J A;  4KUD D;  3O62 B;  5B40 D;  5B24 A;  5GT3 D;  5AV5 A;  5CP6 D;  3MNN C;  3W99 D;  1P3L C;  5B2I C;  4J8U A;  3AZE B;  5B24 B;  5AV6 A;  5AV5 B;  4H9R A;  2ZY5 A;  3KUY C;  3A6N A;  5B1L C;  4J8U B;  3REK C;  5AV6 B;  3LZ1 C;  4H9R B;  3AZM C;  3X1S C;  2FJ7 C;  5GXQ A;  1P3B D;  3WAA C;  3A6N B;  5B31 B;  4EO5 C;  3WTP C;  4J8V A;  2NQB D;  5B2J D;  5GXQ B;  5AV6 D;  4WU9 D;  3REI A;  3B6G D;  3AV1 C;  5GSU D;  3AZH A;  4J8V B;  2ARO C;  1M18 A;  1KX3 A;  5B32 D;  2JCH A;  4J8W C;  3AYW A;  3REI B;  4H9Q A;  5GXQ D;  3AZH B;  4DRA A;  1M18 B;  3MGR C;  1KX3 B;  3UTB A;  1ULY A;  3LZ0 A;  3AZK A;  3P5J B;  4YS3 B;  3AFA A;  3AYW B;  2NZD C;  4H9Q B;  5GT0 D;  3AZF C;  1P3K A;  3KXB A;  3UTB B;  3AZN C;  3AZK B;  3C1B C;  1M18 D;  4Z66 A;  1P3K B;  3UTA A;  2IO5 B;  1AOI D;  3LJA A;  3KWQ C;  4Z66 B;  3LZ0 D;  3MVD C;  3UTA B;  2UWX A;  4XZQ A;  3AFA D;  4HGA C;  1P3I A;  3LJA B;  1F66 D;  1S32 C;  3KXB D;  1P3G C;  1TZY A;  3AZI D;  4XZQ B;  5BS7 C;  4LD9 A;  3X1T A;  1P3I B;  1KX4 D;  1P3O C;  5CHL B;  3VH6 A;  2ZY3 A;  4H9N B;  5AY8 C;  3V9R A;  4R8P D;  1TZY B;  2DQN C;  3VH5 W;  3UT9 C;  1JFI A;  3X1T B;  4X23 D;  3REJ D;  3NQU A;  2HUE C;  3V9R B;  4XZQ D;  4ZBJ B;  3C1C A;  1JFI B;  1ID3 C;  4H9O A;  5DNM A;  1T3U A;  2Y2K A;  3NQU B;  3C1C B;  3LEL C;  4LD9 D;  2Y2P A;  4WU8 C;  4UUZ A;  4J8X D;  2FFF B;  4NFT A;  3B0D B;  5CPI A;  3X1U C;  4UUZ B;  5BT1 D;  3AZL C;  3W96 A;  1U35 A;  4Z5T A;  3AZJ A;  5DNM D;  5CPI B;  3EPL A;  1ZLA D;  5AVB D;  3W96 B;  1U35 B;  2JSS A;  4YM6 A;  3WA9 C;  4G91 B;  4Z5T B;  3AZJ B;  4XUJ C;  4NE3 A;  4JJN D;  3W97 B;  5AV9 C;  3MGP C;  4YM6 B;  1B6W A;  5B0Z A;  5AV8 A;  2Y2N A;  5B0Z B;  2HIO C;  5CPJ C;  1P34 C;  4YM6 D;  1P3P C;  5AV8 B;  3H0M C;  5JRG D;  3AZG C;  2CV5 C;  1P3M C;  5FUG A;  3TU4 A;  1M19 C;  1W2E A;  1HQ3 C;  5FUG B;  3TU4 B;  3MNN A;  5AV8 D;  1P3L A;  2PYO D;  5B1M D;  4Z2M H;  3MNN B;  5B33 A;  3KUY A;  1P3L B;  5B2I B;  1EQZ D;  2J8P A;  5B1L A;  3REK A;  3EPH A;  1P3A C;  3AZM A;  3LZ1 A;  3X1S A;  2FJ7 A;  4Z2M G;  3KUY B;  2Y2G A;  3WAA A;  2BYM A;  5B1L B;  3REK B;  4CAY B;  3AZM B;  3LZ1 B;  3WTP A;  3X1S B;  2FJ7 B;  3MGS D;  4H9S C;  3WAA B;  2G5H C;  5CPK C;  5B33 D;  3WTP B;  4EO5 B;  3AV1 A;  2ARO A;  3VH6 T;  2XD5 A;  4QLC D;  3W98 D;  4J8W A;  2F8N G;  3AV1 B;  3WTP E;  1M1A C;  2ARO B;  3AZE A;  4UPK A;  3MGR A;  4J8W B;  3AN2 D;  2NZD A;  3AZF A;  3AV2 C;  3MGR B;  5F99 C;  3AZN A;  3C1B A;  2NZD B;  3O62 D;  3AZF B;  3B6F C;  2G5I C;  5B31 A;  4AWL C;  3AZN B;  3MGQ C;  4M6B A;  3C1B B;  3AZE D;  3KWQ A;  5B24 D;  3REL C;  5AV5 D;  3MVD A;  2Y2M A;  5E5A C;  5DNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...