3MNNB

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnB00
3AZKC 5B31G 1M1AB 4JJND 5F99B 3V9RB 5FUGB 1M1AD 3AZKB 5F99D 3W97A 5DNNA 5B0ZC 1H3OB 2JSSA 4HGAC 1TAFA 5JA4B 4J8UA 1AOIA 1KU5A 3MVDA 3VH6A 3VH6W 4ZBJC 4HGAB 3MGPA 1M18D 3W97C 5DNNC 5B0ZD 3LZ0D 4KGCA 1WWIA 2NQBA 3TU4C 5CPIA 1P3FC 4ZBJB 3W96A 3B0BA 1AOIC 3W97B 5DNNB 3A6NA 4EO5C 1Q9CA 1TAFB 5B2JA 3MGPC 1KX3C 1M19D 3NQUA 3R45A 5B40D 1AOIB 5DNMC 4XZQD 1TZYA 1P3BA 2PYOA 3TU4D 4H9SA 1P3FD 4EO5B 3W96C 3MGPB 1KX3B 2BYKA 1P3PC 5DNMB 4NE5A 5B31A 3LZ1C 3C1CD 5B2JC 1A7WA 5CPIB 1B67A 3AZLA 5CPJD 3KXBD 1KX3D 1F66C 3B6FC 3W96B 3C1BA 1JFIA 3X1TA 1P3BC 1ID3D 5CP6A 2PYOC 4H9SC 4Z5TA 4KUDC 5B2JB 3W99A 3MNND 1P34A 1F66B 3R45B 1P3PD 1KX4A 5B31C 4QLCC 1P3BB 3LZ1D 4YS3D 1EQZA 2PYOB 3MGRA 3AZLC 4KUDB 3B6FD 1P3OC 2BYKB 5BO0A 3X1TC 5B31B 4QLCB 4Z66A 4KUDD 5B1LA 2F8ND 3X1VD 3AZLB 1P34C 1S32A 3UTAD 1P3LD 1P3OB 1JFIB 1KX4C 4UUZA 3X1TB 1EQZC 2YFWA 3AFAA 4WU9C 1P3OD 1P34B 4H9RA 5AV9A 1HTAA 2HIOC 5AY8A 4J8WD 1KX4B 4Z66C 1EQZB 5B1MA 4WU9B 3REIC 3RELA 5BO0B 3X1UA 4Z66B 4WU9D 1ULYA 5GSUD 3WA9A 4M6BA 3WAAD 4WU8C 3REHD 2HIOD 3REIB 2YFWB 2CV5C 3REKA 4LD9A 3LJAC 5B1MC 3UTAA 1ZLAA 3AV1C 4JJNA 3REID 3RELC 1BH8A 4WU8B 5AY8B 5B1MB 3WA9C 1M1AA 5F99A 3AV1B 4WU8D 3RELB 2CV5D 5AV8D 3LJAD 3V9RA 5FUGA 3AZEC 5BS7A 3AZHC 3AZID 3WA9B 1P3MD 4Z2MG 3UTAB 5AVBD 1M18A 3AZHB 3AN2C 5AVCC 4WV4B 4DRBA 5B0ZA 3LZ0A 4JJNB 1BH8B 2F8NG 4G91C 3AZMC 4AWLC 3AZED 3LELD 5BS7C 3AZHD 3REJD 4X23D 2BYMA 3AN2B 5AVCB 3MGQC 3VH6T 4WZSB 4G92B 3AYWD 4G91B 4J8XD 1M18C 1P3KD 3AN2D 5AVCD 2AROD 5B40A 3LZ0C 4XZQA 3MGQB 3AZMD 5B33D 3TU4A 3UTBC 1P3FA 1M18B 5B24C 3MGQD 5B0ZB 3LZ0B 1P3GD 3C1CA 5CPJA 3KXBA 1M19C 1KX3A 4KHAA 3B6GC 2BYMB 5B2IC 5B40C 3B0CW 4XZQC 5DNMA 1ID3A 3UTBD 1U35C 4CSRA 3MNNA 5B24D 1M19B 3AZGD 4YM6C 3B6GB 4NE6A 2FJ7D 5B40B 1P3PA 4XZQB 3LZ1A 4YS3A 3AV2D 3C1CC 3TU4B 1KX5D 1P3FB 5CPJC 3KXBC 1F66A 3B6FA 1BH9A 3B6GD 5BNVA 5B2ID 4YM6B 1ID3C 5G49A 4KUDA 3C1CB 1U35D 2F8NA 3MNNC 3X1VA 5CPJB 3KXBB 1P3AC 1P3IC 4YM6D 4KHAB 4QLCA 1ID3B 4YS3C 3O62C 4CSRB 3MNNB 1P3OA 1P3IB 2RVQC 3MGSD 1P3PB 4J8WA 2YFVA 3LZ1B 3KWQD 4YS3B 3X1VC 5C3IC 1P3AD 1P3ID 3B6FB 1BH9B 1P3LC 5CHLB 3WTPE 5BNVB 2F8NH 5G49B 3O62D 4J8UD 4WU9A 2F8NB 3X1VB 3KSYA 5C3IB 3MVDD 1P3LB 2RVQD 4H9OA 2HIOA 5E5AD 4J8WC 5GT0D 2HUEC 3REIA 3WKJC 4J8WB 2YFVB 5JRGD 5GSUC 5AV5D 3WAAC 4WU8A 2HUEB 3REHC 3WKJB 2CV5A 3LJAA 5GSUB 5B32D 3AV1A 5B0YC 3WAAB 1HQ3C 1TZYD 4H9OB 3REHB 1P3MA 2HIOB 3WKJD 3W98D 4ZUXC 3VH5A 3VH5W 5AVBA 5BT1D 2NZDC 5AV8C 3AZEA 2LY8A 3LELA 5CPKD 3AZIC 3AZHA 3C1BD 3REJA 5B0YD 1HQ3D 1P3MC 2NZDB 4ZUXD 3AYWA 2CV5B 5AV8B 3KUYD 1F1EA 3LJAB 4J8XA 5AVBC 5GXQC 3AZIB 1P3KA 3AN2A 5AVCA 2AROA 3WTPC 4J8VC 2NZDD 4CAYA 1P3MB 3AZMA 3MGRD 4H9PA 4DRAA 3LELC 4XUJC 3REJC 5GXQB 5AVBB 4X23C 4E45A 3UT9C 3MGQA 3WTPB 5AV6C 3B0DC 3AYWC 1P3GA 5B1LD 3AZFD 3AZEB 3LELB 4J8XC 5GXQD 1S32D 1P3KC 3REJB 2AROC 4X23B 3WTPD 4J8VD 5AV6B 3AFAD 5B33C 3B0DB 3UTBA 3AYWB 4XUJD 4J8XB 5B24A 1P3KB 5AV9D 3UT9D 3AZJD 2FJ7A 2AROB 5AV6D 4R8PD 4CAYB 1P3GC 3AZMB 4WNNB 4H9PB 5B33B 4AWLB 3AV2A 1KX5A 5GT3C 1M19A 3B6GA 3B0CT 5B2IA 3X1SC 3X1UD 2IO5C 5B32G 1P3GB 1U35A 3AZGC 1N1JB 4H9QA 4YM6A 2FJ7C 4H9NB 2F8NK 3AV2C 3UTBB 3AZNC 1KX5C 1ZLAD 5GT3D 5B24B 3AZGB 2FJ7B 3MGSA 3X1SD 3KWQA 3AV2B 1KX5B 3AZNB 1P3AA 1P3IA 5B2IB 3O62A 3REKC 3AZND 3AZKD 1U35B 2CWEA 4H9QB 3MGSC 5E5AA 3KWQC 3REKB 5GT0A 1P3LA 3MGSB 1B6WA 4J8UC 3REKD 3KWQB 3NQJA 5JRGA 5AV5A 1P3AB 3MVDC 4Z2MH 5E5AC 3O62B 4J8UB 5GT0C 5B32A 3W97D 5DNND 4KGCC 3MVDB 3WKJA 2NQBC 1WWSA 5E5AB 5CPIC 3W98A 4E44A 5GSUA 5JRGC 5AV5C 1R4VA 1AOID 5GT0B 3WAAA 4NFTA 3A6NC 3REHA 4KGCB 2NQBB 3MGPD 5CPKA 3NQJB 5JRGB 5B32C 5AV5B 4KGCD 5B0YA 5DNMD 1HQ3A 1TZYC 3A6NB 2NQBD 1BFMA 5CPID 3W98C 4ZUXA 3W96D 3KUYA 3VH5T 3NQUB 5BT1C 5B32B 3A6ND 1TZYB 2NZDA 5B2JD 5AV8A 3W98B 1F66D 5CPKC 3AZIA 3C1BC 1P3BD 5CP6C 2PYOD 4Z5TC 3W99C 3KUYC 3AZFA 5CPKB 5GXQA 3C1BB 5B0YB 3WTPA 4J8VA 5B31D 1HQ3B 4QLCD 5CP6B 5BNXA 4Z5TB 3MGRC 4ZUXB 3AZLD 3W99B 4XUJA 5KDMA 3KUYB 4X23A 3UT9A 3AZJA 3X1TD 5CP6D 5AV6A 4Z5TD 4R8PA 5B1LC 3W99D 3MGRB 3AZFC 1P34D 1S32C 1KX4D 1EQZD 3AFAC 4WNNA 5B33A 5B1LB 3AZFB 1S32B 5AV9C 3AZJC 5AY8C 4J8VB 4UUZB 4Z66D 4R8PC 5BNXB 3AFAB 5GT3A 4XUJB 1N1JA 5KDMB 4H9NA 4H9RB 5AV9B 3UT9B 3AZJB 3X1SA 3X1UC 4R8PB 3AZGA 5AY8D 4LD9C 3X1UB 5B1MD 3UTAC 3AZNA 1ZLAC 3AZKA 3AV1D 4JJNC 1H3OA 3RELD 5JA4A 4LD9B 2L5AA 3WA9D 1M1AC 1ZLAB 5GT3B 5F99C 4NE3A 4G92C 4LD9D 3X1SB 2IO5B
chains in the Genus database with same CATH superfamily
3AZKC 5B31G 1M1AB 4JJND 5F99B 2Y2KA 3V9RB 5FUGB 4WJ3C 1M1AD 2Y2MA 3AZKB 5F99D 3W97A 5DNNA 5B0ZC 1H3OB 2JSSA 4HGAC 1TAFA 5JA4B 4J8UA 1AOIA 1KU5A 3MVDA 3VH6A 3VH6W 4ZBJC 4HGAB 1PZRA 3MGPA 1M18D 3W97C 5DNNC 5B0ZD 3LZ0D 4KGCA 1WWIA 2NQBA 2Y2HA 3TU4C 5CPIA 4ZBJB 1P3FC 3W96A 2JE5A 2UWXA 3B0BA 1AOIC 3W97B 5DNNB 3A6NA 4EO5C 1Q9CA 1TAFB 5B2JA 3MGPC 1KX3C 1M19D 3NQUA 3R45A 5B40D 1AOIB 5DNMC 4XZQD 1TZYA 1P3BA 2PYOA 3TU4D 4H9SA 1P3FD 4EO5B 3W96C 3MGPB 1KX3B 2BYKA 1P3PC 5DNMB 4NE5A 5B31A 3LZ1C 3C1CD 5B2JC 1A7WA 5CPIB 1B67A 3AZLA 5CPJD 3KXBD 1KX3D 1F66C 3B6FC 3W96B 3C1BA 2G5IC 1JFIA 3X1TA 1P3BC 1ID3D 5CP6A 2PYOC 4H9SC 4Z5TA 4KUDC 5B2JB 3W99A 3MNND 1P34A 1F66B 3R45B 1P3PD 1KX4A 5B31C 4QLCC 1P3BB 3LZ1D 4YS3D 1EQZA 2PYOB 3MGRA 3AZLC 4KUDB 3B6FD 1P3OC 2BYKB 5BO0A 3X1TC 5B31B 4QLCB 4Z66A 2W8SA 4KUDD 5B1LA 2Y2JA 3X1VD 3AZLB 1P34C 2F8ND 1S32A 3UTAD 1P3LD 1P3OB 1JFIB 1KX4C 4UUZA 3X1TB 1EQZC 2YFWA 3AFAA 4WU9C 2ZY3A 1P3OD 1P34B 4H9RA 5AV9A 1HTAA 2HIOC 5AY8A 4J8WD 1KX4B 4Z66C 1EQZB 5B1MA 4WU9B 3EPKA 3REIC 3RELA 5BO0B 3X1UA 4Z66B 4WU9D 2Y2PA 1ULYA 5GSUD 3WA9A 4M6BA 2XD1A 3WAAD 3EPLA 4WU8C 3REHD 2HIOD 3REIB 2YFWB 2CV5C 3REKA 4LD9A 3LJAC 5B1MC 3KFUG 3UTAA 1ZLAA 3AV1C 4JJNA 3REID 3RELC 1BH8A 4WU8B 5AY8B 5B1MB 3WA9C 1M1AA 5F99A 3AV1B 4WU8D 3RELB 4UPKA 2CV5D 5AV8D 3LJAD 3V9RA 5FUGA 2Y2NA 3AZEC 5BS7A 3AZHC 3AZID 3WA9B 2BG1A 1P3MD 3H0MC 4Z2MG 3UTAB 5AVBD 1M18A 3AZHB 3AN2C 5AVCC 4WV4B 4DRBA 5B0ZA 3LZ0A 4JJNB 1BH8B 2F8NG 4G91C 3AZMC 4AWLC 3AZED 3LELD 5BS7C 3AZHD 3REJD 4X23D 2BYMA 3AN2B 5AVCB 3MGQC 3VH6T 4WZSB 4G92B 3AYWD 4G91B 1T3UA 4J8XD 1M18C 1P3KD 3AN2D 5AVCD 2AROD 2DF4C 5B40A 2FFFB 4XZQA 3LZ0C 3MGQB 3AZMD 5B33D 3TU4A 3UTBC 1P3FA 1M18B 5B24C 3MGQD 5B0ZB 3LZ0B 1P3GD 3C1CA 5CPJA 3KXBA 1M19C 1KX3A 4KHAA 3B6GC 2BYMB 5B2IC 5B40C 3B0CW 4XZQC 5DNMA 1ID3A 3UTBD 1U35C 4CSRA 3MNNA 5B24D 1M19B 3AZGD 4YM6C 3B6GB 4NE6A 2FJ7D 5B40B 1P3PA 4XZQB 3LZ1A 4YS3A 3AV2D 3C1CC 3TU4B 1KX5D 1P3FB 5CPJC 3KXBC 1F66A 3B6FA 1BH9A 3B6GD 5BNVA 5B2ID 4YM6B 1ID3C 5G49A 4KUDA 3C1CB 1U35D 2F8NA 3MNNC 3X1VA 5CPJB 3KXBB 1P3AC 1P3IC 4YM6D 4KHAB 2ZY2A 4QLCA 1ID3B 4YS3C 3O62C 4CSRB 3MNNB 1P3OA 1P3IB 2RVQC 3MGSD 1P3PB 4J8WA 2YFVA 3LZ1B 3KWQD 4YS3B 3X1VC 5C3IC 1P3AD 1P3ID 3B6FB 1BH9B 1P3LC 5CHLB 3WTPE 5BNVB 2F8NH 5G49B 3O62D 4J8UD 4WU9A 2F8NB 1W2EA 3X1VB 3KSYA 5C3IB 3MVDD 1P3LB 2RVQD 4H9OA 4DQYB 2HIOA 5E5AD 4J8WC 2J8PA 5GT0D 2HUEC 3REIA 3WKJC 4J8WB 2YFVB 5JRGD 5GSUC 5AV5D 3IP4C 3WAAC 4WU8A 2HUEB 3REHC 3WKJB 2CV5A 3LJAA 5GSUB 5B32D 3AV1A 5B0YC 3WAAB 1HQ3C 1TZYD 4H9OB 3REHB 1P3MA 2HIOB 3WKJD 3W98D 4ZUXC 3VH5A 3VH5W 5AVBA 5BT1D 2NZDC 5AV8C 3AZEA 2LY8A 3LELA 5CPKD 3AZIC 3AZHA 3C1BD 3REJA 5B0YD 1HQ3D 1P3MC 2NZDB 4ZUXD 3AYWA 3H0RC 2CV5B 5AV8B 3KUYD 1F1EA 3LJAB 4J8XA 5AVBC 5GXQC 3AZIB 1P3KA 3AN2A 5AVCA 2AROA 2Y2IA 3WTPC 4J8VC 2NZDD 4CAYA 1P3MB 3AZMA 3MGRD 4H9PA 4DRAA 3LELC 4XUJC 3REJC 5GXQB 5AVBB 4X23C 4E45A 3UT9C 3MGQA 3WTPB 5AV6C 3B0DC 3EPHA 3AYWC 1P3GA 5B1LD 3AZFD 3AZEB 3LELB 4J8XC 5GXQD 1S32D 1P3KC 3REJB 2AROC 4X23B 3WTPD 4J8VD 5AV6B 3AFAD 5B33C 3B0DB 3UTBA 3AYWB 4XUJD 4J8XB 5B24A 1P3KB 5AV9D 3UT9D 3AZJD 2FJ7A 2AROB 2DQNC 5AV6D 4R8PD 3P5JB 4CAYB 3AZMB 4WNNB 4H9PB 5B33B 4AWLB 3AV2A 1P3GC 1KX5A 5GT3C 1M19A 3B6GA 3B0CT 5B2IA 3X1SC 3X1UD 2IO5C 5B32G 1P3GB 1U35A 3H0LC 3AZGC 1N1JB 4H9QA 2VQRA 4YM6A 2FJ7C 4H9NB 3EG5B 2F8NK 3AV2C 3UTBB 3AZNC 1KX5C 1ZLAD 5GT3D 5B24B 3AZGB 2FJ7B 3MGSA 3X1SD 3KWQA 3AV2B 1KX5B 3AZNB 1P3AA 1P3IA 3A1IA 5B2IB 3O62A 3FDDA 3REKC 3AZND 3AZKD 1U35B 2CWEA 4H9QB 3MGSC 5E5AA 3KWQC 3REKB 5GT0A 1P3LA 3MGSB 1B6WA 4J8UC 3REKD 3KWQB 3NQJA 5JRGA 5AV5A 1P3AB 3MVDC 2ZM5A 4Z2MH 5E5AC 3O62B 4J8UB 5GT0C 5B32A 3W97D 5DNND 4KGCC 3MVDB 3WKJA 2NQBC 1WWSA 5E5AB 5CPIC 3W98A 4E44A 5GSUA 5JRGC 5AV5C 1R4VA 1AOID 5GT0B 3WAAA 4NFTA 3A6NC 3REHA 4KGCB 2NQBB 3MGPD 2G5HC 5CPKA 3NQJB 5JRGB 5B32C 5AV5B 4KGCD 5B0YA 5DNMD 1HQ3A 1TZYC 3A6NB 2Y2LA 2NQBD 1BFMA 5CPID 2Y2OA 3W98C 4ZUXA 3W96D 3KUYA 3VH5T 3NQUB 5BT1C 5B32B 3A6ND 1TZYB 2NZDA 5B2JD 2Y2GA 5AV8A 3W98B 1F66D 5CPKC 3AZIA 3C1BC 2JCHA 1P3BD 5CP6C 2PYOD 2F2AC 4Z5TC 3W99C 3KUYC 3AZFA 3A1KA 5CPKB 5GXQA 3C1BB 5B0YB 3WTPA 4J8VA 5B31D 1HQ3B 4QLCD 5CP6B 5BNXA 4Z5TB 3MGRC 4ZUXB 3AZLD 3W99B 4XUJA 5KDMA 3KUYB 4X23A 3UT9A 3AZJA 3X1TD 2RIQA 5CP6D 5AV6A 4Z5TD 3AL0C 4R8PA 5B1LC 3W99D 3MGRB 3AZFC 1P34D 1S32C 2Y2QA 1KX4D 2ZY5A 1EQZD 3AFAC 4WNNA 5B33A 5B1LB 3AZFB 1S32B 5AV9C 3AZJC 5AY8C 4J8VB 4UUZB 4Z66D 4R8PC 5BNXB 3AFAB 3F6TA 2ZY4A 5GT3A 4XUJB 1N1JA 5KDMB 4H9NA 4H9RB 5AV9B 3UT9B 1Z2CB 3AZJB 3X1SA 3X1UC 4R8PB 3AZGA 5AY8D 4LD9C 3X1UB 5B1MD 3UTAC 3AZNA 1ZLAC 3AZKA 3AV1D 4JJNC 1H3OA 3RELD 3EPJA 5JA4A 4LD9B 2L5AA 3WA9D 1M1AC 1ZLAB 2XD5A 5GT3B 5F99C 4NE3A 4G92C 4LD9D 3X1SB 2IO5B
chains in the Genus database with same CATH topology
3AZKC 5B31G 1M1AB 4JJND 5F99B 2Y2KA 3V9RB 5FUGB 4WJ3C 1M1AD 2Y2MA 3AZKB 5F99D 3W97A 5DNNA 5B0ZC 1H3OB 2JSSA 4HGAC 1TAFA 5JA4B 4J8UA 1AOIA 1KU5A 3MVDA 3VH6A 3VH6W 4ZBJC 4HGAB 1PZRA 3MGPA 1M18D 3W97C 5DNNC 5B0ZD 3LZ0D 4KGCA 1WWIA 2NQBA 2Y2HA 3TU4C 5CPIA 4ZBJB 1P3FC 3W96A 2JE5A 2UWXA 3B0BA 1AOIC 3W97B 5DNNB 3A6NA 4EO5C 1Q9CA 1TAFB 5B2JA 3MGPC 1KX3C 1M19D 3NQUA 3R45A 5B40D 1AOIB 5DNMC 4XZQD 1TZYA 1P3BA 2PYOA 3TU4D 4H9SA 1P3FD 4EO5B 3W96C 3MGPB 1KX3B 2BYKA 1P3PC 5DNMB 4NE5A 5B31A 3LZ1C 3C1CD 5B2JC 1A7WA 5CPIB 1B67A 3AZLA 5CPJD 3KXBD 1KX3D 1F66C 3B6FC 3W96B 3C1BA 2G5IC 1JFIA 3X1TA 1P3BC 1ID3D 5CP6A 2PYOC 4H9SC 4Z5TA 4KUDC 5B2JB 3W99A 3MNND 1P34A 1F66B 3R45B 1P3PD 1KX4A 5B31C 4QLCC 1P3BB 3LZ1D 4YS3D 1EQZA 2PYOB 3MGRA 3AZLC 4KUDB 3B6FD 1P3OC 2BYKB 5BO0A 3X1TC 5B31B 4QLCB 4Z66A 2W8SA 4KUDD 5B1LA 2Y2JA 3X1VD 3AZLB 1P34C 2F8ND 1S32A 3UTAD 1P3LD 1P3OB 1JFIB 1KX4C 4UUZA 3X1TB 1EQZC 2YFWA 3AFAA 4WU9C 2ZY3A 1P3OD 1P34B 4H9RA 5AV9A 1HTAA 2HIOC 5AY8A 4J8WD 1KX4B 4Z66C 1EQZB 5B1MA 4WU9B 3EPKA 3REIC 3RELA 5BO0B 3X1UA 4Z66B 4WU9D 2Y2PA 1ULYA 5GSUD 3WA9A 4M6BA 2XD1A 3WAAD 3EPLA 4WU8C 3REHD 2HIOD 3REIB 2YFWB 2CV5C 3REKA 4LD9A 3LJAC 5B1MC 3KFUG 3UTAA 1ZLAA 3AV1C 4JJNA 3REID 3RELC 1BH8A 4WU8B 5AY8B 5B1MB 3WA9C 1M1AA 5F99A 3AV1B 4WU8D 3RELB 4UPKA 2CV5D 5AV8D 3LJAD 3V9RA 5FUGA 2Y2NA 3AZEC 5BS7A 3AZHC 3AZID 3WA9B 2BG1A 1P3MD 3H0MC 4Z2MG 3UTAB 5AVBD 1M18A 3AZHB 3AN2C 5AVCC 4WV4B 4DRBA 5B0ZA 3LZ0A 4JJNB 1BH8B 2F8NG 4G91C 3AZMC 4AWLC 3AZED 3LELD 5BS7C 3AZHD 3REJD 4X23D 2BYMA 3AN2B 5AVCB 3MGQC 3VH6T 4WZSB 4G92B 3AYWD 4G91B 1T3UA 4J8XD 1M18C 1P3KD 3AN2D 5AVCD 2AROD 2DF4C 5B40A 2FFFB 4XZQA 3LZ0C 3MGQB 3AZMD 5B33D 3TU4A 3UTBC 1P3FA 1M18B 5B24C 3MGQD 5B0ZB 3LZ0B 1P3GD 3C1CA 5CPJA 3KXBA 1M19C 1KX3A 4KHAA 3B6GC 2BYMB 5B2IC 5B40C 3B0CW 4XZQC 5DNMA 1ID3A 3UTBD 1U35C 4CSRA 3MNNA 5B24D 1M19B 3AZGD 4YM6C 3B6GB 4NE6A 2FJ7D 5B40B 1P3PA 4XZQB 3LZ1A 4YS3A 3AV2D 3C1CC 3TU4B 1KX5D 1P3FB 5CPJC 3KXBC 1F66A 3B6FA 1BH9A 3B6GD 5BNVA 5B2ID 4YM6B 1ID3C 5G49A 4KUDA 3C1CB 1U35D 2F8NA 3MNNC 3X1VA 5CPJB 3KXBB 1P3AC 1P3IC 4YM6D 4KHAB 2ZY2A 4QLCA 1ID3B 4YS3C 3O62C 4CSRB 3MNNB 1P3OA 1P3IB 2RVQC 3MGSD 1P3PB 4J8WA 2YFVA 3LZ1B 3KWQD 4YS3B 3X1VC 5C3IC 1P3AD 1P3ID 3B6FB 1BH9B 1P3LC 5CHLB 3WTPE 5BNVB 2F8NH 5G49B 3O62D 4J8UD 4WU9A 2F8NB 1W2EA 3X1VB 3KSYA 5C3IB 3MVDD 1P3LB 2RVQD 4H9OA 4DQYB 2HIOA 5E5AD 4J8WC 2J8PA 5GT0D 2HUEC 3REIA 3WKJC 4J8WB 2YFVB 5JRGD 5GSUC 5AV5D 3IP4C 3WAAC 4WU8A 2HUEB 3REHC 3WKJB 2CV5A 3LJAA 5GSUB 5B32D 3AV1A 5B0YC 3WAAB 1HQ3C 1TZYD 4H9OB 3REHB 1P3MA 2HIOB 3WKJD 3W98D 4ZUXC 3VH5A 3VH5W 5AVBA 5BT1D 2NZDC 5AV8C 3AZEA 2LY8A 3LELA 5CPKD 3AZIC 3AZHA 3C1BD 3REJA 5B0YD 1HQ3D 1P3MC 2NZDB 4ZUXD 3AYWA 3H0RC 2CV5B 5AV8B 3KUYD 1F1EA 3LJAB 4J8XA 5AVBC 5GXQC 3AZIB 1P3KA 3AN2A 5AVCA 2AROA 2Y2IA 3WTPC 4J8VC 2NZDD 4CAYA 1P3MB 3AZMA 3MGRD 4H9PA 4DRAA 3LELC 4XUJC 3REJC 5GXQB 5AVBB 4X23C 4E45A 3UT9C 3MGQA 3WTPB 5AV6C 3B0DC 3EPHA 3AYWC 1P3GA 5B1LD 3AZFD 3AZEB 3LELB 4J8XC 5GXQD 1S32D 1P3KC 3REJB 2AROC 4X23B 3WTPD 4J8VD 5AV6B 3AFAD 5B33C 3B0DB 3UTBA 3AYWB 4XUJD 4J8XB 5B24A 1P3KB 5AV9D 3UT9D 3AZJD 2FJ7A 2AROB 2DQNC 5AV6D 4R8PD 3P5JB 4CAYB 3AZMB 4WNNB 4H9PB 5B33B 4AWLB 3AV2A 1P3GC 1KX5A 5GT3C 1M19A 3B6GA 3B0CT 5B2IA 3X1SC 3X1UD 2IO5C 5B32G 1P3GB 1U35A 3H0LC 3AZGC 1N1JB 4H9QA 2VQRA 4YM6A 2FJ7C 4H9NB 3EG5B 2F8NK 3AV2C 3UTBB 3AZNC 1KX5C 1ZLAD 5GT3D 5B24B 3AZGB 2FJ7B 3MGSA 3X1SD 3KWQA 3AV2B 1KX5B 3AZNB 1P3AA 1P3IA 3A1IA 5B2IB 3O62A 3FDDA 3REKC 3AZND 3AZKD 1U35B 2CWEA 4H9QB 3MGSC 5E5AA 3KWQC 3REKB 5GT0A 1P3LA 3MGSB 1B6WA 4J8UC 3REKD 3KWQB 3NQJA 5JRGA 5AV5A 1P3AB 3MVDC 2ZM5A 4Z2MH 5E5AC 3O62B 4J8UB 5GT0C 5B32A 3W97D 5DNND 4KGCC 3MVDB 3WKJA 2NQBC 1WWSA 5E5AB 5CPIC 3W98A 4E44A 5GSUA 5JRGC 5AV5C 1R4VA 1AOID 5GT0B 3WAAA 4NFTA 3A6NC 3REHA 4KGCB 2NQBB 3MGPD 2G5HC 5CPKA 3NQJB 5JRGB 5B32C 5AV5B 4KGCD 5B0YA 5DNMD 1HQ3A 1TZYC 3A6NB 2Y2LA 2NQBD 1BFMA 5CPID 2Y2OA 3W98C 4ZUXA 3W96D 3KUYA 3VH5T 3NQUB 5BT1C 5B32B 3A6ND 1TZYB 2NZDA 5B2JD 2Y2GA 5AV8A 3W98B 1F66D 5CPKC 3AZIA 3C1BC 2JCHA 1P3BD 5CP6C 2PYOD 2F2AC 4Z5TC 3W99C 3KUYC 3AZFA 3A1KA 5CPKB 5GXQA 3C1BB 5B0YB 3WTPA 4J8VA 5B31D 1HQ3B 4QLCD 5CP6B 5BNXA 4Z5TB 3MGRC 4ZUXB 3AZLD 3W99B 4XUJA 5KDMA 3KUYB 4X23A 3UT9A 3AZJA 3X1TD 2RIQA 5CP6D 5AV6A 4Z5TD 3AL0C 4R8PA 5B1LC 3W99D 3MGRB 3AZFC 1P34D 1S32C 2Y2QA 1KX4D 2ZY5A 1EQZD 3AFAC 4WNNA 5B33A 5B1LB 3AZFB 1S32B 5AV9C 3AZJC 5AY8C 4J8VB 4UUZB 4Z66D 4R8PC 5BNXB 3AFAB 3F6TA 2ZY4A 5GT3A 4XUJB 1N1JA 5KDMB 4H9NA 4H9RB 5AV9B 3UT9B 1Z2CB 3AZJB 3X1SA 3X1UC 4R8PB 3AZGA 5AY8D 4LD9C 3X1UB 5B1MD 3UTAC 3AZNA 1ZLAC 3AZKA 3AV1D 4JJNC 1H3OA 3RELD 3EPJA 5JA4A 4LD9B 2L5AA 3WA9D 1M1AC 1ZLAB 2XD5A 5GT3B 5F99C 4NE3A 4G92C 4LD9D 3X1SB 2IO5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK C;  5B31 G;  1M1A B;  4JJN D;  5F99 B;  3V9R B;  5FUG B;  1M1A D;  3AZK B;  5F99 D;  3W97 A;  5DNN A;  5B0Z C;  1H3O B;  2JSS A;  4HGA C;  1TAF A;  5JA4 B;  4J8U A;  1AOI A;  1KU5 A;  3MVD A;  3VH6 A;  3VH6 W;  4ZBJ C;  4HGA B;  3MGP A;  1M18 D;  3W97 C;  5DNN C;  5B0Z D;  3LZ0 D;  4KGC A;  1WWI A;  2NQB A;  3TU4 C;  5CPI A;  1P3F C;  4ZBJ B;  3W96 A;  3B0B A;  1AOI C;  3W97 B;  5DNN B;  3A6N A;  4EO5 C;  1Q9C A;  1TAF B;  5B2J A;  3MGP C;  1KX3 C;  1M19 D;  3NQU A;  3R45 A;  5B40 D;  1AOI B;  5DNM C;  4XZQ D;  1TZY A;  1P3B A;  2PYO A;  3TU4 D;  4H9S A;  1P3F D;  4EO5 B;  3W96 C;  3MGP B;  1KX3 B;  2BYK A;  1P3P C;  5DNM B;  4NE5 A;  5B31 A;  3LZ1 C;  3C1C D;  5B2J C;  1A7W A;  5CPI B;  1B67 A;  3AZL A;  5CPJ D;  3KXB D;  1KX3 D;  1F66 C;  3B6F C;  3W96 B;  3C1B A;  1JFI A;  3X1T A;  1P3B C;  1ID3 D;  5CP6 A;  2PYO C;  4H9S C;  4Z5T A;  4KUD C;  5B2J B;  3W99 A;  3MNN D;  1P34 A;  1F66 B;  3R45 B;  1P3P D;  1KX4 A;  5B31 C;  4QLC C;  1P3B B;  3LZ1 D;  4YS3 D;  1EQZ A;  2PYO B;  3MGR A;  3AZL C;  4KUD B;  3B6F D;  1P3O C;  2BYK B;  5BO0 A;  3X1T C;  5B31 B;  4QLC B;  4Z66 A;  4KUD D;  5B1L A;  2F8N D;  3X1V D;  3AZL B;  1P34 C;  1S32 A;  3UTA D;  1P3L D;  1P3O B;  1JFI B;  1KX4 C;  4UUZ A;  3X1T B;  1EQZ C;  2YFW A;  3AFA A;  4WU9 C;  1P3O D;  1P34 B;  4H9R A;  5AV9 A;  1HTA A;  2HIO C;  5AY8 A;  4J8W D;  1KX4 B;  4Z66 C;  1EQZ B;  5B1M A;  4WU9 B;  3REI C;  3REL A;  5BO0 B;  3X1U A;  4Z66 B;  4WU9 D;  1ULY A;  5GSU D;  3WA9 A;  4M6B A;  3WAA D;  4WU8 C;  3REH D;  2HIO D;  3REI B;  2YFW B;  2CV5 C;  3REK A;  4LD9 A;  3LJA C;  5B1M C;  3UTA A;  1ZLA A;  3AV1 C;  4JJN A;  3REI D;  3REL C;  1BH8 A;  4WU8 B;  5AY8 B;  5B1M B;  3WA9 C;  1M1A A;  5F99 A;  3AV1 B;  4WU8 D;  3REL B;  2CV5 D;  5AV8 D;  3LJA D;  3V9R A;  5FUG A;  3AZE C;  5BS7 A;  3AZH C;  3AZI D;  3WA9 B;  1P3M D;  4Z2M G;  3UTA B;  5AVB D;  1M18 A;  3AZH B;  3AN2 C;  5AVC C;  4WV4 B;  4DRB A;  5B0Z A;  3LZ0 A;  4JJN B;  1BH8 B;  2F8N G;  4G91 C;  3AZM C;  4AWL C;  3AZE D;  3LEL D;  5BS7 C;  3AZH D;  3REJ D;  4X23 D;  2BYM A;  3AN2 B;  5AVC B;  3MGQ C;  3VH6 T;  4WZS B;  4G92 B;  3AYW D;  4G91 B;  4J8X D;  1M18 C;  1P3K D;  3AN2 D;  5AVC D;  2ARO D;  5B40 A;  3LZ0 C;  4XZQ A;  3MGQ B;  3AZM D;  5B33 D;  3TU4 A;  3UTB C;  1P3F A;  1M18 B;  5B24 C;  3MGQ D;  5B0Z B;  3LZ0 B;  1P3G D;  3C1C A;  5CPJ A;  3KXB A;  1M19 C;  1KX3 A;  4KHA A;  3B6G C;  2BYM B;  5B2I C;  5B40 C;  3B0C W;  4XZQ C;  5DNM A;  1ID3 A;  3UTB D;  1U35 C;  4CSR A;  3MNN A;  5B24 D;  1M19 B;  3AZG D;  4YM6 C;  3B6G B;  4NE6 A;  2FJ7 D;  5B40 B;  1P3P A;  4XZQ B;  3LZ1 A;  4YS3 A;  3AV2 D;  3C1C C;  3TU4 B;  1KX5 D;  1P3F B;  5CPJ C;  3KXB C;  1F66 A;  3B6F A;  1BH9 A;  3B6G D;  5BNV A;  5B2I D;  4YM6 B;  1ID3 C;  5G49 A;  4KUD A;  3C1C B;  1U35 D;  2F8N A;  3MNN C;  3X1V A;  5CPJ B;  3KXB B;  1P3A C;  1P3I C;  4YM6 D;  4KHA B;  4QLC A;  1ID3 B;  4YS3 C;  3O62 C;  4CSR B;  3MNN B;  1P3O A;  1P3I B;  2RVQ C;  3MGS D;  1P3P B;  4J8W A;  2YFV A;  3LZ1 B;  3KWQ D;  4YS3 B;  3X1V C;  5C3I C;  1P3A D;  1P3I D;  3B6F B;  1BH9 B;  1P3L C;  5CHL B;  3WTP E;  5BNV B;  2F8N H;  5G49 B;  3O62 D;  4J8U D;  4WU9 A;  2F8N B;  3X1V B;  3KSY A;  5C3I B;  3MVD D;  1P3L B;  2RVQ D;  4H9O A;  2HIO A;  5E5A D;  4J8W C;  5GT0 D;  2HUE C;  3REI A;  3WKJ C;  4J8W B;  2YFV B;  5JRG D;  5GSU C;  5AV5 D;  3WAA C;  4WU8 A;  2HUE B;  3REH C;  3WKJ B;  2CV5 A;  3LJA A;  5GSU B;  5B32 D;  3AV1 A;  5B0Y C;  3WAA B;  1HQ3 C;  1TZY D;  4H9O B;  3REH B;  1P3M A;  2HIO B;  3WKJ D;  3W98 D;  4ZUX C;  3VH5 A;  3VH5 W;  5AVB A;  5BT1 D;  2NZD C;  5AV8 C;  3AZE A;  2LY8 A;  3LEL A;  5CPK D;  3AZI C;  3AZH A;  3C1B D;  3REJ A;  5B0Y D;  1HQ3 D;  1P3M C;  2NZD B;  4ZUX D;  3AYW A;  2CV5 B;  5AV8 B;  3KUY D;  1F1E A;  3LJA B;  4J8X A;  5AVB C;  5GXQ C;  3AZI B;  1P3K A;  3AN2 A;  5AVC A;  2ARO A;  3WTP C;  4J8V C;  2NZD D;  4CAY A;  1P3M B;  3AZM A;  3MGR D;  4H9P A;  4DRA A;  3LEL C;  4XUJ C;  3REJ C;  5GXQ B;  5AVB B;  4X23 C;  4E45 A;  3UT9 C;  3MGQ A;  3WTP B;  5AV6 C;  3B0D C;  3AYW C;  1P3G A;  5B1L D;  3AZF D;  3AZE B;  3LEL B;  4J8X C;  5GXQ D;  1S32 D;  1P3K C;  3REJ B;  2ARO C;  4X23 B;  3WTP D;  4J8V D;  5AV6 B;  3AFA D;  5B33 C;  3B0D B;  3UTB A;  3AYW B;  4XUJ D;  4J8X B;  5B24 A;  1P3K B;  5AV9 D;  3UT9 D;  3AZJ D;  2FJ7 A;  2ARO B;  5AV6 D;  4R8P D;  4CAY B;  1P3G C;  3AZM B;  4WNN B;  4H9P B;  5B33 B;  4AWL B;  3AV2 A;  1KX5 A;  5GT3 C;  1M19 A;  3B6G A;  3B0C T;  5B2I A;  3X1S C;  3X1U D;  2IO5 C;  5B32 G;  1P3G B;  1U35 A;  3AZG C;  1N1J B;  4H9Q A;  4YM6 A;  2FJ7 C;  4H9N B;  2F8N K;  3AV2 C;  3UTB B;  3AZN C;  1KX5 C;  1ZLA D;  5GT3 D;  5B24 B;  3AZG B;  2FJ7 B;  3MGS A;  3X1S D;  3KWQ A;  3AV2 B;  1KX5 B;  3AZN B;  1P3A A;  1P3I A;  5B2I B;  3O62 A;  3REK C;  3AZN D;  3AZK D;  1U35 B;  2CWE A;  4H9Q B;  3MGS C;  5E5A A;  3KWQ C;  3REK B;  5GT0 A;  1P3L A;  3MGS B;  1B6W A;  4J8U C;  3REK D;  3KWQ B;  3NQJ A;  5JRG A;  5AV5 A;  1P3A B;  3MVD C;  4Z2M H;  5E5A C;  3O62 B;  4J8U B;  5GT0 C;  5B32 A;  3W97 D;  5DNN D;  4KGC C;  3MVD B;  3WKJ A;  2NQB C;  1WWS A;  5E5A B;  5CPI C;  3W98 A;  4E44 A;  5GSU A;  5JRG C;  5AV5 C;  1R4V A;  1AOI D;  5GT0 B;  3WAA A;  4NFT A;  3A6N C;  3REH A;  4KGC B;  2NQB B;  3MGP D;  5CPK A;  3NQJ B;  5JRG B;  5B32 C;  5AV5 B;  4KGC D;  5B0Y A;  5DNM D;  1HQ3 A;  1TZY C;  3A6N B;  2NQB D;  1BFM A;  5CPI D;  3W98 C;  4ZUX A;  3W96 D;  3KUY A;  3VH5 T;  3NQU B;  5BT1 C;  5B32 B;  3A6N D;  1TZY B;  2NZD A;  5B2J D;  5AV8 A;  3W98 B;  1F66 D;  5CPK C;  3AZI A;  3C1B C;  1P3B D;  5CP6 C;  2PYO D;  4Z5T C;  3W99 C;  3KUY C;  3AZF A;  5CPK B;  5GXQ A;  3C1B B;  5B0Y B;  3WTP A;  4J8V A;  5B31 D;  1HQ3 B;  4QLC D;  5CP6 B;  5BNX A;  4Z5T B;  3MGR C;  4ZUX B;  3AZL D;  3W99 B;  4XUJ A;  5KDM A;  3KUY B;  4X23 A;  3UT9 A;  3AZJ A;  3X1T D;  5CP6 D;  5AV6 A;  4Z5T D;  4R8P A;  5B1L C;  3W99 D;  3MGR B;  3AZF C;  1P34 D;  1S32 C;  1KX4 D;  1EQZ D;  3AFA C;  4WNN A;  5B33 A;  5B1L B;  3AZF B;  1S32 B;  5AV9 C;  3AZJ C;  5AY8 C;  4J8V B;  4UUZ B;  4Z66 D;  4R8P C;  5BNX B;  3AFA B;  5GT3 A;  4XUJ B;  1N1J A;  5KDM B;  4H9N A;  4H9R B;  5AV9 B;  3UT9 B;  3AZJ B;  3X1S A;  3X1U C;  4R8P B;  3AZG A;  5AY8 D;  4LD9 C;  3X1U B;  5B1M D;  3UTA C;  3AZN A;  1ZLA C;  3AZK A;  3AV1 D;  4JJN C;  1H3O A;  3REL D;  5JA4 A;  4LD9 B;  2L5A A;  3WA9 D;  1M1A C;  1ZLA B;  5GT3 B;  5F99 C;  4NE3 A;  4G92 C;  4LD9 D;  3X1S B;  2IO5 B; 
#chains in the Genus database with same CATH topology
 3AZK C;  5B31 G;  1M1A B;  4JJN D;  5F99 B;  2Y2K A;  3V9R B;  5FUG B;  4WJ3 C;  1M1A D;  2Y2M A;  3AZK B;  5F99 D;  3W97 A;  5DNN A;  5B0Z C;  1H3O B;  2JSS A;  4HGA C;  1TAF A;  5JA4 B;  4J8U A;  1AOI A;  1KU5 A;  3MVD A;  3VH6 A;  3VH6 W;  4ZBJ C;  4HGA B;  1PZR A;  3MGP A;  1M18 D;  3W97 C;  5DNN C;  5B0Z D;  3LZ0 D;  4KGC A;  1WWI A;  2NQB A;  2Y2H A;  3TU4 C;  5CPI A;  4ZBJ B;  1P3F C;  3W96 A;  2JE5 A;  2UWX A;  3B0B A;  1AOI C;  3W97 B;  5DNN B;  3A6N A;  4EO5 C;  1Q9C A;  1TAF B;  5B2J A;  3MGP C;  1KX3 C;  1M19 D;  3NQU A;  3R45 A;  5B40 D;  1AOI B;  5DNM C;  4XZQ D;  1TZY A;  1P3B A;  2PYO A;  3TU4 D;  4H9S A;  1P3F D;  4EO5 B;  3W96 C;  3MGP B;  1KX3 B;  2BYK A;  1P3P C;  5DNM B;  4NE5 A;  5B31 A;  3LZ1 C;  3C1C D;  5B2J C;  1A7W A;  5CPI B;  1B67 A;  3AZL A;  5CPJ D;  3KXB D;  1KX3 D;  1F66 C;  3B6F C;  3W96 B;  3C1B A;  2G5I C;  1JFI A;  3X1T A;  1P3B C;  1ID3 D;  5CP6 A;  2PYO C;  4H9S C;  4Z5T A;  4KUD C;  5B2J B;  3W99 A;  3MNN D;  1P34 A;  1F66 B;  3R45 B;  1P3P D;  1KX4 A;  5B31 C;  4QLC C;  1P3B B;  3LZ1 D;  4YS3 D;  1EQZ A;  2PYO B;  3MGR A;  3AZL C;  4KUD B;  3B6F D;  1P3O C;  2BYK B;  5BO0 A;  3X1T C;  5B31 B;  4QLC B;  4Z66 A;  2W8S A;  4KUD D;  5B1L A;  2Y2J A;  3X1V D;  3AZL B;  1P34 C;  2F8N D;  1S32 A;  3UTA D;  1P3L D;  1P3O B;  1JFI B;  1KX4 C;  4UUZ A;  3X1T B;  1EQZ C;  2YFW A;  3AFA A;  4WU9 C;  2ZY3 A;  1P3O D;  1P34 B;  4H9R A;  5AV9 A;  1HTA A;  2HIO C;  5AY8 A;  4J8W D;  1KX4 B;  4Z66 C;  1EQZ B;  5B1M A;  4WU9 B;  3EPK A;  3REI C;  3REL A;  5BO0 B;  3X1U A;  4Z66 B;  4WU9 D;  2Y2P A;  1ULY A;  5GSU D;  3WA9 A;  4M6B A;  2XD1 A;  3WAA D;  3EPL A;  4WU8 C;  3REH D;  2HIO D;  3REI B;  2YFW B;  2CV5 C;  3REK A;  4LD9 A;  3LJA C;  5B1M C;  3KFU G;  3UTA A;  1ZLA A;  3AV1 C;  4JJN A;  3REI D;  3REL C;  1BH8 A;  4WU8 B;  5AY8 B;  5B1M B;  3WA9 C;  1M1A A;  5F99 A;  3AV1 B;  4WU8 D;  3REL B;  4UPK A;  2CV5 D;  5AV8 D;  3LJA D;  3V9R A;  5FUG A;  2Y2N A;  3AZE C;  5BS7 A;  3AZH C;  3AZI D;  3WA9 B;  2BG1 A;  1P3M D;  3H0M C;  4Z2M G;  3UTA B;  5AVB D;  1M18 A;  3AZH B;  3AN2 C;  5AVC C;  4WV4 B;  4DRB A;  5B0Z A;  3LZ0 A;  4JJN B;  1BH8 B;  2F8N G;  4G91 C;  3AZM C;  4AWL C;  3AZE D;  3LEL D;  5BS7 C;  3AZH D;  3REJ D;  4X23 D;  2BYM A;  3AN2 B;  5AVC B;  3MGQ C;  3VH6 T;  4WZS B;  4G92 B;  3AYW D;  4G91 B;  1T3U A;  4J8X D;  1M18 C;  1P3K D;  3AN2 D;  5AVC D;  2ARO D;  2DF4 C;  5B40 A;  2FFF B;  4XZQ A;  3LZ0 C;  3MGQ B;  3AZM D;  5B33 D;  3TU4 A;  3UTB C;  1P3F A;  1M18 B;  5B24 C;  3MGQ D;  5B0Z B;  3LZ0 B;  1P3G D;  3C1C A;  5CPJ A;  3KXB A;  1M19 C;  1KX3 A;  4KHA A;  3B6G C;  2BYM B;  5B2I C;  5B40 C;  3B0C W;  4XZQ C;  5DNM A;  1ID3 A;  3UTB D;  1U35 C;  4CSR A;  3MNN A;  5B24 D;  1M19 B;  3AZG D;  4YM6 C;  3B6G B;  4NE6 A;  2FJ7 D;  5B40 B;  1P3P A;  4XZQ B;  3LZ1 A;  4YS3 A;  3AV2 D;  3C1C C;  3TU4 B;  1KX5 D;  1P3F B;  5CPJ C;  3KXB C;  1F66 A;  3B6F A;  1BH9 A;  3B6G D;  5BNV A;  5B2I D;  4YM6 B;  1ID3 C;  5G49 A;  4KUD A;  3C1C B;  1U35 D;  2F8N A;  3MNN C;  3X1V A;  5CPJ B;  3KXB B;  1P3A C;  1P3I C;  4YM6 D;  4KHA B;  2ZY2 A;  4QLC A;  1ID3 B;  4YS3 C;  3O62 C;  4CSR B;  3MNN B;  1P3O A;  1P3I B;  2RVQ C;  3MGS D;  1P3P B;  4J8W A;  2YFV A;  3LZ1 B;  3KWQ D;  4YS3 B;  3X1V C;  5C3I C;  1P3A D;  1P3I D;  3B6F B;  1BH9 B;  1P3L C;  5CHL B;  3WTP E;  5BNV B;  2F8N H;  5G49 B;  3O62 D;  4J8U D;  4WU9 A;  2F8N B;  1W2E A;  3X1V B;  3KSY A;  5C3I B;  3MVD D;  1P3L B;  2RVQ D;  4H9O A;  4DQY B;  2HIO A;  5E5A D;  4J8W C;  2J8P A;  5GT0 D;  2HUE C;  3REI A;  3WKJ C;  4J8W B;  2YFV B;  5JRG D;  5GSU C;  5AV5 D;  3IP4 C;  3WAA C;  4WU8 A;  2HUE B;  3REH C;  3WKJ B;  2CV5 A;  3LJA A;  5GSU B;  5B32 D;  3AV1 A;  5B0Y C;  3WAA B;  1HQ3 C;  1TZY D;  4H9O B;  3REH B;  1P3M A;  2HIO B;  3WKJ D;  3W98 D;  4ZUX C;  3VH5 A;  3VH5 W;  5AVB A;  5BT1 D;  2NZD C;  5AV8 C;  3AZE A;  2LY8 A;  3LEL A;  5CPK D;  3AZI C;  3AZH A;  3C1B D;  3REJ A;  5B0Y D;  1HQ3 D;  1P3M C;  2NZD B;  4ZUX D;  3AYW A;  3H0R C;  2CV5 B;  5AV8 B;  3KUY D;  1F1E A;  3LJA B;  4J8X A;  5AVB C;  5GXQ C;  3AZI B;  1P3K A;  3AN2 A;  5AVC A;  2ARO A;  2Y2I A;  3WTP C;  4J8V C;  2NZD D;  4CAY A;  1P3M B;  3AZM A;  3MGR D;  4H9P A;  4DRA A;  3LEL C;  4XUJ C;  3REJ C;  5GXQ B;  5AVB B;  4X23 C;  4E45 A;  3UT9 C;  3MGQ A;  3WTP B;  5AV6 C;  3B0D C;  3EPH A;  3AYW C;  1P3G A;  5B1L D;  3AZF D;  3AZE B;  3LEL B;  4J8X C;  5GXQ D;  1S32 D;  1P3K C;  3REJ B;  2ARO C;  4X23 B;  3WTP D;  4J8V D;  5AV6 B;  3AFA D;  5B33 C;  3B0D B;  3UTB A;  3AYW B;  4XUJ D;  4J8X B;  5B24 A;  1P3K B;  5AV9 D;  3UT9 D;  3AZJ D;  2FJ7 A;  2ARO B;  2DQN C;  5AV6 D;  4R8P D;  3P5J B;  4CAY B;  3AZM B;  4WNN B;  4H9P B;  5B33 B;  4AWL B;  3AV2 A;  1P3G C;  1KX5 A;  5GT3 C;  1M19 A;  3B6G A;  3B0C T;  5B2I A;  3X1S C;  3X1U D;  2IO5 C;  5B32 G;  1P3G B;  1U35 A;  3H0L C;  3AZG C;  1N1J B;  4H9Q A;  2VQR A;  4YM6 A;  2FJ7 C;  4H9N B;  3EG5 B;  2F8N K;  3AV2 C;  3UTB B;  3AZN C;  1KX5 C;  1ZLA D;  5GT3 D;  5B24 B;  3AZG B;  2FJ7 B;  3MGS A;  3X1S D;  3KWQ A;  3AV2 B;  1KX5 B;  3AZN B;  1P3A A;  1P3I A;  3A1I A;  5B2I B;  3O62 A;  3FDD A;  3REK C;  3AZN D;  3AZK D;  1U35 B;  2CWE A;  4H9Q B;  3MGS C;  5E5A A;  3KWQ C;  3REK B;  5GT0 A;  1P3L A;  3MGS B;  1B6W A;  4J8U C;  3REK D;  3KWQ B;  3NQJ A;  5JRG A;  5AV5 A;  1P3A B;  3MVD C;  2ZM5 A;  4Z2M H;  5E5A C;  3O62 B;  4J8U B;  5GT0 C;  5B32 A;  3W97 D;  5DNN D;  4KGC C;  3MVD B;  3WKJ A;  2NQB C;  1WWS A;  5E5A B;  5CPI C;  3W98 A;  4E44 A;  5GSU A;  5JRG C;  5AV5 C;  1R4V A;  1AOI D;  5GT0 B;  3WAA A;  4NFT A;  3A6N C;  3REH A;  4KGC B;  2NQB B;  3MGP D;  2G5H C;  5CPK A;  3NQJ B;  5JRG B;  5B32 C;  5AV5 B;  4KGC D;  5B0Y A;  5DNM D;  1HQ3 A;  1TZY C;  3A6N B;  2Y2L A;  2NQB D;  1BFM A;  5CPI D;  2Y2O A;  3W98 C;  4ZUX A;  3W96 D;  3KUY A;  3VH5 T;  3NQU B;  5BT1 C;  5B32 B;  3A6N D;  1TZY B;  2NZD A;  5B2J D;  2Y2G A;  5AV8 A;  3W98 B;  1F66 D;  5CPK C;  3AZI A;  3C1B C;  2JCH A;  1P3B D;  5CP6 C;  2PYO D;  2F2A C;  4Z5T C;  3W99 C;  3KUY C;  3AZF A;  3A1K A;  5CPK B;  5GXQ A;  3C1B B;  5B0Y B;  3WTP A;  4J8V A;  5B31 D;  1HQ3 B;  4QLC D;  5CP6 B;  5BNX A;  4Z5T B;  3MGR C;  4ZUX B;  3AZL D;  3W99 B;  4XUJ A;  5KDM A;  3KUY B;  4X23 A;  3UT9 A;  3AZJ A;  3X1T D;  2RIQ A;  5CP6 D;  5AV6 A;  4Z5T D;  3AL0 C;  4R8P A;  5B1L C;  3W99 D;  3MGR B;  3AZF C;  1P34 D;  1S32 C;  2Y2Q A;  1KX4 D;  2ZY5 A;  1EQZ D;  3AFA C;  4WNN A;  5B33 A;  5B1L B;  3AZF B;  1S32 B;  5AV9 C;  3AZJ C;  5AY8 C;  4J8V B;  4UUZ B;  4Z66 D;  4R8P C;  5BNX B;  3AFA B;  3F6T A;  2ZY4 A;  5GT3 A;  4XUJ B;  1N1J A;  5KDM B;  4H9N A;  4H9R B;  5AV9 B;  3UT9 B;  1Z2C B;  3AZJ B;  3X1S A;  3X1U C;  4R8P B;  3AZG A;  5AY8 D;  4LD9 C;  3X1U B;  5B1M D;  3UTA C;  3AZN A;  1ZLA C;  3AZK A;  3AV1 D;  4JJN C;  1H3O A;  3REL D;  3EPJ A;  5JA4 A;  4LD9 B;  2L5A A;  3WA9 D;  1M1A C;  1ZLA B;  2XD5 A;  5GT3 B;  5F99 C;  4NE3 A;  4G92 C;  4LD9 D;  3X1S B;  2IO5 B; 
#chains in the Genus database with same CATH homology
 3AZK C;  5B31 G;  1M1A B;  4JJN D;  5F99 B;  2Y2K A;  3V9R B;  5FUG B;  4WJ3 C;  1M1A D;  2Y2M A;  3AZK B;  5F99 D;  3W97 A;  5DNN A;  5B0Z C;  1H3O B;  2JSS A;  4HGA C;  1TAF A;  5JA4 B;  4J8U A;  1AOI A;  1KU5 A;  3MVD A;  3VH6 A;  3VH6 W;  4ZBJ C;  4HGA B;  1PZR A;  3MGP A;  1M18 D;  3W97 C;  5DNN C;  5B0Z D;  3LZ0 D;  4KGC A;  1WWI A;  2NQB A;  2Y2H A;  3TU4 C;  5CPI A;  4ZBJ B;  1P3F C;  3W96 A;  2JE5 A;  2UWX A;  3B0B A;  1AOI C;  3W97 B;  5DNN B;  3A6N A;  4EO5 C;  1Q9C A;  1TAF B;  5B2J A;  3MGP C;  1KX3 C;  1M19 D;  3NQU A;  3R45 A;  5B40 D;  1AOI B;  5DNM C;  4XZQ D;  1TZY A;  1P3B A;  2PYO A;  3TU4 D;  4H9S A;  1P3F D;  4EO5 B;  3W96 C;  3MGP B;  1KX3 B;  2BYK A;  1P3P C;  5DNM B;  4NE5 A;  5B31 A;  3LZ1 C;  3C1C D;  5B2J C;  1A7W A;  5CPI B;  1B67 A;  3AZL A;  5CPJ D;  3KXB D;  1KX3 D;  1F66 C;  3B6F C;  3W96 B;  3C1B A;  2G5I C;  1JFI A;  3X1T A;  1P3B C;  1ID3 D;  5CP6 A;  2PYO C;  4H9S C;  4Z5T A;  4KUD C;  5B2J B;  3W99 A;  3MNN D;  1P34 A;  1F66 B;  3R45 B;  1P3P D;  1KX4 A;  5B31 C;  4QLC C;  1P3B B;  3LZ1 D;  4YS3 D;  1EQZ A;  2PYO B;  3MGR A;  3AZL C;  4KUD B;  3B6F D;  1P3O C;  2BYK B;  5BO0 A;  3X1T C;  5B31 B;  4QLC B;  4Z66 A;  2W8S A;  4KUD D;  5B1L A;  2Y2J A;  3X1V D;  3AZL B;  1P34 C;  2F8N D;  1S32 A;  3UTA D;  1P3L D;  1P3O B;  1JFI B;  1KX4 C;  4UUZ A;  3X1T B;  1EQZ C;  2YFW A;  3AFA A;  4WU9 C;  2ZY3 A;  1P3O D;  1P34 B;  4H9R A;  5AV9 A;  1HTA A;  2HIO C;  5AY8 A;  4J8W D;  1KX4 B;  4Z66 C;  1EQZ B;  5B1M A;  4WU9 B;  3EPK A;  3REI C;  3REL A;  5BO0 B;  3X1U A;  4Z66 B;  4WU9 D;  2Y2P A;  1ULY A;  5GSU D;  3WA9 A;  4M6B A;  2XD1 A;  3WAA D;  3EPL A;  4WU8 C;  3REH D;  2HIO D;  3REI B;  2YFW B;  2CV5 C;  3REK A;  4LD9 A;  3LJA C;  5B1M C;  3KFU G;  3UTA A;  1ZLA A;  3AV1 C;  4JJN A;  3REI D;  3REL C;  1BH8 A;  4WU8 B;  5AY8 B;  5B1M B;  3WA9 C;  1M1A A;  5F99 A;  3AV1 B;  4WU8 D;  3REL B;  4UPK A;  2CV5 D;  5AV8 D;  3LJA D;  3V9R A;  5FUG A;  2Y2N A;  3AZE C;  5BS7 A;  3AZH C;  3AZI D;  3WA9 B;  2BG1 A;  1P3M D;  3H0M C;  4Z2M G;  3UTA B;  5AVB D;  1M18 A;  3AZH B;  3AN2 C;  5AVC C;  4WV4 B;  4DRB A;  5B0Z A;  3LZ0 A;  4JJN B;  1BH8 B;  2F8N G;  4G91 C;  3AZM C;  4AWL C;  3AZE D;  3LEL D;  5BS7 C;  3AZH D;  3REJ D;  4X23 D;  2BYM A;  3AN2 B;  5AVC B;  3MGQ C;  3VH6 T;  4WZS B;  4G92 B;  3AYW D;  4G91 B;  1T3U A;  4J8X D;  1M18 C;  1P3K D;  3AN2 D;  5AVC D;  2ARO D;  2DF4 C;  5B40 A;  2FFF B;  4XZQ A;  3LZ0 C;  3MGQ B;  3AZM D;  5B33 D;  3TU4 A;  3UTB C;  1P3F A;  1M18 B;  5B24 C;  3MGQ D;  5B0Z B;  3LZ0 B;  1P3G D;  3C1C A;  5CPJ A;  3KXB A;  1M19 C;  1KX3 A;  4KHA A;  3B6G C;  2BYM B;  5B2I C;  5B40 C;  3B0C W;  4XZQ C;  5DNM A;  1ID3 A;  3UTB D;  1U35 C;  4CSR A;  3MNN A;  5B24 D;  1M19 B;  3AZG D;  4YM6 C;  3B6G B;  4NE6 A;  2FJ7 D;  5B40 B;  1P3P A;  4XZQ B;  3LZ1 A;  4YS3 A;  3AV2 D;  3C1C C;  3TU4 B;  1KX5 D;  1P3F B;  5CPJ C;  3KXB C;  1F66 A;  3B6F A;  1BH9 A;  3B6G D;  5BNV A;  5B2I D;  4YM6 B;  1ID3 C;  5G49 A;  4KUD A;  3C1C B;  1U35 D;  2F8N A;  3MNN C;  3X1V A;  5CPJ B;  3KXB B;  1P3A C;  1P3I C;  4YM6 D;  4KHA B;  2ZY2 A;  4QLC A;  1ID3 B;  4YS3 C;  3O62 C;  4CSR B;  3MNN B;  1P3O A;  1P3I B;  2RVQ C;  3MGS D;  1P3P B;  4J8W A;  2YFV A;  3LZ1 B;  3KWQ D;  4YS3 B;  3X1V C;  5C3I C;  1P3A D;  1P3I D;  3B6F B;  1BH9 B;  1P3L C;  5CHL B;  3WTP E;  5BNV B;  2F8N H;  5G49 B;  3O62 D;  4J8U D;  4WU9 A;  2F8N B;  1W2E A;  3X1V B;  3KSY A;  5C3I B;  3MVD D;  1P3L B;  2RVQ D;  4H9O A;  4DQY B;  2HIO A;  5E5A D;  4J8W C;  2J8P A;  5GT0 D;  2HUE C;  3REI A;  3WKJ C;  4J8W B;  2YFV B;  5JRG D;  5GSU C;  5AV5 D;  3IP4 C;  3WAA C;  4WU8 A;  2HUE B;  3REH C;  3WKJ B;  2CV5 A;  3LJA A;  5GSU B;  5B32 D;  3AV1 A;  5B0Y C;  3WAA B;  1HQ3 C;  1TZY D;  4H9O B;  3REH B;  1P3M A;  2HIO B;  3WKJ D;  3W98 D;  4ZUX C;  3VH5 A;  3VH5 W;  5AVB A;  5BT1 D;  2NZD C;  5AV8 C;  3AZE A;  2LY8 A;  3LEL A;  5CPK D;  3AZI C;  3AZH A;  3C1B D;  3REJ A;  5B0Y D;  1HQ3 D;  1P3M C;  2NZD B;  4ZUX D;  3AYW A;  3H0R C;  2CV5 B;  5AV8 B;  3KUY D;  1F1E A;  3LJA B;  4J8X A;  5AVB C;  5GXQ C;  3AZI B;  1P3K A;  3AN2 A;  5AVC A;  2ARO A;  2Y2I A;  3WTP C;  4J8V C;  2NZD D;  4CAY A;  1P3M B;  3AZM A;  3MGR D;  4H9P A;  4DRA A;  3LEL C;  4XUJ C;  3REJ C;  5GXQ B;  5AVB B;  4X23 C;  4E45 A;  3UT9 C;  3MGQ A;  3WTP B;  5AV6 C;  3B0D C;  3EPH A;  3AYW C;  1P3G A;  5B1L D;  3AZF D;  3AZE B;  3LEL B;  4J8X C;  5GXQ D;  1S32 D;  1P3K C;  3REJ B;  2ARO C;  4X23 B;  3WTP D;  4J8V D;  5AV6 B;  3AFA D;  5B33 C;  3B0D B;  3UTB A;  3AYW B;  4XUJ D;  4J8X B;  5B24 A;  1P3K B;  5AV9 D;  3UT9 D;  3AZJ D;  2FJ7 A;  2ARO B;  2DQN C;  5AV6 D;  4R8P D;  3P5J B;  4CAY B;  3AZM B;  4WNN B;  4H9P B;  5B33 B;  4AWL B;  3AV2 A;  1P3G C;  1KX5 A;  5GT3 C;  1M19 A;  3B6G A;  3B0C T;  5B2I A;  3X1S C;  3X1U D;  2IO5 C;  5B32 G;  1P3G B;  1U35 A;  3H0L C;  3AZG C;  1N1J B;  4H9Q A;  2VQR A;  4YM6 A;  2FJ7 C;  4H9N B;  3EG5 B;  2F8N K;  3AV2 C;  3UTB B;  3AZN C;  1KX5 C;  1ZLA D;  5GT3 D;  5B24 B;  3AZG B;  2FJ7 B;  3MGS A;  3X1S D;  3KWQ A;  3AV2 B;  1KX5 B;  3AZN B;  1P3A A;  1P3I A;  3A1I A;  5B2I B;  3O62 A;  3FDD A;  3REK C;  3AZN D;  3AZK D;  1U35 B;  2CWE A;  4H9Q B;  3MGS C;  5E5A A;  3KWQ C;  3REK B;  5GT0 A;  1P3L A;  3MGS B;  1B6W A;  4J8U C;  3REK D;  3KWQ B;  3NQJ A;  5JRG A;  5AV5 A;  1P3A B;  3MVD C;  2ZM5 A;  4Z2M H;  5E5A C;  3O62 B;  4J8U B;  5GT0 C;  5B32 A;  3W97 D;  5DNN D;  4KGC C;  3MVD B;  3WKJ A;  2NQB C;  1WWS A;  5E5A B;  5CPI C;  3W98 A;  4E44 A;  5GSU A;  5JRG C;  5AV5 C;  1R4V A;  1AOI D;  5GT0 B;  3WAA A;  4NFT A;  3A6N C;  3REH A;  4KGC B;  2NQB B;  3MGP D;  2G5H C;  5CPK A;  3NQJ B;  5JRG B;  5B32 C;  5AV5 B;  4KGC D;  5B0Y A;  5DNM D;  1HQ3 A;  1TZY C;  3A6N B;  2Y2L A;  2NQB D;  1BFM A;  5CPI D;  2Y2O A;  3W98 C;  4ZUX A;  3W96 D;  3KUY A;  3VH5 T;  3NQU B;  5BT1 C;  5B32 B;  3A6N D;  1TZY B;  2NZD A;  5B2J D;  2Y2G A;  5AV8 A;  3W98 B;  1F66 D;  5CPK C;  3AZI A;  3C1B C;  2JCH A;  1P3B D;  5CP6 C;  2PYO D;  2F2A C;  4Z5T C;  3W99 C;  3KUY C;  3AZF A;  3A1K A;  5CPK B;  5GXQ A;  3C1B B;  5B0Y B;  3WTP A;  4J8V A;  5B31 D;  1HQ3 B;  4QLC D;  5CP6 B;  5BNX A;  4Z5T B;  3MGR C;  4ZUX B;  3AZL D;  3W99 B;  4XUJ A;  5KDM A;  3KUY B;  4X23 A;  3UT9 A;  3AZJ A;  3X1T D;  2RIQ A;  5CP6 D;  5AV6 A;  4Z5T D;  3AL0 C;  4R8P A;  5B1L C;  3W99 D;  3MGR B;  3AZF C;  1P34 D;  1S32 C;  2Y2Q A;  1KX4 D;  2ZY5 A;  1EQZ D;  3AFA C;  4WNN A;  5B33 A;  5B1L B;  3AZF B;  1S32 B;  5AV9 C;  3AZJ C;  5AY8 C;  4J8V B;  4UUZ B;  4Z66 D;  4R8P C;  5BNX B;  3AFA B;  3F6T A;  2ZY4 A;  5GT3 A;  4XUJ B;  1N1J A;  5KDM B;  4H9N A;  4H9R B;  5AV9 B;  3UT9 B;  1Z2C B;  3AZJ B;  3X1S A;  3X1U C;  4R8P B;  3AZG A;  5AY8 D;  4LD9 C;  3X1U B;  5B1M D;  3UTA C;  3AZN A;  1ZLA C;  3AZK A;  3AV1 D;  4JJN C;  1H3O A;  3REL D;  3EPJ A;  5JA4 A;  4LD9 B;  2L5A A;  3WA9 D;  1M1A C;  1ZLA B;  2XD5 A;  5GT3 B;  5F99 C;  4NE3 A;  4G92 C;  4LD9 D;  3X1S B;  2IO5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...