3MNNB

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnB00
4ZUXA 3AZMD 1HQ3B 3X1TB 3WTPE 3AZFD 3AYWA 2FJ7A 3X1UC 3MVDA 3W97C 5GSUA 2FJ7C 1KX4C 1KU5A 2YFWA 5CPKD 5E5AC 3W98D 5AVBC 4H9PA 3B0CT 3LZ1B 3REKA 5AY8A 4WNNA 5B33D 4WZSB 1M1AB 3REKC 5BO0B 5BT1C 1P3FD 3AZJC 4Z5TA 5B1MC 5AV8B 1BH8A 5CP6A 3C1CD 1F66D 1P3OA 3REHA 4QLCD 3MNND 3B6FB 2F8ND 4J8XA 1KX5C 2NQBB 3AZLC 5AV9C 4Z66D 1KX5A 3WAAB 3W96C 3C1CB 5AV9D 3REJC 5JRGB 5AVCC 3AZLA 5CPID 1M18A 3MGPA 1BH9A 2PYOB 3O62C 5GT0B 4CAYA 3WA9A 3AV2A 5DNMD 5B1LD 3AYWC 1HQ3A 1U35D 3WA9C 4XUJA 3WTPC 3LJAA 3MGRA 3AZHD 1ID3C 3X1SD 1M18B 5GSUC 3LZ1C 4H9SC 5BT1D 4WU8B 1M19D 3W98B 3X1TD 3MVDB 2NZDD 5CPKB 4NE5A 3AFAB 4J8WB 4UUZA 1ZLAD 5GSUB 2HIOA 3VH6A 1JFIB 1TZYA 1ID3B 3AZND 1P3IA 3AFAD 2HIOC 4CSRB 5GT3A 4R8PA 5DNND 5B32A 1P3IC 2PYOC 5JA4B 3RELB 1S32B 4QLCA 2BYMB 3C1BC 3R45B 1U35B 3B0DB 2RVQC 5B1LB 5B0YC 3TU4D 1EQZB 4CSRA 5GXQC 5GT3B 3REIB 4J8XC 5B1MA 4DRAA 3WAAD 5AV5D 5B31B 3RELC 4LD9C 1TAFB 4YM6A 5BNXB 3AZGB 4WV4B 1F66B 4G91B 5B2IC 3NQUB 4YM6C 3KUYB 3O62A 5B31G 1M19A 1P3KD 5DNMC 1P3BA 5AVBD 3B6GD 3LJAD 3MGRD 4XUJD 3AZGC 5G49A 5AV6B 3V9RA 3KXBA 1P3BC 1P3PD 3AZNA 2IO5B 5B0ZC 3X1SB 5BS7A 2BYKA 3W97D 5B32C 5AY8C 4ZUXB 5B24D 1F66C 3A6ND 3B6GA 3UTBC 4JJNC 3B0BA 5GT0D 2PYOD 1AOIC 4J8VB 4JJNA 4R8PC 2PYOA 4R8PD 4J8WD 2BYMA 1AOID 3AN2C 5B1LA 5B24A 3REHC 4WU9D 3WA9D 5B1LC 4J8UB 3LZ0C 2HUEB 4NFTA 2YFWB 3X1SC 5DNMB 5AV5A 4X23A 2HIOB 4J8UD 4KGCD 4G92B 5CP6D 1M1AA 1P3GC 3WKJA 3WTPB 5B2IA 3KWQA 4Z5TD 3TU4B 3WKJC 4Z66C 2AROA 1BH8B 5CP6B 3O62B 3AZLD 4XZQA 4YS3A 2L5AA 4EO5C 3NQJA 5BNVB 5KDMB 5GT3D 5CPJC 3W96B 4XZQC 4YS3C 3REKD 3A6NB 4WU9C 5G49B 1TZYD 5AV6A 1H3OB 3REHD 1KX5B 5B1MD 3MGSA 3UT9D 1P3FC 3RELD 4XZQB 5F99B 4YS3B 2NZDC 4Z2MH 5KDMA 5B2JB 3W96A 3LELA 3MVDD 2NZDB 1AOIB 3B6GB 1H3OA 5F99D 2FJ7D 5B0YB 3A6NC 1P3MD 5AY8D 5B24C 1P3AA 5F99A 3AZHB 4WU8A 5CPKA 1P3ID 5AVCD 4UUZB 3X1UA 5E5AB 4H9PB 1M18D 3W96D 4LD9A 1P3BB 5JRGD 3AZGD 1TZYB 4X23C 1P3GB 1TZYC 4G92C 3X1SA 5E5AA 5AV5B 3KSYA 4LD9D 1P3LB 3B6FA 3WAAC 3AV2D 4J8XB 4G91C 1P3GA 1P3FB 2NQBA 3AZIB 3B6FD 3MGQD 3REIA 2CV5C 3AZKD 4JJND 5B31A 1S32D 5E5AD 5CHLB 1F1EA 5AVCB 5JRGC 3MGPB 4CAYB 4ZBJB 5DNNC 2YFVB 1KX3B 1F66A 5B0YD 3TU4C 5AV6C 3REID 3MGQA 3LJAC 3MGRC 5AVCA 1P3AD 1P3LC 4H9RA 3W99B 4EO5B 5B40D 4H9SA 3MVDC 4J8WA 3VH5A 4KUDB 3WKJB 4H9QB 5FUGB 1M19C 3WTPA 1JFIA 1WWSA 1P3AB 3AZED 5B2ID 2CWEA 1ZLAC 3AZNB 4H9NA 3VH6W 3WKJD 3UT9A 4KUDD 5AVBB 2LY8A 3NQJB 5BNVA 5CPKC 1P3PB 1KX4D 4X23D 5CPIC 4XUJB 3WTPD 4J8VC 3AZHC 3AYWD 1EQZA 3AZKA 4H9NB 3MNNB 5AVBA 4JJNB 3UTBA 4J8VA 3KWQC 3KWQD 3LZ0D 4E45A 3C1CC 1R4VA 3AN2A 5B0YA 4KGCA 3AZIA 5AV9B 3AZJA 1M1AD 2NQBC 5GXQA 4J8UA 2CV5B 4WU9B 3MNNC 3AZIC 3AV2B 1P3OC 3AV1B 5AV8A 1P34D 3X1VA 5B31D 1S32A 5AV8C 3W98C 3UTAD 4DRBA 5CPJD 3REJA 1M18C 5B2IB 1BFMA 1P3AC 3LZ1A 2AROB 3W97B 1ID3D 4Z2MG 1P3BD 1N1JA 2RVQD 5B32G 1P3LA 1BH9B 4XUJC 1ID3A 5FUGA 3AZFC 1KX4B 4YM6B 3KUYC 5B0ZD 5CPJA 3AZGA 3LJAB 3MGRB 2FJ7B 4HGAC 3W97A 3AZNC 3REHB 1KX3C 3VH5T 4YM6D 5B2JA 3AZKC 1KX5D 3LELB 1P3PA 1AOIA 4WU8D 1M19B 3C1BA 2NZDA 2YFVA 1KX3A 4KUDC 4XZQD 4YS3D 3UTAB 3WAAA 1P3KA 5GT3C 3W99C 3C1CA 3AZLB 5B40B 1EQZC 3W99D 3AN2D 3UTBB 3REKB 1HQ3D 3AV1D 4WNNB 1ULYA 1U35C 5B32B 1TAFA 3C1BB 3LZ0A 5JA4A 3RELA 5B40C 4QLCB 3UTAA 5AV9A 5CP6C 3AZJB 5AV5C 4Z5TB 4KGCC 5DNNA 5B32D 3W98A 1M1AC 2F8NB 3KUYD 3AFAA 3KWQB 2HIOD 3AFAC 3X1TA 3REJB 3AZFA 4J8VD 5GT0A 1HQ3C 3WA9B 3KUYA 2F8NG 1ZLAB 3LZ1D 1EQZD 3UT9C 5B33C 3MGSC 5B2JD 5B2JC 3KXBC 5CPIA 4WU9A 5B1MB 5B0ZA 3AV1A 1B67A 3AZEB 3TU4A 3B0DC 4H9RB 3W99A 5C3IC 5BO0A 3O62D 1KX3D 3VH6T 4Z66B 3REJD 5B40A 1P3KC 3A6NA 1P34B 1WWIA 3AZMC 4KHAB 3X1VD 3KXBD 2F8NH 3AZJD 1A7WA 2HUEC 2F8NA 4AWLB 1P3OD 3AZHA 3X1TC 3AZID 3AYWB 2AROC 5DNMA 2NQBD 4M6BA 5GT0C 4X23B 4LD9B 3UTBD 3AN2B 1P34C 4Z5TC 4KGCB 2F8NK 4H9OA 3C1BD 3REIC 3LZ0B 3X1VB 4ZUXD 5B24B 5AY8B 4ZUXC 1P3MB 3B6GC 4ZBJC 4H9OB 1B6WA 5DNNB 1Q9CA 1P3IB 4KUDA 2IO5C 5B0ZB 1P3FA 4QLCC 4NE6A 3MGQC 3AZEA 1P3MC 4R8PB 3VH5W 5F99C 3AV2C 3MGSB 2BYKB 3UT9B 3AZEC 1U35A 1P3MA 3R45A 2AROD 4HGAB 4J8WC 3AZMA 3UTAC 1KX4A 3MGPD 5CPJB 4WU8C 3AZFB 4NE3A 3AZKB 1ZLAA 4KHAA 5AV6D 4J8XD 3AZMB 5GXQD 4AWLC 3X1UB 1P3LD 5BNXA 5CPIB 4H9QA 1P3PC 1HTAA 1P3KB 3NQUA 3X1UD 5GXQB 2CV5A 5C3IB 2JSSA 1P3GD 2CV5D 4J8UC 1P3OB 3B6FC 5B33A 3MGQB 4Z66A 3B0CW 1S32C 5AV8D 1P34A 4E44A 3V9RB 5B31C 5BS7C 3KXBB 3LELD 3MNNA 3MGPC 5JRGA 3AV1C 3LELC 3X1VC 5B33B 3MGSD 1N1JB 5GSUD
chains in the Genus database with same CATH superfamily
4ZUXA 3AZMD 1HQ3B 3X1TB 3WTPE 3AZFD 3AYWA 2FJ7A 3X1UC 3MVDA 2Y2IA 5GSUA 2FJ7C 3W97C 1KX4C 1W2EA 1KU5A 3H0MC 2YFWA 5CPKD 3AL0C 5E5AC 3W98D 2XD5A 5AVBC 4H9PA 3B0CT 3LZ1B 3REKA 5AY8A 4WNNA 5B33D 4WZSB 1M1AB 2DQNC 3REKC 5BO0B 5BT1C 1P3FD 3IP4C 3AZJC 4Z5TA 5B1MC 5AV8B 1BH8A 5CP6A 3C1CD 1F66D 1P3OA 3REHA 4QLCD 3MNND 3B6FB 2F8ND 4J8XA 1KX5C 2NQBB 3AZLC 5AV9C 4Z66D 1KX5A 3WAAB 3W96C 3C1CB 5AV9D 3REJC 5JRGB 5AVCC 3AZLA 5CPID 1M18A 3MGPA 1BH9A 2PYOB 3O62C 5GT0B 4CAYA 3WA9A 3AV2A 5DNMD 5B1LD 3AYWC 1HQ3A 1U35D 3WA9C 4XUJA 3WTPC 3LJAA 3MGRA 3AZHD 1ID3C 3X1SD 1M18B 5GSUC 3LZ1C 4H9SC 5BT1D 4WU8B 1M19D 3W98B 3X1TD 3MVDB 2NZDD 5CPKB 4NE5A 3AFAB 4J8WB 4UUZA 1ZLAD 5GSUB 2HIOA 2RIQA 3VH6A 1JFIB 1TZYA 1ID3B 2VQRA 3AZND 1P3IA 3AFAD 2HIOC 4CSRB 5GT3A 4R8PA 5DNND 5B32A 1P3IC 2PYOC 5JA4B 3RELB 1S32B 4QLCA 2BYMB 3C1BC 3R45B 1U35B 3B0DB 2RVQC 5B1LB 5B0YC 3TU4D 1EQZB 4CSRA 5GXQC 5GT3B 3REIB 4J8XC 5B1MA 4DRAA 3WAAD 5AV5D 5B31B 3RELC 4LD9C 4DQYB 1TAFB 4YM6A 5BNXB 3AZGB 4WV4B 1F66B 4G91B 5B2IC 3NQUB 4YM6C 3KUYB 3O62A 5B31G 1M19A 1P3KD 5DNMC 2G5IC 2BG1A 1P3BA 2JE5A 5AVBD 3B6GD 3LJAD 3MGRD 4XUJD 3AZGC 5G49A 5AV6B 3V9RA 3KXBA 1P3BC 1P3PD 3AZNA 2IO5B 5B0ZC 3X1SB 5BS7A 2BYKA 3W97D 5B32C 5AY8C 4ZUXB 5B24D 1F66C 3A6ND 3B6GA 1T3UA 3UTBC 4JJNC 3B0BA 4UPKA 5GT0D 2PYOD 1AOIC 4J8VB 4JJNA 4R8PC 2PYOA 4R8PD 4J8WD 2BYMA 2UWXA 1AOID 3AN2C 5B1LA 3EPLA 5B24A 3REHC 4WU9D 3WA9D 1Z2CB 5B1LC 4J8UB 3LZ0C 2HUEB 4NFTA 2YFWB 3X1SC 5DNMB 3KFUG 5AV5A 4X23A 2HIOB 4J8UD 4KGCD 4G92B 5CP6D 1M1AA 1P3GC 3WKJA 3WTPB 5B2IA 3KWQA 4Z5TD 3TU4B 3WKJC 4Z66C 2AROA 1BH8B 5CP6B 3O62B 3AZLD 4XZQA 4YS3A 2L5AA 4EO5C 3NQJA 5BNVB 5KDMB 5GT3D 5CPJC 3W96B 3EG5B 4XZQC 4YS3C 3REKD 2ZY3A 3A6NB 4WU9C 5G49B 1TZYD 5AV6A 1H3OB 3REHD 1KX5B 5B1MD 3MGSA 3UT9D 1P3FC 3RELD 4XZQB 5F99B 4YS3B 2NZDC 4Z2MH 5KDMA 5B2JB 3W96A 3LELA 3MVDD 2NZDB 1AOIB 3P5JB 3B6GB 1H3OA 5F99D 2Y2HA 2FJ7D 5B0YB 3A6NC 2ZY4A 1P3MD 5AY8D 5B24C 1P3AA 5F99A 3AZHB 4WU8A 3F6TA 5CPKA 1P3ID 5AVCD 4UUZB 3X1UA 5E5AB 4H9PB 1M18D 3W96D 4LD9A 1P3BB 5JRGD 3AZGD 1TZYB 4X23C 2Y2KA 1P3GB 1TZYC 4G92C 3X1SA 5E5AA 5AV5B 3KSYA 4LD9D 1P3LB 3B6FA 3WAAC 3AV2D 4J8XB 4G91C 1P3GA 1P3FB 2NQBA 3AZIB 3B6FD 3MGQD 3REIA 2CV5C 3AZKD 4JJND 3A1KA 5B31A 1S32D 5E5AD 5CHLB 1F1EA 5AVCB 5JRGC 3MGPB 1PZRA 4CAYB 4ZBJB 5DNNC 2YFVB 1KX3B 1F66A 2ZY5A 5B0YD 3TU4C 5AV6C 3REID 3MGQA 3LJAC 3MGRC 5AVCA 1P3AD 1P3LC 3A1IA 4H9RA 4EO5B 5B40D 3W99B 4H9SA 3MVDC 4J8WA 3VH5A 4KUDB 3WKJB 4H9QB 5FUGB 1M19C 3WTPA 1JFIA 1WWSA 1P3AB 3AZED 5B2ID 2CWEA 1ZLAC 3AZNB 4H9NA 3VH6W 3WKJD 3UT9A 4KUDD 5AVBB 2LY8A 3NQJB 5BNVA 5CPKC 1P3PB 1KX4D 4X23D 2W8SA 5CPIC 4XUJB 3WTPD 4J8VC 3AZHC 3AYWD 1EQZA 3AZKA 4H9NB 3MNNB 3H0RC 5AVBA 4JJNB 3UTBA 4J8VA 3KWQC 3KWQD 3LZ0D 4E45A 3C1CC 1R4VA 2JCHA 3AN2A 5B0YA 4KGCA 3AZIA 5AV9B 3AZJA 1M1AD 2NQBC 5GXQA 4J8UA 2CV5B 4WU9B 3MNNC 3AZIC 3AV2B 1P3OC 3AV1B 5AV8A 1P34D 3X1VA 5B31D 1S32A 5AV8C 3W98C 3UTAD 4DRBA 5CPJD 3REJA 1M18C 5B2IB 1BFMA 1P3AC 3LZ1A 2AROB 3W97B 1ID3D 4Z2MG 1P3BD 1N1JA 2RVQD 5B32G 1P3LA 1BH9B 4XUJC 1ID3A 5FUGA 3AZFC 3H0LC 4WJ3C 1KX4B 4YM6B 3KUYC 5B0ZD 5CPJA 3AZGA 3LJAB 3MGRB 2FJ7B 4HGAC 3W97A 2F2AC 3AZNC 2DF4C 3REHB 1KX3C 3VH5T 4YM6D 5B2JA 3AZKC 1KX5D 3LELB 1P3PA 1AOIA 4WU8D 1M19B 3C1BA 2NZDA 2YFVA 1KX3A 4KUDC 4XZQD 4YS3D 3UTAB 3WAAA 1P3KA 5GT3C 3W99C 3C1CA 3AZLB 5B40B 1EQZC 3W99D 3AN2D 3UTBB 3REKB 1HQ3D 3AV1D 4WNNB 1ULYA 1U35C 5B32B 1TAFA 3C1BB 3LZ0A 5JA4A 3RELA 5B40C 4QLCB 3UTAA 5AV9A 5CP6C 3AZJB 5AV5C 4Z5TB 4KGCC 5DNNA 5B32D 3W98A 1M1AC 2F8NB 3KUYD 2J8PA 3AFAA 3KWQB 2HIOD 3AFAC 3X1TA 3REJB 2ZY2A 3AZFA 4J8VD 5GT0A 1HQ3C 3WA9B 3KUYA 2F8NG 1ZLAB 3LZ1D 1EQZD 3UT9C 5B33C 3MGSC 2XD1A 5B2JD 5B2JC 3KXBC 5CPIA 2Y2OA 4WU9A 2Y2PA 5B1MB 5B0ZA 2G5HC 3AV1A 1B67A 3AZEB 3TU4A 2Y2LA 3EPHA 3B0DC 4H9RB 2Y2NA 3W99A 5C3IC 5BO0A 3O62D 1KX3D 3VH6T 4Z66B 3REJD 5B40A 1P3KC 3A6NA 1P34B 1WWIA 3AZMC 3FDDA 4KHAB 3X1VD 3KXBD 2Y2GA 2F8NH 3AZJD 1A7WA 2HUEC 2F8NA 4AWLB 1P3OD 3AZHA 3X1TC 3AZID 3AYWB 2AROC 5DNMA 2NQBD 4M6BA 5GT0C 4X23B 4LD9B 3UTBD 3AN2B 1P34C 4Z5TC 4KGCB 2F8NK 4H9OA 3C1BD 3REIC 3LZ0B 3X1VB 4ZUXD 5B24B 5AY8B 4ZUXC 1P3MB 2ZM5A 2FFFB 3B6GC 4ZBJC 4H9OB 1B6WA 5DNNB 1Q9CA 1P3IB 4KUDA 2IO5C 5B0ZB 1P3FA 4QLCC 4NE6A 3MGQC 3AZEA 1P3MC 4R8PB 3VH5W 2Y2QA 5F99C 3AV2C 3MGSB 2BYKB 3EPKA 3UT9B 3AZEC 1U35A 1P3MA 3R45A 2AROD 4HGAB 4J8WC 3AZMA 3UTAC 1KX4A 3MGPD 5CPJB 4WU8C 3AZFB 2Y2JA 4NE3A 3AZKB 1ZLAA 3EPJA 4KHAA 5AV6D 4J8XD 3AZMB 5GXQD 4AWLC 3X1UB 1P3LD 5BNXA 5CPIB 4H9QA 1P3PC 1HTAA 1P3KB 3NQUA 3X1UD 5GXQB 2CV5A 5C3IB 2JSSA 1P3GD 2CV5D 4J8UC 1P3OB 3B6FC 5B33A 3MGQB 4Z66A 3B0CW 1S32C 5AV8D 1P34A 4E44A 3V9RB 5B31C 5BS7C 3KXBB 3LELD 3MNNA 3MGPC 5JRGA 3AV1C 3LELC 3X1VC 5B33B 2Y2MA 3MGSD 1N1JB 5GSUD
chains in the Genus database with same CATH topology
4ZUXA 3AZMD 1HQ3B 3X1TB 3WTPE 3AZFD 3AYWA 2FJ7A 3X1UC 3MVDA 2Y2IA 5GSUA 2FJ7C 3W97C 1KX4C 1W2EA 1KU5A 3H0MC 2YFWA 5CPKD 3AL0C 5E5AC 3W98D 2XD5A 5AVBC 4H9PA 3B0CT 3LZ1B 3REKA 5AY8A 4WNNA 5B33D 4WZSB 1M1AB 2DQNC 3REKC 5BO0B 5BT1C 1P3FD 3IP4C 3AZJC 4Z5TA 5B1MC 5AV8B 1BH8A 5CP6A 3C1CD 1F66D 1P3OA 3REHA 4QLCD 3MNND 3B6FB 2F8ND 4J8XA 1KX5C 2NQBB 3AZLC 5AV9C 4Z66D 1KX5A 3WAAB 3W96C 3C1CB 5AV9D 3REJC 5JRGB 5AVCC 3AZLA 5CPID 1M18A 3MGPA 1BH9A 2PYOB 3O62C 5GT0B 4CAYA 3WA9A 3AV2A 5DNMD 5B1LD 3AYWC 1HQ3A 1U35D 3WA9C 4XUJA 3WTPC 3LJAA 3MGRA 3AZHD 1ID3C 3X1SD 1M18B 5GSUC 3LZ1C 4H9SC 5BT1D 4WU8B 1M19D 3W98B 3X1TD 3MVDB 2NZDD 5CPKB 4NE5A 3AFAB 4J8WB 4UUZA 1ZLAD 5GSUB 2HIOA 2RIQA 3VH6A 1JFIB 1TZYA 1ID3B 2VQRA 3AZND 1P3IA 3AFAD 2HIOC 4CSRB 5GT3A 4R8PA 5DNND 5B32A 1P3IC 2PYOC 5JA4B 3RELB 1S32B 4QLCA 2BYMB 3C1BC 3R45B 1U35B 3B0DB 2RVQC 5B1LB 5B0YC 3TU4D 1EQZB 4CSRA 5GXQC 5GT3B 3REIB 4J8XC 5B1MA 4DRAA 3WAAD 5AV5D 5B31B 3RELC 4LD9C 4DQYB 1TAFB 4YM6A 5BNXB 3AZGB 4WV4B 1F66B 4G91B 5B2IC 3NQUB 4YM6C 3KUYB 3O62A 5B31G 1M19A 1P3KD 5DNMC 2G5IC 2BG1A 1P3BA 2JE5A 5AVBD 3B6GD 3LJAD 3MGRD 4XUJD 3AZGC 5G49A 5AV6B 3V9RA 3KXBA 1P3BC 1P3PD 3AZNA 2IO5B 5B0ZC 3X1SB 5BS7A 2BYKA 3W97D 5B32C 5AY8C 4ZUXB 5B24D 1F66C 3A6ND 3B6GA 1T3UA 3UTBC 4JJNC 3B0BA 4UPKA 5GT0D 2PYOD 1AOIC 4J8VB 4JJNA 4R8PC 2PYOA 4R8PD 4J8WD 2BYMA 2UWXA 1AOID 3AN2C 5B1LA 3EPLA 5B24A 3REHC 4WU9D 3WA9D 1Z2CB 5B1LC 4J8UB 3LZ0C 2HUEB 4NFTA 2YFWB 3X1SC 5DNMB 3KFUG 5AV5A 4X23A 2HIOB 4J8UD 4KGCD 4G92B 5CP6D 1M1AA 1P3GC 3WKJA 3WTPB 5B2IA 3KWQA 4Z5TD 3TU4B 3WKJC 4Z66C 2AROA 1BH8B 5CP6B 3O62B 3AZLD 4XZQA 4YS3A 2L5AA 4EO5C 3NQJA 5BNVB 5KDMB 5GT3D 5CPJC 3W96B 3EG5B 4XZQC 4YS3C 3REKD 2ZY3A 3A6NB 4WU9C 5G49B 1TZYD 5AV6A 1H3OB 3REHD 1KX5B 5B1MD 3MGSA 3UT9D 1P3FC 3RELD 4XZQB 5F99B 4YS3B 2NZDC 4Z2MH 5KDMA 5B2JB 3W96A 3LELA 3MVDD 2NZDB 1AOIB 3P5JB 3B6GB 1H3OA 5F99D 2Y2HA 2FJ7D 5B0YB 3A6NC 2ZY4A 1P3MD 5AY8D 5B24C 1P3AA 5F99A 3AZHB 4WU8A 3F6TA 5CPKA 1P3ID 5AVCD 4UUZB 3X1UA 5E5AB 4H9PB 1M18D 3W96D 4LD9A 1P3BB 5JRGD 3AZGD 1TZYB 4X23C 2Y2KA 1P3GB 1TZYC 4G92C 3X1SA 5E5AA 5AV5B 3KSYA 4LD9D 1P3LB 3B6FA 3WAAC 3AV2D 4J8XB 4G91C 1P3GA 1P3FB 2NQBA 3AZIB 3B6FD 3MGQD 3REIA 2CV5C 3AZKD 4JJND 3A1KA 5B31A 1S32D 5E5AD 5CHLB 1F1EA 5AVCB 5JRGC 3MGPB 1PZRA 4CAYB 4ZBJB 5DNNC 2YFVB 1KX3B 1F66A 2ZY5A 5B0YD 3TU4C 5AV6C 3REID 3MGQA 3LJAC 3MGRC 5AVCA 1P3AD 1P3LC 3A1IA 4H9RA 4EO5B 5B40D 3W99B 4H9SA 3MVDC 4J8WA 3VH5A 4KUDB 3WKJB 4H9QB 5FUGB 1M19C 3WTPA 1JFIA 1WWSA 1P3AB 3AZED 5B2ID 2CWEA 1ZLAC 3AZNB 4H9NA 3VH6W 3WKJD 3UT9A 4KUDD 5AVBB 2LY8A 3NQJB 5BNVA 5CPKC 1P3PB 1KX4D 4X23D 2W8SA 5CPIC 4XUJB 3WTPD 4J8VC 3AZHC 3AYWD 1EQZA 3AZKA 4H9NB 3MNNB 3H0RC 5AVBA 4JJNB 3UTBA 4J8VA 3KWQC 3KWQD 3LZ0D 4E45A 3C1CC 1R4VA 2JCHA 3AN2A 5B0YA 4KGCA 3AZIA 5AV9B 3AZJA 1M1AD 2NQBC 5GXQA 4J8UA 2CV5B 4WU9B 3MNNC 3AZIC 3AV2B 1P3OC 3AV1B 5AV8A 1P34D 3X1VA 5B31D 1S32A 5AV8C 3W98C 3UTAD 4DRBA 5CPJD 3REJA 1M18C 5B2IB 1BFMA 1P3AC 3LZ1A 2AROB 3W97B 1ID3D 4Z2MG 1P3BD 1N1JA 2RVQD 5B32G 1P3LA 1BH9B 4XUJC 1ID3A 5FUGA 3AZFC 3H0LC 4WJ3C 1KX4B 4YM6B 3KUYC 5B0ZD 5CPJA 3AZGA 3LJAB 3MGRB 2FJ7B 4HGAC 3W97A 2F2AC 3AZNC 2DF4C 3REHB 1KX3C 3VH5T 4YM6D 5B2JA 3AZKC 1KX5D 3LELB 1P3PA 1AOIA 4WU8D 1M19B 3C1BA 2NZDA 2YFVA 1KX3A 4KUDC 4XZQD 4YS3D 3UTAB 3WAAA 1P3KA 5GT3C 3W99C 3C1CA 3AZLB 5B40B 1EQZC 3W99D 3AN2D 3UTBB 3REKB 1HQ3D 3AV1D 4WNNB 1ULYA 1U35C 5B32B 1TAFA 3C1BB 3LZ0A 5JA4A 3RELA 5B40C 4QLCB 3UTAA 5AV9A 5CP6C 3AZJB 5AV5C 4Z5TB 4KGCC 5DNNA 5B32D 3W98A 1M1AC 2F8NB 3KUYD 2J8PA 3AFAA 3KWQB 2HIOD 3AFAC 3X1TA 3REJB 2ZY2A 3AZFA 4J8VD 5GT0A 1HQ3C 3WA9B 3KUYA 2F8NG 1ZLAB 3LZ1D 1EQZD 3UT9C 5B33C 3MGSC 2XD1A 5B2JD 5B2JC 3KXBC 5CPIA 2Y2OA 4WU9A 2Y2PA 5B1MB 5B0ZA 2G5HC 3AV1A 1B67A 3AZEB 3TU4A 2Y2LA 3EPHA 3B0DC 4H9RB 2Y2NA 3W99A 5C3IC 5BO0A 3O62D 1KX3D 3VH6T 4Z66B 3REJD 5B40A 1P3KC 3A6NA 1P34B 1WWIA 3AZMC 3FDDA 4KHAB 3X1VD 3KXBD 2Y2GA 2F8NH 3AZJD 1A7WA 2HUEC 2F8NA 4AWLB 1P3OD 3AZHA 3X1TC 3AZID 3AYWB 2AROC 5DNMA 2NQBD 4M6BA 5GT0C 4X23B 4LD9B 3UTBD 3AN2B 1P34C 4Z5TC 4KGCB 2F8NK 4H9OA 3C1BD 3REIC 3LZ0B 3X1VB 4ZUXD 5B24B 5AY8B 4ZUXC 1P3MB 2ZM5A 2FFFB 3B6GC 4ZBJC 4H9OB 1B6WA 5DNNB 1Q9CA 1P3IB 4KUDA 2IO5C 5B0ZB 1P3FA 4QLCC 4NE6A 3MGQC 3AZEA 1P3MC 4R8PB 3VH5W 2Y2QA 5F99C 3AV2C 3MGSB 2BYKB 3EPKA 3UT9B 3AZEC 1U35A 1P3MA 3R45A 2AROD 4HGAB 4J8WC 3AZMA 3UTAC 1KX4A 3MGPD 5CPJB 4WU8C 3AZFB 2Y2JA 4NE3A 3AZKB 1ZLAA 3EPJA 4KHAA 5AV6D 4J8XD 3AZMB 5GXQD 4AWLC 3X1UB 1P3LD 5BNXA 5CPIB 4H9QA 1P3PC 1HTAA 1P3KB 3NQUA 3X1UD 5GXQB 2CV5A 5C3IB 2JSSA 1P3GD 2CV5D 4J8UC 1P3OB 3B6FC 5B33A 3MGQB 4Z66A 3B0CW 1S32C 5AV8D 1P34A 4E44A 3V9RB 5B31C 5BS7C 3KXBB 3LELD 3MNNA 3MGPC 5JRGA 3AV1C 3LELC 3X1VC 5B33B 2Y2MA 3MGSD 1N1JB 5GSUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX A;  3AZM D;  1HQ3 B;  3X1T B;  3WTP E;  3AZF D;  3AYW A;  2FJ7 A;  3X1U C;  3MVD A;  3W97 C;  5GSU A;  2FJ7 C;  1KX4 C;  1KU5 A;  2YFW A;  5CPK D;  5E5A C;  3W98 D;  5AVB C;  4H9P A;  3B0C T;  3LZ1 B;  3REK A;  5AY8 A;  4WNN A;  5B33 D;  4WZS B;  1M1A B;  3REK C;  5BO0 B;  5BT1 C;  1P3F D;  3AZJ C;  4Z5T A;  5B1M C;  5AV8 B;  1BH8 A;  5CP6 A;  3C1C D;  1F66 D;  1P3O A;  3REH A;  4QLC D;  3MNN D;  3B6F B;  2F8N D;  4J8X A;  1KX5 C;  2NQB B;  3AZL C;  5AV9 C;  4Z66 D;  1KX5 A;  3WAA B;  3W96 C;  3C1C B;  5AV9 D;  3REJ C;  5JRG B;  5AVC C;  3AZL A;  5CPI D;  1M18 A;  3MGP A;  1BH9 A;  2PYO B;  3O62 C;  5GT0 B;  4CAY A;  3WA9 A;  3AV2 A;  5DNM D;  5B1L D;  3AYW C;  1HQ3 A;  1U35 D;  3WA9 C;  4XUJ A;  3WTP C;  3LJA A;  3MGR A;  3AZH D;  1ID3 C;  3X1S D;  1M18 B;  5GSU C;  3LZ1 C;  4H9S C;  5BT1 D;  4WU8 B;  1M19 D;  3W98 B;  3X1T D;  3MVD B;  2NZD D;  5CPK B;  4NE5 A;  3AFA B;  4J8W B;  4UUZ A;  1ZLA D;  5GSU B;  2HIO A;  3VH6 A;  1JFI B;  1TZY A;  1ID3 B;  3AZN D;  1P3I A;  3AFA D;  2HIO C;  4CSR B;  5GT3 A;  4R8P A;  5DNN D;  5B32 A;  1P3I C;  2PYO C;  5JA4 B;  3REL B;  1S32 B;  4QLC A;  2BYM B;  3C1B C;  3R45 B;  1U35 B;  3B0D B;  2RVQ C;  5B1L B;  5B0Y C;  3TU4 D;  1EQZ B;  4CSR A;  5GXQ C;  5GT3 B;  3REI B;  4J8X C;  5B1M A;  4DRA A;  3WAA D;  5AV5 D;  5B31 B;  3REL C;  4LD9 C;  1TAF B;  4YM6 A;  5BNX B;  3AZG B;  4WV4 B;  1F66 B;  4G91 B;  5B2I C;  3NQU B;  4YM6 C;  3KUY B;  3O62 A;  5B31 G;  1M19 A;  1P3K D;  5DNM C;  1P3B A;  5AVB D;  3B6G D;  3LJA D;  3MGR D;  4XUJ D;  3AZG C;  5G49 A;  5AV6 B;  3V9R A;  3KXB A;  1P3B C;  1P3P D;  3AZN A;  2IO5 B;  5B0Z C;  3X1S B;  5BS7 A;  2BYK A;  3W97 D;  5B32 C;  5AY8 C;  4ZUX B;  5B24 D;  1F66 C;  3A6N D;  3B6G A;  3UTB C;  4JJN C;  3B0B A;  5GT0 D;  2PYO D;  1AOI C;  4J8V B;  4JJN A;  4R8P C;  2PYO A;  4R8P D;  4J8W D;  2BYM A;  1AOI D;  3AN2 C;  5B1L A;  5B24 A;  3REH C;  4WU9 D;  3WA9 D;  5B1L C;  4J8U B;  3LZ0 C;  2HUE B;  4NFT A;  2YFW B;  3X1S C;  5DNM B;  5AV5 A;  4X23 A;  2HIO B;  4J8U D;  4KGC D;  4G92 B;  5CP6 D;  1M1A A;  1P3G C;  3WKJ A;  3WTP B;  5B2I A;  3KWQ A;  4Z5T D;  3TU4 B;  3WKJ C;  4Z66 C;  2ARO A;  1BH8 B;  5CP6 B;  3O62 B;  3AZL D;  4XZQ A;  4YS3 A;  2L5A A;  4EO5 C;  3NQJ A;  5BNV B;  5KDM B;  5GT3 D;  5CPJ C;  3W96 B;  4XZQ C;  4YS3 C;  3REK D;  3A6N B;  4WU9 C;  5G49 B;  1TZY D;  5AV6 A;  1H3O B;  3REH D;  1KX5 B;  5B1M D;  3MGS A;  3UT9 D;  1P3F C;  3REL D;  4XZQ B;  5F99 B;  4YS3 B;  2NZD C;  4Z2M H;  5KDM A;  5B2J B;  3W96 A;  3LEL A;  3MVD D;  2NZD B;  1AOI B;  3B6G B;  1H3O A;  5F99 D;  2FJ7 D;  5B0Y B;  3A6N C;  1P3M D;  5AY8 D;  5B24 C;  1P3A A;  5F99 A;  3AZH B;  4WU8 A;  5CPK A;  1P3I D;  5AVC D;  4UUZ B;  3X1U A;  5E5A B;  4H9P B;  1M18 D;  3W96 D;  4LD9 A;  1P3B B;  5JRG D;  3AZG D;  1TZY B;  4X23 C;  1P3G B;  1TZY C;  4G92 C;  3X1S A;  5E5A A;  5AV5 B;  3KSY A;  4LD9 D;  1P3L B;  3B6F A;  3WAA C;  3AV2 D;  4J8X B;  4G91 C;  1P3G A;  1P3F B;  2NQB A;  3AZI B;  3B6F D;  3MGQ D;  3REI A;  2CV5 C;  3AZK D;  4JJN D;  5B31 A;  1S32 D;  5E5A D;  5CHL B;  1F1E A;  5AVC B;  5JRG C;  3MGP B;  4CAY B;  4ZBJ B;  5DNN C;  2YFV B;  1KX3 B;  1F66 A;  5B0Y D;  3TU4 C;  5AV6 C;  3REI D;  3MGQ A;  3LJA C;  3MGR C;  5AVC A;  1P3A D;  1P3L C;  4H9R A;  3W99 B;  4EO5 B;  5B40 D;  4H9S A;  3MVD C;  4J8W A;  3VH5 A;  4KUD B;  3WKJ B;  4H9Q B;  5FUG B;  1M19 C;  3WTP A;  1JFI A;  1WWS A;  1P3A B;  3AZE D;  5B2I D;  2CWE A;  1ZLA C;  3AZN B;  4H9N A;  3VH6 W;  3WKJ D;  3UT9 A;  4KUD D;  5AVB B;  2LY8 A;  3NQJ B;  5BNV A;  5CPK C;  1P3P B;  1KX4 D;  4X23 D;  5CPI C;  4XUJ B;  3WTP D;  4J8V C;  3AZH C;  3AYW D;  1EQZ A;  3AZK A;  4H9N B;  3MNN B;  5AVB A;  4JJN B;  3UTB A;  4J8V A;  3KWQ C;  3KWQ D;  3LZ0 D;  4E45 A;  3C1C C;  1R4V A;  3AN2 A;  5B0Y A;  4KGC A;  3AZI A;  5AV9 B;  3AZJ A;  1M1A D;  2NQB C;  5GXQ A;  4J8U A;  2CV5 B;  4WU9 B;  3MNN C;  3AZI C;  3AV2 B;  1P3O C;  3AV1 B;  5AV8 A;  1P34 D;  3X1V A;  5B31 D;  1S32 A;  5AV8 C;  3W98 C;  3UTA D;  4DRB A;  5CPJ D;  3REJ A;  1M18 C;  5B2I B;  1BFM A;  1P3A C;  3LZ1 A;  2ARO B;  3W97 B;  1ID3 D;  4Z2M G;  1P3B D;  1N1J A;  2RVQ D;  5B32 G;  1P3L A;  1BH9 B;  4XUJ C;  1ID3 A;  5FUG A;  3AZF C;  1KX4 B;  4YM6 B;  3KUY C;  5B0Z D;  5CPJ A;  3AZG A;  3LJA B;  3MGR B;  2FJ7 B;  4HGA C;  3W97 A;  3AZN C;  3REH B;  1KX3 C;  3VH5 T;  4YM6 D;  5B2J A;  3AZK C;  1KX5 D;  3LEL B;  1P3P A;  1AOI A;  4WU8 D;  1M19 B;  3C1B A;  2NZD A;  2YFV A;  1KX3 A;  4KUD C;  4XZQ D;  4YS3 D;  3UTA B;  3WAA A;  1P3K A;  5GT3 C;  3W99 C;  3C1C A;  3AZL B;  5B40 B;  1EQZ C;  3W99 D;  3AN2 D;  3UTB B;  3REK B;  1HQ3 D;  3AV1 D;  4WNN B;  1ULY A;  1U35 C;  5B32 B;  1TAF A;  3C1B B;  3LZ0 A;  5JA4 A;  3REL A;  5B40 C;  4QLC B;  3UTA A;  5AV9 A;  5CP6 C;  3AZJ B;  5AV5 C;  4Z5T B;  4KGC C;  5DNN A;  5B32 D;  3W98 A;  1M1A C;  2F8N B;  3KUY D;  3AFA A;  3KWQ B;  2HIO D;  3AFA C;  3X1T A;  3REJ B;  3AZF A;  4J8V D;  5GT0 A;  1HQ3 C;  3WA9 B;  3KUY A;  2F8N G;  1ZLA B;  3LZ1 D;  1EQZ D;  3UT9 C;  5B33 C;  3MGS C;  5B2J D;  5B2J C;  3KXB C;  5CPI A;  4WU9 A;  5B1M B;  5B0Z A;  3AV1 A;  1B67 A;  3AZE B;  3TU4 A;  3B0D C;  4H9R B;  3W99 A;  5C3I C;  5BO0 A;  3O62 D;  1KX3 D;  3VH6 T;  4Z66 B;  3REJ D;  5B40 A;  1P3K C;  3A6N A;  1P34 B;  1WWI A;  3AZM C;  4KHA B;  3X1V D;  3KXB D;  2F8N H;  3AZJ D;  1A7W A;  2HUE C;  2F8N A;  4AWL B;  1P3O D;  3AZH A;  3X1T C;  3AZI D;  3AYW B;  2ARO C;  5DNM A;  2NQB D;  4M6B A;  5GT0 C;  4X23 B;  4LD9 B;  3UTB D;  3AN2 B;  1P34 C;  4Z5T C;  4KGC B;  2F8N K;  4H9O A;  3C1B D;  3REI C;  3LZ0 B;  3X1V B;  4ZUX D;  5B24 B;  5AY8 B;  4ZUX C;  1P3M B;  3B6G C;  4ZBJ C;  4H9O B;  1B6W A;  5DNN B;  1Q9C A;  1P3I B;  4KUD A;  2IO5 C;  5B0Z B;  1P3F A;  4QLC C;  4NE6 A;  3MGQ C;  3AZE A;  1P3M C;  4R8P B;  3VH5 W;  5F99 C;  3AV2 C;  3MGS B;  2BYK B;  3UT9 B;  3AZE C;  1U35 A;  1P3M A;  3R45 A;  2ARO D;  4HGA B;  4J8W C;  3AZM A;  3UTA C;  1KX4 A;  3MGP D;  5CPJ B;  4WU8 C;  3AZF B;  4NE3 A;  3AZK B;  1ZLA A;  4KHA A;  5AV6 D;  4J8X D;  3AZM B;  5GXQ D;  4AWL C;  3X1U B;  1P3L D;  5BNX A;  5CPI B;  4H9Q A;  1P3P C;  1HTA A;  1P3K B;  3NQU A;  3X1U D;  5GXQ B;  2CV5 A;  5C3I B;  2JSS A;  1P3G D;  2CV5 D;  4J8U C;  1P3O B;  3B6F C;  5B33 A;  3MGQ B;  4Z66 A;  3B0C W;  1S32 C;  5AV8 D;  1P34 A;  4E44 A;  3V9R B;  5B31 C;  5BS7 C;  3KXB B;  3LEL D;  3MNN A;  3MGP C;  5JRG A;  3AV1 C;  3LEL C;  3X1V C;  5B33 B;  3MGS D;  1N1J B;  5GSU D; 
#chains in the Genus database with same CATH topology
 4ZUX A;  3AZM D;  1HQ3 B;  3X1T B;  3WTP E;  3AZF D;  3AYW A;  2FJ7 A;  3X1U C;  3MVD A;  2Y2I A;  5GSU A;  2FJ7 C;  3W97 C;  1KX4 C;  1W2E A;  1KU5 A;  3H0M C;  2YFW A;  5CPK D;  3AL0 C;  5E5A C;  3W98 D;  2XD5 A;  5AVB C;  4H9P A;  3B0C T;  3LZ1 B;  3REK A;  5AY8 A;  4WNN A;  5B33 D;  4WZS B;  1M1A B;  2DQN C;  3REK C;  5BO0 B;  5BT1 C;  1P3F D;  3IP4 C;  3AZJ C;  4Z5T A;  5B1M C;  5AV8 B;  1BH8 A;  5CP6 A;  3C1C D;  1F66 D;  1P3O A;  3REH A;  4QLC D;  3MNN D;  3B6F B;  2F8N D;  4J8X A;  1KX5 C;  2NQB B;  3AZL C;  5AV9 C;  4Z66 D;  1KX5 A;  3WAA B;  3W96 C;  3C1C B;  5AV9 D;  3REJ C;  5JRG B;  5AVC C;  3AZL A;  5CPI D;  1M18 A;  3MGP A;  1BH9 A;  2PYO B;  3O62 C;  5GT0 B;  4CAY A;  3WA9 A;  3AV2 A;  5DNM D;  5B1L D;  3AYW C;  1HQ3 A;  1U35 D;  3WA9 C;  4XUJ A;  3WTP C;  3LJA A;  3MGR A;  3AZH D;  1ID3 C;  3X1S D;  1M18 B;  5GSU C;  3LZ1 C;  4H9S C;  5BT1 D;  4WU8 B;  1M19 D;  3W98 B;  3X1T D;  3MVD B;  2NZD D;  5CPK B;  4NE5 A;  3AFA B;  4J8W B;  4UUZ A;  1ZLA D;  5GSU B;  2HIO A;  2RIQ A;  3VH6 A;  1JFI B;  1TZY A;  1ID3 B;  2VQR A;  3AZN D;  1P3I A;  3AFA D;  2HIO C;  4CSR B;  5GT3 A;  4R8P A;  5DNN D;  5B32 A;  1P3I C;  2PYO C;  5JA4 B;  3REL B;  1S32 B;  4QLC A;  2BYM B;  3C1B C;  3R45 B;  1U35 B;  3B0D B;  2RVQ C;  5B1L B;  5B0Y C;  3TU4 D;  1EQZ B;  4CSR A;  5GXQ C;  5GT3 B;  3REI B;  4J8X C;  5B1M A;  4DRA A;  3WAA D;  5AV5 D;  5B31 B;  3REL C;  4LD9 C;  4DQY B;  1TAF B;  4YM6 A;  5BNX B;  3AZG B;  4WV4 B;  1F66 B;  4G91 B;  5B2I C;  3NQU B;  4YM6 C;  3KUY B;  3O62 A;  5B31 G;  1M19 A;  1P3K D;  5DNM C;  2G5I C;  2BG1 A;  1P3B A;  2JE5 A;  5AVB D;  3B6G D;  3LJA D;  3MGR D;  4XUJ D;  3AZG C;  5G49 A;  5AV6 B;  3V9R A;  3KXB A;  1P3B C;  1P3P D;  3AZN A;  2IO5 B;  5B0Z C;  3X1S B;  5BS7 A;  2BYK A;  3W97 D;  5B32 C;  5AY8 C;  4ZUX B;  5B24 D;  1F66 C;  3A6N D;  3B6G A;  1T3U A;  3UTB C;  4JJN C;  3B0B A;  4UPK A;  5GT0 D;  2PYO D;  1AOI C;  4J8V B;  4JJN A;  4R8P C;  2PYO A;  4R8P D;  4J8W D;  2BYM A;  2UWX A;  1AOI D;  3AN2 C;  5B1L A;  3EPL A;  5B24 A;  3REH C;  4WU9 D;  3WA9 D;  1Z2C B;  5B1L C;  4J8U B;  3LZ0 C;  2HUE B;  4NFT A;  2YFW B;  3X1S C;  5DNM B;  3KFU G;  5AV5 A;  4X23 A;  2HIO B;  4J8U D;  4KGC D;  4G92 B;  5CP6 D;  1M1A A;  1P3G C;  3WKJ A;  3WTP B;  5B2I A;  3KWQ A;  4Z5T D;  3TU4 B;  3WKJ C;  4Z66 C;  2ARO A;  1BH8 B;  5CP6 B;  3O62 B;  3AZL D;  4XZQ A;  4YS3 A;  2L5A A;  4EO5 C;  3NQJ A;  5BNV B;  5KDM B;  5GT3 D;  5CPJ C;  3W96 B;  3EG5 B;  4XZQ C;  4YS3 C;  3REK D;  2ZY3 A;  3A6N B;  4WU9 C;  5G49 B;  1TZY D;  5AV6 A;  1H3O B;  3REH D;  1KX5 B;  5B1M D;  3MGS A;  3UT9 D;  1P3F C;  3REL D;  4XZQ B;  5F99 B;  4YS3 B;  2NZD C;  4Z2M H;  5KDM A;  5B2J B;  3W96 A;  3LEL A;  3MVD D;  2NZD B;  1AOI B;  3P5J B;  3B6G B;  1H3O A;  5F99 D;  2Y2H A;  2FJ7 D;  5B0Y B;  3A6N C;  2ZY4 A;  1P3M D;  5AY8 D;  5B24 C;  1P3A A;  5F99 A;  3AZH B;  4WU8 A;  3F6T A;  5CPK A;  1P3I D;  5AVC D;  4UUZ B;  3X1U A;  5E5A B;  4H9P B;  1M18 D;  3W96 D;  4LD9 A;  1P3B B;  5JRG D;  3AZG D;  1TZY B;  4X23 C;  2Y2K A;  1P3G B;  1TZY C;  4G92 C;  3X1S A;  5E5A A;  5AV5 B;  3KSY A;  4LD9 D;  1P3L B;  3B6F A;  3WAA C;  3AV2 D;  4J8X B;  4G91 C;  1P3G A;  1P3F B;  2NQB A;  3AZI B;  3B6F D;  3MGQ D;  3REI A;  2CV5 C;  3AZK D;  4JJN D;  3A1K A;  5B31 A;  1S32 D;  5E5A D;  5CHL B;  1F1E A;  5AVC B;  5JRG C;  3MGP B;  1PZR A;  4CAY B;  4ZBJ B;  5DNN C;  2YFV B;  1KX3 B;  1F66 A;  2ZY5 A;  5B0Y D;  3TU4 C;  5AV6 C;  3REI D;  3MGQ A;  3LJA C;  3MGR C;  5AVC A;  1P3A D;  1P3L C;  3A1I A;  4H9R A;  4EO5 B;  5B40 D;  3W99 B;  4H9S A;  3MVD C;  4J8W A;  3VH5 A;  4KUD B;  3WKJ B;  4H9Q B;  5FUG B;  1M19 C;  3WTP A;  1JFI A;  1WWS A;  1P3A B;  3AZE D;  5B2I D;  2CWE A;  1ZLA C;  3AZN B;  4H9N A;  3VH6 W;  3WKJ D;  3UT9 A;  4KUD D;  5AVB B;  2LY8 A;  3NQJ B;  5BNV A;  5CPK C;  1P3P B;  1KX4 D;  4X23 D;  2W8S A;  5CPI C;  4XUJ B;  3WTP D;  4J8V C;  3AZH C;  3AYW D;  1EQZ A;  3AZK A;  4H9N B;  3MNN B;  3H0R C;  5AVB A;  4JJN B;  3UTB A;  4J8V A;  3KWQ C;  3KWQ D;  3LZ0 D;  4E45 A;  3C1C C;  1R4V A;  2JCH A;  3AN2 A;  5B0Y A;  4KGC A;  3AZI A;  5AV9 B;  3AZJ A;  1M1A D;  2NQB C;  5GXQ A;  4J8U A;  2CV5 B;  4WU9 B;  3MNN C;  3AZI C;  3AV2 B;  1P3O C;  3AV1 B;  5AV8 A;  1P34 D;  3X1V A;  5B31 D;  1S32 A;  5AV8 C;  3W98 C;  3UTA D;  4DRB A;  5CPJ D;  3REJ A;  1M18 C;  5B2I B;  1BFM A;  1P3A C;  3LZ1 A;  2ARO B;  3W97 B;  1ID3 D;  4Z2M G;  1P3B D;  1N1J A;  2RVQ D;  5B32 G;  1P3L A;  1BH9 B;  4XUJ C;  1ID3 A;  5FUG A;  3AZF C;  3H0L C;  4WJ3 C;  1KX4 B;  4YM6 B;  3KUY C;  5B0Z D;  5CPJ A;  3AZG A;  3LJA B;  3MGR B;  2FJ7 B;  4HGA C;  3W97 A;  2F2A C;  3AZN C;  2DF4 C;  3REH B;  1KX3 C;  3VH5 T;  4YM6 D;  5B2J A;  3AZK C;  1KX5 D;  3LEL B;  1P3P A;  1AOI A;  4WU8 D;  1M19 B;  3C1B A;  2NZD A;  2YFV A;  1KX3 A;  4KUD C;  4XZQ D;  4YS3 D;  3UTA B;  3WAA A;  1P3K A;  5GT3 C;  3W99 C;  3C1C A;  3AZL B;  5B40 B;  1EQZ C;  3W99 D;  3AN2 D;  3UTB B;  3REK B;  1HQ3 D;  3AV1 D;  4WNN B;  1ULY A;  1U35 C;  5B32 B;  1TAF A;  3C1B B;  3LZ0 A;  5JA4 A;  3REL A;  5B40 C;  4QLC B;  3UTA A;  5AV9 A;  5CP6 C;  3AZJ B;  5AV5 C;  4Z5T B;  4KGC C;  5DNN A;  5B32 D;  3W98 A;  1M1A C;  2F8N B;  3KUY D;  2J8P A;  3AFA A;  3KWQ B;  2HIO D;  3AFA C;  3X1T A;  3REJ B;  2ZY2 A;  3AZF A;  4J8V D;  5GT0 A;  1HQ3 C;  3WA9 B;  3KUY A;  2F8N G;  1ZLA B;  3LZ1 D;  1EQZ D;  3UT9 C;  5B33 C;  3MGS C;  2XD1 A;  5B2J D;  5B2J C;  3KXB C;  5CPI A;  2Y2O A;  4WU9 A;  2Y2P A;  5B1M B;  5B0Z A;  2G5H C;  3AV1 A;  1B67 A;  3AZE B;  3TU4 A;  2Y2L A;  3EPH A;  3B0D C;  4H9R B;  2Y2N A;  3W99 A;  5C3I C;  5BO0 A;  3O62 D;  1KX3 D;  3VH6 T;  4Z66 B;  3REJ D;  5B40 A;  1P3K C;  3A6N A;  1P34 B;  1WWI A;  3AZM C;  3FDD A;  4KHA B;  3X1V D;  3KXB D;  2Y2G A;  2F8N H;  3AZJ D;  1A7W A;  2HUE C;  2F8N A;  4AWL B;  1P3O D;  3AZH A;  3X1T C;  3AZI D;  3AYW B;  2ARO C;  5DNM A;  2NQB D;  4M6B A;  5GT0 C;  4X23 B;  4LD9 B;  3UTB D;  3AN2 B;  1P34 C;  4Z5T C;  4KGC B;  2F8N K;  4H9O A;  3C1B D;  3REI C;  3LZ0 B;  3X1V B;  4ZUX D;  5B24 B;  5AY8 B;  4ZUX C;  1P3M B;  2ZM5 A;  2FFF B;  3B6G C;  4ZBJ C;  4H9O B;  1B6W A;  5DNN B;  1Q9C A;  1P3I B;  4KUD A;  2IO5 C;  5B0Z B;  1P3F A;  4QLC C;  4NE6 A;  3MGQ C;  3AZE A;  1P3M C;  4R8P B;  3VH5 W;  2Y2Q A;  5F99 C;  3AV2 C;  3MGS B;  2BYK B;  3EPK A;  3UT9 B;  3AZE C;  1U35 A;  1P3M A;  3R45 A;  2ARO D;  4HGA B;  4J8W C;  3AZM A;  3UTA C;  1KX4 A;  3MGP D;  5CPJ B;  4WU8 C;  3AZF B;  2Y2J A;  4NE3 A;  3AZK B;  1ZLA A;  3EPJ A;  4KHA A;  5AV6 D;  4J8X D;  3AZM B;  5GXQ D;  4AWL C;  3X1U B;  1P3L D;  5BNX A;  5CPI B;  4H9Q A;  1P3P C;  1HTA A;  1P3K B;  3NQU A;  3X1U D;  5GXQ B;  2CV5 A;  5C3I B;  2JSS A;  1P3G D;  2CV5 D;  4J8U C;  1P3O B;  3B6F C;  5B33 A;  3MGQ B;  4Z66 A;  3B0C W;  1S32 C;  5AV8 D;  1P34 A;  4E44 A;  3V9R B;  5B31 C;  5BS7 C;  3KXB B;  3LEL D;  3MNN A;  3MGP C;  5JRG A;  3AV1 C;  3LEL C;  3X1V C;  5B33 B;  2Y2M A;  3MGS D;  1N1J B;  5GSU D; 
#chains in the Genus database with same CATH homology
 4ZUX A;  3AZM D;  1HQ3 B;  3X1T B;  3WTP E;  3AZF D;  3AYW A;  2FJ7 A;  3X1U C;  3MVD A;  2Y2I A;  5GSU A;  2FJ7 C;  3W97 C;  1KX4 C;  1W2E A;  1KU5 A;  3H0M C;  2YFW A;  5CPK D;  3AL0 C;  5E5A C;  3W98 D;  2XD5 A;  5AVB C;  4H9P A;  3B0C T;  3LZ1 B;  3REK A;  5AY8 A;  4WNN A;  5B33 D;  4WZS B;  1M1A B;  2DQN C;  3REK C;  5BO0 B;  5BT1 C;  1P3F D;  3IP4 C;  3AZJ C;  4Z5T A;  5B1M C;  5AV8 B;  1BH8 A;  5CP6 A;  3C1C D;  1F66 D;  1P3O A;  3REH A;  4QLC D;  3MNN D;  3B6F B;  2F8N D;  4J8X A;  1KX5 C;  2NQB B;  3AZL C;  5AV9 C;  4Z66 D;  1KX5 A;  3WAA B;  3W96 C;  3C1C B;  5AV9 D;  3REJ C;  5JRG B;  5AVC C;  3AZL A;  5CPI D;  1M18 A;  3MGP A;  1BH9 A;  2PYO B;  3O62 C;  5GT0 B;  4CAY A;  3WA9 A;  3AV2 A;  5DNM D;  5B1L D;  3AYW C;  1HQ3 A;  1U35 D;  3WA9 C;  4XUJ A;  3WTP C;  3LJA A;  3MGR A;  3AZH D;  1ID3 C;  3X1S D;  1M18 B;  5GSU C;  3LZ1 C;  4H9S C;  5BT1 D;  4WU8 B;  1M19 D;  3W98 B;  3X1T D;  3MVD B;  2NZD D;  5CPK B;  4NE5 A;  3AFA B;  4J8W B;  4UUZ A;  1ZLA D;  5GSU B;  2HIO A;  2RIQ A;  3VH6 A;  1JFI B;  1TZY A;  1ID3 B;  2VQR A;  3AZN D;  1P3I A;  3AFA D;  2HIO C;  4CSR B;  5GT3 A;  4R8P A;  5DNN D;  5B32 A;  1P3I C;  2PYO C;  5JA4 B;  3REL B;  1S32 B;  4QLC A;  2BYM B;  3C1B C;  3R45 B;  1U35 B;  3B0D B;  2RVQ C;  5B1L B;  5B0Y C;  3TU4 D;  1EQZ B;  4CSR A;  5GXQ C;  5GT3 B;  3REI B;  4J8X C;  5B1M A;  4DRA A;  3WAA D;  5AV5 D;  5B31 B;  3REL C;  4LD9 C;  4DQY B;  1TAF B;  4YM6 A;  5BNX B;  3AZG B;  4WV4 B;  1F66 B;  4G91 B;  5B2I C;  3NQU B;  4YM6 C;  3KUY B;  3O62 A;  5B31 G;  1M19 A;  1P3K D;  5DNM C;  2G5I C;  2BG1 A;  1P3B A;  2JE5 A;  5AVB D;  3B6G D;  3LJA D;  3MGR D;  4XUJ D;  3AZG C;  5G49 A;  5AV6 B;  3V9R A;  3KXB A;  1P3B C;  1P3P D;  3AZN A;  2IO5 B;  5B0Z C;  3X1S B;  5BS7 A;  2BYK A;  3W97 D;  5B32 C;  5AY8 C;  4ZUX B;  5B24 D;  1F66 C;  3A6N D;  3B6G A;  1T3U A;  3UTB C;  4JJN C;  3B0B A;  4UPK A;  5GT0 D;  2PYO D;  1AOI C;  4J8V B;  4JJN A;  4R8P C;  2PYO A;  4R8P D;  4J8W D;  2BYM A;  2UWX A;  1AOI D;  3AN2 C;  5B1L A;  3EPL A;  5B24 A;  3REH C;  4WU9 D;  3WA9 D;  1Z2C B;  5B1L C;  4J8U B;  3LZ0 C;  2HUE B;  4NFT A;  2YFW B;  3X1S C;  5DNM B;  3KFU G;  5AV5 A;  4X23 A;  2HIO B;  4J8U D;  4KGC D;  4G92 B;  5CP6 D;  1M1A A;  1P3G C;  3WKJ A;  3WTP B;  5B2I A;  3KWQ A;  4Z5T D;  3TU4 B;  3WKJ C;  4Z66 C;  2ARO A;  1BH8 B;  5CP6 B;  3O62 B;  3AZL D;  4XZQ A;  4YS3 A;  2L5A A;  4EO5 C;  3NQJ A;  5BNV B;  5KDM B;  5GT3 D;  5CPJ C;  3W96 B;  3EG5 B;  4XZQ C;  4YS3 C;  3REK D;  2ZY3 A;  3A6N B;  4WU9 C;  5G49 B;  1TZY D;  5AV6 A;  1H3O B;  3REH D;  1KX5 B;  5B1M D;  3MGS A;  3UT9 D;  1P3F C;  3REL D;  4XZQ B;  5F99 B;  4YS3 B;  2NZD C;  4Z2M H;  5KDM A;  5B2J B;  3W96 A;  3LEL A;  3MVD D;  2NZD B;  1AOI B;  3P5J B;  3B6G B;  1H3O A;  5F99 D;  2Y2H A;  2FJ7 D;  5B0Y B;  3A6N C;  2ZY4 A;  1P3M D;  5AY8 D;  5B24 C;  1P3A A;  5F99 A;  3AZH B;  4WU8 A;  3F6T A;  5CPK A;  1P3I D;  5AVC D;  4UUZ B;  3X1U A;  5E5A B;  4H9P B;  1M18 D;  3W96 D;  4LD9 A;  1P3B B;  5JRG D;  3AZG D;  1TZY B;  4X23 C;  2Y2K A;  1P3G B;  1TZY C;  4G92 C;  3X1S A;  5E5A A;  5AV5 B;  3KSY A;  4LD9 D;  1P3L B;  3B6F A;  3WAA C;  3AV2 D;  4J8X B;  4G91 C;  1P3G A;  1P3F B;  2NQB A;  3AZI B;  3B6F D;  3MGQ D;  3REI A;  2CV5 C;  3AZK D;  4JJN D;  3A1K A;  5B31 A;  1S32 D;  5E5A D;  5CHL B;  1F1E A;  5AVC B;  5JRG C;  3MGP B;  1PZR A;  4CAY B;  4ZBJ B;  5DNN C;  2YFV B;  1KX3 B;  1F66 A;  2ZY5 A;  5B0Y D;  3TU4 C;  5AV6 C;  3REI D;  3MGQ A;  3LJA C;  3MGR C;  5AVC A;  1P3A D;  1P3L C;  3A1I A;  4H9R A;  4EO5 B;  5B40 D;  3W99 B;  4H9S A;  3MVD C;  4J8W A;  3VH5 A;  4KUD B;  3WKJ B;  4H9Q B;  5FUG B;  1M19 C;  3WTP A;  1JFI A;  1WWS A;  1P3A B;  3AZE D;  5B2I D;  2CWE A;  1ZLA C;  3AZN B;  4H9N A;  3VH6 W;  3WKJ D;  3UT9 A;  4KUD D;  5AVB B;  2LY8 A;  3NQJ B;  5BNV A;  5CPK C;  1P3P B;  1KX4 D;  4X23 D;  2W8S A;  5CPI C;  4XUJ B;  3WTP D;  4J8V C;  3AZH C;  3AYW D;  1EQZ A;  3AZK A;  4H9N B;  3MNN B;  3H0R C;  5AVB A;  4JJN B;  3UTB A;  4J8V A;  3KWQ C;  3KWQ D;  3LZ0 D;  4E45 A;  3C1C C;  1R4V A;  2JCH A;  3AN2 A;  5B0Y A;  4KGC A;  3AZI A;  5AV9 B;  3AZJ A;  1M1A D;  2NQB C;  5GXQ A;  4J8U A;  2CV5 B;  4WU9 B;  3MNN C;  3AZI C;  3AV2 B;  1P3O C;  3AV1 B;  5AV8 A;  1P34 D;  3X1V A;  5B31 D;  1S32 A;  5AV8 C;  3W98 C;  3UTA D;  4DRB A;  5CPJ D;  3REJ A;  1M18 C;  5B2I B;  1BFM A;  1P3A C;  3LZ1 A;  2ARO B;  3W97 B;  1ID3 D;  4Z2M G;  1P3B D;  1N1J A;  2RVQ D;  5B32 G;  1P3L A;  1BH9 B;  4XUJ C;  1ID3 A;  5FUG A;  3AZF C;  3H0L C;  4WJ3 C;  1KX4 B;  4YM6 B;  3KUY C;  5B0Z D;  5CPJ A;  3AZG A;  3LJA B;  3MGR B;  2FJ7 B;  4HGA C;  3W97 A;  2F2A C;  3AZN C;  2DF4 C;  3REH B;  1KX3 C;  3VH5 T;  4YM6 D;  5B2J A;  3AZK C;  1KX5 D;  3LEL B;  1P3P A;  1AOI A;  4WU8 D;  1M19 B;  3C1B A;  2NZD A;  2YFV A;  1KX3 A;  4KUD C;  4XZQ D;  4YS3 D;  3UTA B;  3WAA A;  1P3K A;  5GT3 C;  3W99 C;  3C1C A;  3AZL B;  5B40 B;  1EQZ C;  3W99 D;  3AN2 D;  3UTB B;  3REK B;  1HQ3 D;  3AV1 D;  4WNN B;  1ULY A;  1U35 C;  5B32 B;  1TAF A;  3C1B B;  3LZ0 A;  5JA4 A;  3REL A;  5B40 C;  4QLC B;  3UTA A;  5AV9 A;  5CP6 C;  3AZJ B;  5AV5 C;  4Z5T B;  4KGC C;  5DNN A;  5B32 D;  3W98 A;  1M1A C;  2F8N B;  3KUY D;  2J8P A;  3AFA A;  3KWQ B;  2HIO D;  3AFA C;  3X1T A;  3REJ B;  2ZY2 A;  3AZF A;  4J8V D;  5GT0 A;  1HQ3 C;  3WA9 B;  3KUY A;  2F8N G;  1ZLA B;  3LZ1 D;  1EQZ D;  3UT9 C;  5B33 C;  3MGS C;  2XD1 A;  5B2J D;  5B2J C;  3KXB C;  5CPI A;  2Y2O A;  4WU9 A;  2Y2P A;  5B1M B;  5B0Z A;  2G5H C;  3AV1 A;  1B67 A;  3AZE B;  3TU4 A;  2Y2L A;  3EPH A;  3B0D C;  4H9R B;  2Y2N A;  3W99 A;  5C3I C;  5BO0 A;  3O62 D;  1KX3 D;  3VH6 T;  4Z66 B;  3REJ D;  5B40 A;  1P3K C;  3A6N A;  1P34 B;  1WWI A;  3AZM C;  3FDD A;  4KHA B;  3X1V D;  3KXB D;  2Y2G A;  2F8N H;  3AZJ D;  1A7W A;  2HUE C;  2F8N A;  4AWL B;  1P3O D;  3AZH A;  3X1T C;  3AZI D;  3AYW B;  2ARO C;  5DNM A;  2NQB D;  4M6B A;  5GT0 C;  4X23 B;  4LD9 B;  3UTB D;  3AN2 B;  1P34 C;  4Z5T C;  4KGC B;  2F8N K;  4H9O A;  3C1B D;  3REI C;  3LZ0 B;  3X1V B;  4ZUX D;  5B24 B;  5AY8 B;  4ZUX C;  1P3M B;  2ZM5 A;  2FFF B;  3B6G C;  4ZBJ C;  4H9O B;  1B6W A;  5DNN B;  1Q9C A;  1P3I B;  4KUD A;  2IO5 C;  5B0Z B;  1P3F A;  4QLC C;  4NE6 A;  3MGQ C;  3AZE A;  1P3M C;  4R8P B;  3VH5 W;  2Y2Q A;  5F99 C;  3AV2 C;  3MGS B;  2BYK B;  3EPK A;  3UT9 B;  3AZE C;  1U35 A;  1P3M A;  3R45 A;  2ARO D;  4HGA B;  4J8W C;  3AZM A;  3UTA C;  1KX4 A;  3MGP D;  5CPJ B;  4WU8 C;  3AZF B;  2Y2J A;  4NE3 A;  3AZK B;  1ZLA A;  3EPJ A;  4KHA A;  5AV6 D;  4J8X D;  3AZM B;  5GXQ D;  4AWL C;  3X1U B;  1P3L D;  5BNX A;  5CPI B;  4H9Q A;  1P3P C;  1HTA A;  1P3K B;  3NQU A;  3X1U D;  5GXQ B;  2CV5 A;  5C3I B;  2JSS A;  1P3G D;  2CV5 D;  4J8U C;  1P3O B;  3B6F C;  5B33 A;  3MGQ B;  4Z66 A;  3B0C W;  1S32 C;  5AV8 D;  1P34 A;  4E44 A;  3V9R B;  5B31 C;  5BS7 C;  3KXB B;  3LEL D;  3MNN A;  3MGP C;  5JRG A;  3AV1 C;  3LEL C;  3X1V C;  5B33 B;  2Y2M A;  3MGS D;  1N1J B;  5GSU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...