4J8VB

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vB00
4WU9B 5KDMB 1U35B 3B6GB 4H9NA 3AV2A 1ZLAB 1TZYB 5AV6B 3UTAD 5B24B 1N1JA 4J8XB 1P3LC 3RELD 2AROA 2NZDA 5GT3D 5AV5A 1P3KC 3AFAC 5AY8B 3AZKA 3X1TB 3B6FA 5B33B 1BH9B 4H9SA 3MGPD 5GT3C 2YFWB 5E5AC 1P3FA 3AYWC 3W97A 1HQ3A 4J8VB 4J8WB 3NQJA 4R8PB 3AZGD 1M19C 1KX5A 5GSUD 5GXQC 5B1LD 3REJB 5DNND 1AOID 3UTBA 5DNMD 1M18C 4XZQC 5B0ZD 3MGSC 5AV8B 5BNXB 3AV1D 3MNNA 3AN2A 3REIA 5B40D 1AOIC 3AV2C 5CPKD 1P3BB 3NQUB 4H9RA 5KDMA 5JRGD 3B6GA 5JA4B 5FUGA 1TZYA 2AROC 5B40C 2NZDC 4J8XA 2BYKB 4LD9B 1F66D 1P3MD 5CPJB 3KUYA 3X1SB 3B6FC 3AZKC 4WU8D 4H9SC 4ZUXB 3C1CD 3AZEB 1P3FC 3W96D 3WA9B 3X1VB 3X1TA 1HQ3C 3W97C 5B33A 3REHB 1BH9A 1KX5C 1B6WA 5G49B 4J8WA 4NE5A 2CV5B 1KX4A 2HUEB 4WU9D 4AWLC 3UTBC 1P3LB 1U35D 5B32D 4JJNA 1ZLAD 5AV6D 3MNNC 1H3OA 3AN2C 5B24D 5B31D 5AV8A 4WU9C 1U35C 3B6GC 3LJAB 1P3BA 1TZYC 5AV6C 1P3IB 5E5AB 5JA4A 1WWIA 4J8XC 5BO0A 4J8UA 4XUJA 3MGRA 5AY8D 5AVCA 2NQBB 3AZID 3KUYC 4LD9A 3REKB 5CP6B 4QLCB 5CPJA 4J8VD 4R8PD 4KUDB 3X1TC 1P34D 1HTAA 4NE6A 5B33C 1JFIA 2F8NA 4XZQB 5AV9B 3AZLA 5CHLB 3X1VA 3REHA 3REJD 4J8VC 4J8WC 4H9NB 4R8PC 1N1JB 2RVQC 1KX4C 2YFVB 4JJNC 1P3BD 2NZDB 2JSSA 4Z66B 4YS3D 5AV5B 5AV8C 3LZ1A 1BFMA 2HIOD 3O62B 3W99B 1P3BC 4NE3A 1M1AA 1P3FB 3LJAA 4J8UC 3LZ0B 1P3IA 3X1SD 3NQJB 5BNVA 3X1UD 3AZNA 4ZUXD 3AZED 3WA9D 1P3OD 5GT0D 2NQBA 4LD9C 1ID3A 5CPJC 3X1SC 3REKA 4AWLB 5CP6A 4QLCA 3AZEC 3AZJB 4KUDA 3C1BA 3WA9C 3X1VC 3REHC 3LELA 3AN2B 3R45B 2CV5D 1P3PB 3REIB 5AV9A 1P3LD 2LY8A 1EQZB 4H9RB 3AZHA 5FUGB 3VH5A 5AVBA 1P3KD 2CV5C 2HUEC 3AFAD 2YFVA 3LZ1C 1TAFA 4Z66A 5E5AD 3KUYB 3AYWD 3O62A 3W99A 1M19D 3LJAC 1P3IC 3B0CW 4WNNA 3B0CT 3REKD 3AZNC 5GXQD 3LZ0A 4DRAA 2NQBC 3TU4A 1ID3C 1M18D 4KHAA 4XZQD 3MGSD 1KX4B 3REKC 4Z5TB 5CP6C 4QLCC 2F8NG 4JJNB 3AV2D 3MGQA 4KUDC 1H3OB 3LELC 3AZJA 5AV9C 2PYOA 2AROD 1P3GA 3R45A 3AZHC 1P3PA 1S32B 2NZDD 1EQZA 5AV5D 5B1MA 4HGAB 4H9PA 2IO5B 5BO0B 4J8UB 4XUJB 3MGRB 5AVCB 3AZKD 3B6FD 4X23A 4Z66C 5AV5C 1P3FD 4KGCB 3W97D 1HQ3D 1KU5A 3LZ0D 3O62C 3W99C 5B2IA 1KX5D 1JFIB 2F8NB 3WAAA 5B0YB 3AZFB 3V9RA 3AZLB 3WKJB 3LZ0C 3WTPE 3B0DB 5B2JA 3UTBD 4YM6B 4G91B 3MNND 2CWEA 3AN2D 3KWQA 3REID 2FJ7B 3MGQC 1B67A 4Z5TA 3B6GD 3AZJC 3LZ1B 2PYOC 1TZYD 5BS7A 3WTPA 1P3PC 3REIC 4J8XD 1EQZC 5CPIA 2L5AA 1M1AB 1S32A 3KUYD 5BNVB 3AZNB 3X1TD 5B33D 3KXBB 1ID3B 2F8NH 4DRBA 4KGCA 1KX3B 1P3AB 4J8WD 3C1BB 3VH6A 3LELB 4G92B 3VH5W 5B0YA 3AZFA 2RVQD 3B0BA 3VH5T 3UTAB 5B2JC 1KX4D 3UT9A 3WKJA 4JJND 3AZHB 3RELB 5AVBB 3KWQC 4YM6A 4CAYA 5AV8D 4Z5TC 4NFTA 2FJ7A 3W98A 5BS7C 1TAFB 4WV4B 3AZMB 3MGPB 5CPIC 4J8UD 4XUJD 5F99B 3MGRD 5AVCD 1S32C 4LD9D 4WNNB 4HGAC 2IO5C 5CPJD 4XUJC 3MGRC 5AVCC 4E45A 2F8ND 3TU4B 4KHAB 4UUZA 3MVDA 4KGCC 3AZLD 4Z2MH 3X1VD 3A6NB 3REHD 3KXBA 5B0ZB 3AV1B 1BH8B 3MGQB 1KX3A 1P3AA 3KSYA 5CPKB 5B0YC 3AZFC 2PYOB 5JRGB 3AZLC 1P3GB 3WKJC 3B0DC 3UTAA 5B1MB 4YM6C 3RELA 3LZ1D 4G91C 4H9PB 1P3MB 4CSRB 2FJ7C 5GT3A 3W98C 4X23B 1M1AD 4WU8B 3LJAD 1P3ID 3AZMA 3MGPA 3AZND 5B2IB 3WAAB 5F99A 1M1AC 3V9RB 2NQBD 1ID3D 3AZGA 5B2JB 5CP6D 4QLCD 5GSUA 3MVDC 4KUDD 3C1BD 5B32B 5B1LA 1AOIA 5DNNA 3KXBC 3LELD 5BT1C 3KWQB 5AV9D 5DNMA 1KX3C 5B31B 1P3AC 3A6NA 5B0ZA 3AV1A 3AZHD 1BH8A 3C1BC 4M6BA 1ULYA 3WTPB 5B40A 5AVBD 4G92C 5CPKA 3UTAC 5CPIB 2BYMB 5JRGA 3RELC 4Z66D 3AZMD 5AVBC 3AZIB 5F99D 3O62D 3W99D 1P3MA 1F66A 4CSRA 3VH6W 3VH6T 4WU8A 3AZMC 1P34B 1R4VA 3MGPC 3C1CA 3W96A 5F99C 3TU4D 4ZBJC 3AZGC 3A6ND 3UT9B 5GSUC 3MGQD 5B1LC 3TU4C 5DNNC 4EO5B 4WU9A 3AZJD 4CAYB 5DNMC 1U35A 5B32A 4YS3B 2F8NK 3A6NC 1P3GD 2PYOD 5B0ZC 3AV1C 1ZLAA 5AV6A 4H9QB 1P3PD 2HIOB 1EQZD 3W98B 5B24A 5B31A 4Z2MG 5B1MD 5CPKC 5JRGC 1P3GC 4H9OB 2BYMA 4X23D 1F1EA 3X1UB 5B1MC 5C3IB 5AY8A 1P3OB 5GT0B 1F66C 1P3MC 3AZIA 2YFWA 5B2ID 3WAAD 4X23C 4WU8C 4UUZB 3MVDB 4J8VA 3C1CC 3W96C 4R8PA 1P34A 5B2JD 5B2IC 3WAAC 3REJA 3KWQD 4Z5TD 1P3KB 5BNXA 3AFAB 3MGSA 5B32C 3WTPD 1ZLAC 3NQUA 5GT3B 5CPID 5B24C 5B31C 4YS3A 3AYWB 1WWSA 4H9QA 1S32D 2HIOA 1M19B 3WTPC 2BYKA 5GXQB 4H9OA 1Q9CA 5AY8C 3X1SA 4ZBJB 3X1UA 3AZGB 4KGCD 4ZUXA 3AZIC 1M18B 3MGSB 3AZEA 3WA9A 1P3OA 5GT0A 5GSUB 5B1LB 1AOIB 5DNNB 3AV2B 5B0YD 3AZFD 1P34C 4E44A 5DNMB 3UT9D 5G49A 3WKJD 2AROB 3REJC 2CV5A 1A7WA 5B40B 1P3LA 4YM6D 4WZSB 3UT9C 2FJ7D 3W98D 1P3KA 5B32G 3AZKB 3B6FB 4EO5C 3AFAA 4YS3C 5B31G 3W97B 1HQ3B 1F66B 2HIOC 5E5AA 3AYWA 1KX5B 3C1CB 3W96B 1M19A 3MVDD 3X1UC 3UTBB 5GXQA 4ZUXC 5C3IC 3KXBD 5BT1D 1P3OC 5GT0C 3MNNB 1KX3D 1P3AD 1M18A 4XZQA
chains in the Genus database with same CATH superfamily
4WU9B 5KDMB 1U35B 3B6GB 4H9NA 3AV2A 1ZLAB 1TZYB 5AV6B 3UTAD 5B24B 1N1JA 3A1KA 4J8XB 1P3LC 3RELD 2AROA 2NZDA 5GT3D 5AV5A 1P3KC 3AFAC 5AY8B 2G5IC 3AZKA 3X1TB 3B6FA 5B33B 1BH9B 4H9SA 3MGPD 5GT3C 2YFWB 5E5AC 1P3FA 3AYWC 3W97A 1HQ3A 4J8VB 4J8WB 3NQJA 4R8PB 3AZGD 1M19C 1KX5A 5GSUD 5GXQC 2W8SA 5B1LD 3REJB 5DNND 1AOID 3UTBA 5DNMD 1M18C 4XZQC 5B0ZD 3MGSC 5AV8B 5BNXB 3AV1D 3MNNA 3AN2A 3REIA 5B40D 1AOIC 3AV2C 5CPKD 1P3BB 3NQUB 4H9RA 5KDMA 5JRGD 3B6GA 5JA4B 5FUGA 1TZYA 2AROC 5B40C 2NZDC 4J8XA 2BYKB 4LD9B 3FDDA 1F66D 1P3MD 5CPJB 3EPHA 3KUYA 3X1SB 3B6FC 3AZKC 1Z2CB 4WU8D 4H9SC 4ZUXB 3C1CD 3AZEB 1P3FC 3EPLA 3WA9B 3W96D 3X1VB 2ZY4A 1HQ3C 3X1TA 5B33A 3REHB 1BH9A 3W97C 3EG5B 1KX5C 1B6WA 5G49B 4J8WA 4NE5A 2CV5B 1KX4A 2HUEB 4WU9D 4AWLC 3UTBC 1P3LB 1U35D 5B32D 4JJNA 1ZLAD 5AV6D 3MNNC 1H3OA 3P5JB 3AN2C 5B24D 5B31D 5AV8A 4WU9C 1U35C 3B6GC 3LJAB 1P3BA 1TZYC 5AV6C 1P3IB 5E5AB 5JA4A 1WWIA 4J8XC 5BO0A 4J8UA 4XUJA 3MGRA 5AY8D 5AVCA 2NQBB 3AZID 3KUYC 4LD9A 3REKB 5CP6B 4QLCB 5CPJA 4J8VD 4R8PD 4KUDB 3X1TC 1P34D 1HTAA 4NE6A 2BG1A 5B33C 1JFIA 2F8NA 4XZQB 5AV9B 2JCHA 2VQRA 3AZLA 5CHLB 3X1VA 3REHA 3REJD 4J8VC 4J8WC 4H9NB 4R8PC 2F2AC 1N1JB 2RVQC 2ZY5A 1KX4C 2Y2MA 2YFVB 4JJNC 1P3BD 2ZM5A 2NZDB 2JSSA 4Z66B 4YS3D 5AV5B 1PZRA 5AV8C 3LZ1A 1BFMA 2HIOD 3O62B 3W99B 3AL0C 1P3BC 4NE3A 1M1AA 1P3FB 3LJAA 4J8UC 3LZ0B 1P3IA 3X1SD 3NQJB 5BNVA 3X1UD 3AZNA 4ZUXD 3AZED 2JE5A 3WA9D 1P3OD 5GT0D 2NQBA 4LD9C 1ID3A 5CPJC 3X1SC 3REKA 4AWLB 5CP6A 4QLCA 3AZEC 3AZJB 4KUDA 3C1BA 3WA9C 3X1VC 3REHC 3LELA 3AN2B 3R45B 2CV5D 1P3PB 3REIB 5AV9A 1P3LD 2LY8A 1EQZB 4H9RB 3AZHA 5FUGB 3VH5A 5AVBA 1P3KD 2J8PA 2CV5C 2HUEC 3AFAD 2YFVA 3EPKA 3LZ1C 1TAFA 4Z66A 5E5AD 3KUYB 3AYWD 3O62A 3W99A 1M19D 3LJAC 1P3IC 3B0CW 4WNNA 3B0CT 3REKD 3AZNC 5GXQD 3LZ0A 4DRAA 2NQBC 3TU4A 1ID3C 2DF4C 1M18D 4KHAA 4XZQD 3MGSD 1KX4B 3REKC 4Z5TB 5CP6C 4QLCC 2F8NG 4JJNB 3AV2D 3MGQA 4KUDC 1H3OB 3LELC 4UPKA 3AZJA 5AV9C 2PYOA 2AROD 1P3GA 3R45A 3AZHC 1P3PA 1S32B 2NZDD 1EQZA 5AV5D 5B1MA 4HGAB 4H9PA 2IO5B 5BO0B 4J8UB 4XUJB 3MGRB 5AVCB 3AZKD 3B6FD 4X23A 4Z66C 5AV5C 1P3FD 4KGCB 3W97D 1HQ3D 2Y2KA 1KU5A 3LZ0D 3O62C 3W99C 5B2IA 1KX5D 1JFIB 2F8NB 3WAAA 5B0YB 3AZFB 3V9RA 2DQNC 3AZLB 3WKJB 3LZ0C 3WTPE 3B0DB 5B2JA 3UTBD 4YM6B 4G91B 3MNND 2CWEA 3AN2D 3KWQA 3REID 2FJ7B 3MGQC 1B67A 4Z5TA 3B6GD 3AZJC 3LZ1B 2PYOC 1TZYD 5BS7A 3WTPA 1P3PC 3REIC 4J8XD 1EQZC 5CPIA 2L5AA 1M1AB 1S32A 3H0RC 3KUYD 5BNVB 3AZNB 3X1TD 5B33D 3KXBB 1ID3B 2F8NH 4DRBA 4KGCA 1KX3B 1P3AB 4J8WD 3C1BB 3VH6A 3LELB 4G92B 3VH5W 5B0YA 3AZFA 2RVQD 3B0BA 3VH5T 3UTAB 5B2JC 1KX4D 3UT9A 3WKJA 4JJND 3AZHB 3RELB 3IP4C 4DQYB 5AVBB 3KWQC 4YM6A 4CAYA 5AV8D 4Z5TC 4NFTA 2FJ7A 3W98A 5BS7C 1TAFB 4WV4B 3AZMB 3MGPB 5CPIC 4J8UD 4XUJD 5F99B 3MGRD 5AVCD 1S32C 2Y2OA 4LD9D 4WNNB 4HGAC 2IO5C 5CPJD 4XUJC 3MGRC 5AVCC 4E45A 2F8ND 3TU4B 4KHAB 4UUZA 3MVDA 4KGCC 3AZLD 4Z2MH 3X1VD 3A6NB 3REHD 2RIQA 5B0ZB 3KXBA 3AV1B 1BH8B 3MGQB 1KX3A 1P3AA 3KSYA 5CPKB 5B0YC 3AZFC 2PYOB 5JRGB 3EPJA 3AZLC 1P3GB 3WKJC 3B0DC 3UTAA 5B1MB 4YM6C 3RELA 3LZ1D 4G91C 4H9PB 1P3MB 4CSRB 2FJ7C 5GT3A 3W98C 4X23B 1M1AD 4WU8B 3KFUG 3LJAD 1P3ID 3AZMA 3MGPA 2Y2GA 3AZND 5B2IB 3A1IA 5F99A 3WAAB 2Y2HA 1M1AC 3V9RB 2NQBD 1ID3D 3AZGA 5B2JB 5CP6D 4QLCD 5GSUA 3MVDC 4KUDD 3C1BD 5B32B 4WJ3C 5B1LA 1AOIA 5DNNA 3KXBC 3LELD 5BT1C 3KWQB 3F6TA 5AV9D 5DNMA 1KX3C 5B31B 1P3AC 3A6NA 5B0ZA 3AV1A 3AZHD 1BH8A 3C1BC 4M6BA 1ULYA 3WTPB 5B40A 5AVBD 2Y2IA 4G92C 5CPKA 3UTAC 5CPIB 2BYMB 2FFFB 2Y2JA 5JRGA 3RELC 4Z66D 3AZMD 5AVBC 3AZIB 2Y2LA 5F99D 3O62D 3W99D 1P3MA 1F66A 4CSRA 3VH6W 3VH6T 4WU8A 3AZMC 1P34B 1R4VA 3MGPC 3C1CA 3W96A 5F99C 3TU4D 4ZBJC 3AZGC 3A6ND 3UT9B 5GSUC 3MGQD 2Y2PA 5B1LC 5DNNC 3TU4C 4EO5B 4WU9A 3AZJD 4CAYB 5DNMC 1U35A 5B32A 4YS3B 2F8NK 3A6NC 1P3GD 2PYOD 5B0ZC 3AV1C 1ZLAA 5AV6A 4H9QB 1P3PD 2HIOB 1EQZD 3W98B 5B24A 5B31A 4Z2MG 5B1MD 5CPKC 2ZY2A 5JRGC 1P3GC 4H9OB 2BYMA 4X23D 2XD5A 1F1EA 3X1UB 5B1MC 5C3IB 5AY8A 1P3OB 5GT0B 1F66C 1P3MC 3AZIA 2YFWA 5B2ID 3WAAD 4X23C 4WU8C 4UUZB 3MVDB 2ZY3A 4J8VA 3C1CC 3W96C 4R8PA 1P34A 5B2JD 5B2IC 3WAAC 3REJA 3KWQD 4Z5TD 2Y2NA 1P3KB 5BNXA 3AFAB 3MGSA 5B32C 3WTPD 1ZLAC 3NQUA 5GT3B 5CPID 5B24C 5B31C 4YS3A 3AYWB 1WWSA 4H9QA 1S32D 2HIOA 1M19B 3WTPC 2BYKA 5GXQB 4H9OA 1Q9CA 3H0LC 5AY8C 3X1SA 4ZBJB 3X1UA 3AZGB 4KGCD 4ZUXA 3AZIC 1M18B 3MGSB 3AZEA 3WA9A 1P3OA 5GT0A 3H0MC 2G5HC 5GSUB 5B1LB 1AOIB 5DNNB 3AV2B 5B0YD 3AZFD 1P34C 4E44A 5DNMB 3UT9D 5G49A 3WKJD 2AROB 3REJC 2CV5A 1A7WA 5B40B 1P3LA 4YM6D 4WZSB 1T3UA 3UT9C 2FJ7D 3W98D 1P3KA 5B32G 3AZKB 3B6FB 4EO5C 1W2EA 3AFAA 4YS3C 2XD1A 5B31G 3W97B 1HQ3B 1F66B 2HIOC 5E5AA 3AYWA 1KX5B 2UWXA 2Y2QA 3C1CB 3W96B 1M19A 3MVDD 3X1UC 3UTBB 5GXQA 4ZUXC 5C3IC 3KXBD 5BT1D 1P3OC 5GT0C 3MNNB 1KX3D 1P3AD 1M18A 4XZQA
chains in the Genus database with same CATH topology
4WU9B 5KDMB 1U35B 3B6GB 4H9NA 3AV2A 1ZLAB 1TZYB 5AV6B 3UTAD 5B24B 1N1JA 3A1KA 4J8XB 1P3LC 3RELD 2AROA 2NZDA 5GT3D 5AV5A 1P3KC 3AFAC 5AY8B 2G5IC 3AZKA 3X1TB 3B6FA 5B33B 1BH9B 4H9SA 3MGPD 5GT3C 2YFWB 5E5AC 1P3FA 3AYWC 3W97A 1HQ3A 4J8VB 4J8WB 3NQJA 4R8PB 3AZGD 1M19C 1KX5A 5GSUD 5GXQC 2W8SA 5B1LD 3REJB 5DNND 1AOID 3UTBA 5DNMD 1M18C 4XZQC 5B0ZD 3MGSC 5AV8B 5BNXB 3AV1D 3MNNA 3AN2A 3REIA 5B40D 1AOIC 3AV2C 5CPKD 1P3BB 3NQUB 4H9RA 5KDMA 5JRGD 3B6GA 5JA4B 5FUGA 1TZYA 2AROC 5B40C 2NZDC 4J8XA 2BYKB 4LD9B 3FDDA 1F66D 1P3MD 5CPJB 3EPHA 3KUYA 3X1SB 3B6FC 3AZKC 1Z2CB 4WU8D 4H9SC 4ZUXB 3C1CD 3AZEB 1P3FC 3EPLA 3WA9B 3W96D 3X1VB 2ZY4A 1HQ3C 3X1TA 5B33A 3REHB 1BH9A 3W97C 3EG5B 1KX5C 1B6WA 5G49B 4J8WA 4NE5A 2CV5B 1KX4A 2HUEB 4WU9D 4AWLC 3UTBC 1P3LB 1U35D 5B32D 4JJNA 1ZLAD 5AV6D 3MNNC 1H3OA 3P5JB 3AN2C 5B24D 5B31D 5AV8A 4WU9C 1U35C 3B6GC 3LJAB 1P3BA 1TZYC 5AV6C 1P3IB 5E5AB 5JA4A 1WWIA 4J8XC 5BO0A 4J8UA 4XUJA 3MGRA 5AY8D 5AVCA 2NQBB 3AZID 3KUYC 4LD9A 3REKB 5CP6B 4QLCB 5CPJA 4J8VD 4R8PD 4KUDB 3X1TC 1P34D 1HTAA 4NE6A 2BG1A 5B33C 1JFIA 2F8NA 4XZQB 5AV9B 2JCHA 2VQRA 3AZLA 5CHLB 3X1VA 3REHA 3REJD 4J8VC 4J8WC 4H9NB 4R8PC 2F2AC 1N1JB 2RVQC 2ZY5A 1KX4C 2Y2MA 2YFVB 4JJNC 1P3BD 2ZM5A 2NZDB 2JSSA 4Z66B 4YS3D 5AV5B 1PZRA 5AV8C 3LZ1A 1BFMA 2HIOD 3O62B 3W99B 3AL0C 1P3BC 4NE3A 1M1AA 1P3FB 3LJAA 4J8UC 3LZ0B 1P3IA 3X1SD 3NQJB 5BNVA 3X1UD 3AZNA 4ZUXD 3AZED 2JE5A 3WA9D 1P3OD 5GT0D 2NQBA 4LD9C 1ID3A 5CPJC 3X1SC 3REKA 4AWLB 5CP6A 4QLCA 3AZEC 3AZJB 4KUDA 3C1BA 3WA9C 3X1VC 3REHC 3LELA 3AN2B 3R45B 2CV5D 1P3PB 3REIB 5AV9A 1P3LD 2LY8A 1EQZB 4H9RB 3AZHA 5FUGB 3VH5A 5AVBA 1P3KD 2J8PA 2CV5C 2HUEC 3AFAD 2YFVA 3EPKA 3LZ1C 1TAFA 4Z66A 5E5AD 3KUYB 3AYWD 3O62A 3W99A 1M19D 3LJAC 1P3IC 3B0CW 4WNNA 3B0CT 3REKD 3AZNC 5GXQD 3LZ0A 4DRAA 2NQBC 3TU4A 1ID3C 2DF4C 1M18D 4KHAA 4XZQD 3MGSD 1KX4B 3REKC 4Z5TB 5CP6C 4QLCC 2F8NG 4JJNB 3AV2D 3MGQA 4KUDC 1H3OB 3LELC 4UPKA 3AZJA 5AV9C 2PYOA 2AROD 1P3GA 3R45A 3AZHC 1P3PA 1S32B 2NZDD 1EQZA 5AV5D 5B1MA 4HGAB 4H9PA 2IO5B 5BO0B 4J8UB 4XUJB 3MGRB 5AVCB 3AZKD 3B6FD 4X23A 4Z66C 5AV5C 1P3FD 4KGCB 3W97D 1HQ3D 2Y2KA 1KU5A 3LZ0D 3O62C 3W99C 5B2IA 1KX5D 1JFIB 2F8NB 3WAAA 5B0YB 3AZFB 3V9RA 2DQNC 3AZLB 3WKJB 3LZ0C 3WTPE 3B0DB 5B2JA 3UTBD 4YM6B 4G91B 3MNND 2CWEA 3AN2D 3KWQA 3REID 2FJ7B 3MGQC 1B67A 4Z5TA 3B6GD 3AZJC 3LZ1B 2PYOC 1TZYD 5BS7A 3WTPA 1P3PC 3REIC 4J8XD 1EQZC 5CPIA 2L5AA 1M1AB 1S32A 3H0RC 3KUYD 5BNVB 3AZNB 3X1TD 5B33D 3KXBB 1ID3B 2F8NH 4DRBA 4KGCA 1KX3B 1P3AB 4J8WD 3C1BB 3VH6A 3LELB 4G92B 3VH5W 5B0YA 3AZFA 2RVQD 3B0BA 3VH5T 3UTAB 5B2JC 1KX4D 3UT9A 3WKJA 4JJND 3AZHB 3RELB 3IP4C 4DQYB 5AVBB 3KWQC 4YM6A 4CAYA 5AV8D 4Z5TC 4NFTA 2FJ7A 3W98A 5BS7C 1TAFB 4WV4B 3AZMB 3MGPB 5CPIC 4J8UD 4XUJD 5F99B 3MGRD 5AVCD 1S32C 2Y2OA 4LD9D 4WNNB 4HGAC 2IO5C 5CPJD 4XUJC 3MGRC 5AVCC 4E45A 2F8ND 3TU4B 4KHAB 4UUZA 3MVDA 4KGCC 3AZLD 4Z2MH 3X1VD 3A6NB 3REHD 2RIQA 5B0ZB 3KXBA 3AV1B 1BH8B 3MGQB 1KX3A 1P3AA 3KSYA 5CPKB 5B0YC 3AZFC 2PYOB 5JRGB 3EPJA 3AZLC 1P3GB 3WKJC 3B0DC 3UTAA 5B1MB 4YM6C 3RELA 3LZ1D 4G91C 4H9PB 1P3MB 4CSRB 2FJ7C 5GT3A 3W98C 4X23B 1M1AD 4WU8B 3KFUG 3LJAD 1P3ID 3AZMA 3MGPA 2Y2GA 3AZND 5B2IB 3A1IA 5F99A 3WAAB 2Y2HA 1M1AC 3V9RB 2NQBD 1ID3D 3AZGA 5B2JB 5CP6D 4QLCD 5GSUA 3MVDC 4KUDD 3C1BD 5B32B 4WJ3C 5B1LA 1AOIA 5DNNA 3KXBC 3LELD 5BT1C 3KWQB 3F6TA 5AV9D 5DNMA 1KX3C 5B31B 1P3AC 3A6NA 5B0ZA 3AV1A 3AZHD 1BH8A 3C1BC 4M6BA 1ULYA 3WTPB 5B40A 5AVBD 2Y2IA 4G92C 5CPKA 3UTAC 5CPIB 2BYMB 2FFFB 2Y2JA 5JRGA 3RELC 4Z66D 3AZMD 5AVBC 3AZIB 2Y2LA 5F99D 3O62D 3W99D 1P3MA 1F66A 4CSRA 3VH6W 3VH6T 4WU8A 3AZMC 1P34B 1R4VA 3MGPC 3C1CA 3W96A 5F99C 3TU4D 4ZBJC 3AZGC 3A6ND 3UT9B 5GSUC 3MGQD 2Y2PA 5B1LC 5DNNC 3TU4C 4EO5B 4WU9A 3AZJD 4CAYB 5DNMC 1U35A 5B32A 4YS3B 2F8NK 3A6NC 1P3GD 2PYOD 5B0ZC 3AV1C 1ZLAA 5AV6A 4H9QB 1P3PD 2HIOB 1EQZD 3W98B 5B24A 5B31A 4Z2MG 5B1MD 5CPKC 2ZY2A 5JRGC 1P3GC 4H9OB 2BYMA 4X23D 2XD5A 1F1EA 3X1UB 5B1MC 5C3IB 5AY8A 1P3OB 5GT0B 1F66C 1P3MC 3AZIA 2YFWA 5B2ID 3WAAD 4X23C 4WU8C 4UUZB 3MVDB 2ZY3A 4J8VA 3C1CC 3W96C 4R8PA 1P34A 5B2JD 5B2IC 3WAAC 3REJA 3KWQD 4Z5TD 2Y2NA 1P3KB 5BNXA 3AFAB 3MGSA 5B32C 3WTPD 1ZLAC 3NQUA 5GT3B 5CPID 5B24C 5B31C 4YS3A 3AYWB 1WWSA 4H9QA 1S32D 2HIOA 1M19B 3WTPC 2BYKA 5GXQB 4H9OA 1Q9CA 3H0LC 5AY8C 3X1SA 4ZBJB 3X1UA 3AZGB 4KGCD 4ZUXA 3AZIC 1M18B 3MGSB 3AZEA 3WA9A 1P3OA 5GT0A 3H0MC 2G5HC 5GSUB 5B1LB 1AOIB 5DNNB 3AV2B 5B0YD 3AZFD 1P34C 4E44A 5DNMB 3UT9D 5G49A 3WKJD 2AROB 3REJC 2CV5A 1A7WA 5B40B 1P3LA 4YM6D 4WZSB 1T3UA 3UT9C 2FJ7D 3W98D 1P3KA 5B32G 3AZKB 3B6FB 4EO5C 1W2EA 3AFAA 4YS3C 2XD1A 5B31G 3W97B 1HQ3B 1F66B 2HIOC 5E5AA 3AYWA 1KX5B 2UWXA 2Y2QA 3C1CB 3W96B 1M19A 3MVDD 3X1UC 3UTBB 5GXQA 4ZUXC 5C3IC 3KXBD 5BT1D 1P3OC 5GT0C 3MNNB 1KX3D 1P3AD 1M18A 4XZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 B;  5KDM B;  1U35 B;  3B6G B;  4H9N A;  3AV2 A;  1ZLA B;  1TZY B;  5AV6 B;  3UTA D;  5B24 B;  1N1J A;  4J8X B;  1P3L C;  3REL D;  2ARO A;  2NZD A;  5GT3 D;  5AV5 A;  1P3K C;  3AFA C;  5AY8 B;  3AZK A;  3X1T B;  3B6F A;  5B33 B;  1BH9 B;  4H9S A;  3MGP D;  5GT3 C;  2YFW B;  5E5A C;  1P3F A;  3AYW C;  3W97 A;  1HQ3 A;  4J8V B;  4J8W B;  3NQJ A;  4R8P B;  3AZG D;  1M19 C;  1KX5 A;  5GSU D;  5GXQ C;  5B1L D;  3REJ B;  5DNN D;  1AOI D;  3UTB A;  5DNM D;  1M18 C;  4XZQ C;  5B0Z D;  3MGS C;  5AV8 B;  5BNX B;  3AV1 D;  3MNN A;  3AN2 A;  3REI A;  5B40 D;  1AOI C;  3AV2 C;  5CPK D;  1P3B B;  3NQU B;  4H9R A;  5KDM A;  5JRG D;  3B6G A;  5JA4 B;  5FUG A;  1TZY A;  2ARO C;  5B40 C;  2NZD C;  4J8X A;  2BYK B;  4LD9 B;  1F66 D;  1P3M D;  5CPJ B;  3KUY A;  3X1S B;  3B6F C;  3AZK C;  4WU8 D;  4H9S C;  4ZUX B;  3C1C D;  3AZE B;  1P3F C;  3W96 D;  3WA9 B;  3X1V B;  3X1T A;  1HQ3 C;  3W97 C;  5B33 A;  3REH B;  1BH9 A;  1KX5 C;  1B6W A;  5G49 B;  4J8W A;  4NE5 A;  2CV5 B;  1KX4 A;  2HUE B;  4WU9 D;  4AWL C;  3UTB C;  1P3L B;  1U35 D;  5B32 D;  4JJN A;  1ZLA D;  5AV6 D;  3MNN C;  1H3O A;  3AN2 C;  5B24 D;  5B31 D;  5AV8 A;  4WU9 C;  1U35 C;  3B6G C;  3LJA B;  1P3B A;  1TZY C;  5AV6 C;  1P3I B;  5E5A B;  5JA4 A;  1WWI A;  4J8X C;  5BO0 A;  4J8U A;  4XUJ A;  3MGR A;  5AY8 D;  5AVC A;  2NQB B;  3AZI D;  3KUY C;  4LD9 A;  3REK B;  5CP6 B;  4QLC B;  5CPJ A;  4J8V D;  4R8P D;  4KUD B;  3X1T C;  1P34 D;  1HTA A;  4NE6 A;  5B33 C;  1JFI A;  2F8N A;  4XZQ B;  5AV9 B;  3AZL A;  5CHL B;  3X1V A;  3REH A;  3REJ D;  4J8V C;  4J8W C;  4H9N B;  4R8P C;  1N1J B;  2RVQ C;  1KX4 C;  2YFV B;  4JJN C;  1P3B D;  2NZD B;  2JSS A;  4Z66 B;  4YS3 D;  5AV5 B;  5AV8 C;  3LZ1 A;  1BFM A;  2HIO D;  3O62 B;  3W99 B;  1P3B C;  4NE3 A;  1M1A A;  1P3F B;  3LJA A;  4J8U C;  3LZ0 B;  1P3I A;  3X1S D;  3NQJ B;  5BNV A;  3X1U D;  3AZN A;  4ZUX D;  3AZE D;  3WA9 D;  1P3O D;  5GT0 D;  2NQB A;  4LD9 C;  1ID3 A;  5CPJ C;  3X1S C;  3REK A;  4AWL B;  5CP6 A;  4QLC A;  3AZE C;  3AZJ B;  4KUD A;  3C1B A;  3WA9 C;  3X1V C;  3REH C;  3LEL A;  3AN2 B;  3R45 B;  2CV5 D;  1P3P B;  3REI B;  5AV9 A;  1P3L D;  2LY8 A;  1EQZ B;  4H9R B;  3AZH A;  5FUG B;  3VH5 A;  5AVB A;  1P3K D;  2CV5 C;  2HUE C;  3AFA D;  2YFV A;  3LZ1 C;  1TAF A;  4Z66 A;  5E5A D;  3KUY B;  3AYW D;  3O62 A;  3W99 A;  1M19 D;  3LJA C;  1P3I C;  3B0C W;  4WNN A;  3B0C T;  3REK D;  3AZN C;  5GXQ D;  3LZ0 A;  4DRA A;  2NQB C;  3TU4 A;  1ID3 C;  1M18 D;  4KHA A;  4XZQ D;  3MGS D;  1KX4 B;  3REK C;  4Z5T B;  5CP6 C;  4QLC C;  2F8N G;  4JJN B;  3AV2 D;  3MGQ A;  4KUD C;  1H3O B;  3LEL C;  3AZJ A;  5AV9 C;  2PYO A;  2ARO D;  1P3G A;  3R45 A;  3AZH C;  1P3P A;  1S32 B;  2NZD D;  1EQZ A;  5AV5 D;  5B1M A;  4HGA B;  4H9P A;  2IO5 B;  5BO0 B;  4J8U B;  4XUJ B;  3MGR B;  5AVC B;  3AZK D;  3B6F D;  4X23 A;  4Z66 C;  5AV5 C;  1P3F D;  4KGC B;  3W97 D;  1HQ3 D;  1KU5 A;  3LZ0 D;  3O62 C;  3W99 C;  5B2I A;  1KX5 D;  1JFI B;  2F8N B;  3WAA A;  5B0Y B;  3AZF B;  3V9R A;  3AZL B;  3WKJ B;  3LZ0 C;  3WTP E;  3B0D B;  5B2J A;  3UTB D;  4YM6 B;  4G91 B;  3MNN D;  2CWE A;  3AN2 D;  3KWQ A;  3REI D;  2FJ7 B;  3MGQ C;  1B67 A;  4Z5T A;  3B6G D;  3AZJ C;  3LZ1 B;  2PYO C;  1TZY D;  5BS7 A;  3WTP A;  1P3P C;  3REI C;  4J8X D;  1EQZ C;  5CPI A;  2L5A A;  1M1A B;  1S32 A;  3KUY D;  5BNV B;  3AZN B;  3X1T D;  5B33 D;  3KXB B;  1ID3 B;  2F8N H;  4DRB A;  4KGC A;  1KX3 B;  1P3A B;  4J8W D;  3C1B B;  3VH6 A;  3LEL B;  4G92 B;  3VH5 W;  5B0Y A;  3AZF A;  2RVQ D;  3B0B A;  3VH5 T;  3UTA B;  5B2J C;  1KX4 D;  3UT9 A;  3WKJ A;  4JJN D;  3AZH B;  3REL B;  5AVB B;  3KWQ C;  4YM6 A;  4CAY A;  5AV8 D;  4Z5T C;  4NFT A;  2FJ7 A;  3W98 A;  5BS7 C;  1TAF B;  4WV4 B;  3AZM B;  3MGP B;  5CPI C;  4J8U D;  4XUJ D;  5F99 B;  3MGR D;  5AVC D;  1S32 C;  4LD9 D;  4WNN B;  4HGA C;  2IO5 C;  5CPJ D;  4XUJ C;  3MGR C;  5AVC C;  4E45 A;  2F8N D;  3TU4 B;  4KHA B;  4UUZ A;  3MVD A;  4KGC C;  3AZL D;  4Z2M H;  3X1V D;  3A6N B;  3REH D;  3KXB A;  5B0Z B;  3AV1 B;  1BH8 B;  3MGQ B;  1KX3 A;  1P3A A;  3KSY A;  5CPK B;  5B0Y C;  3AZF C;  2PYO B;  5JRG B;  3AZL C;  1P3G B;  3WKJ C;  3B0D C;  3UTA A;  5B1M B;  4YM6 C;  3REL A;  3LZ1 D;  4G91 C;  4H9P B;  1P3M B;  4CSR B;  2FJ7 C;  5GT3 A;  3W98 C;  4X23 B;  1M1A D;  4WU8 B;  3LJA D;  1P3I D;  3AZM A;  3MGP A;  3AZN D;  5B2I B;  3WAA B;  5F99 A;  1M1A C;  3V9R B;  2NQB D;  1ID3 D;  3AZG A;  5B2J B;  5CP6 D;  4QLC D;  5GSU A;  3MVD C;  4KUD D;  3C1B D;  5B32 B;  5B1L A;  1AOI A;  5DNN A;  3KXB C;  3LEL D;  5BT1 C;  3KWQ B;  5AV9 D;  5DNM A;  1KX3 C;  5B31 B;  1P3A C;  3A6N A;  5B0Z A;  3AV1 A;  3AZH D;  1BH8 A;  3C1B C;  4M6B A;  1ULY A;  3WTP B;  5B40 A;  5AVB D;  4G92 C;  5CPK A;  3UTA C;  5CPI B;  2BYM B;  5JRG A;  3REL C;  4Z66 D;  3AZM D;  5AVB C;  3AZI B;  5F99 D;  3O62 D;  3W99 D;  1P3M A;  1F66 A;  4CSR A;  3VH6 W;  3VH6 T;  4WU8 A;  3AZM C;  1P34 B;  1R4V A;  3MGP C;  3C1C A;  3W96 A;  5F99 C;  3TU4 D;  4ZBJ C;  3AZG C;  3A6N D;  3UT9 B;  5GSU C;  3MGQ D;  5B1L C;  3TU4 C;  5DNN C;  4EO5 B;  4WU9 A;  3AZJ D;  4CAY B;  5DNM C;  1U35 A;  5B32 A;  4YS3 B;  2F8N K;  3A6N C;  1P3G D;  2PYO D;  5B0Z C;  3AV1 C;  1ZLA A;  5AV6 A;  4H9Q B;  1P3P D;  2HIO B;  1EQZ D;  3W98 B;  5B24 A;  5B31 A;  4Z2M G;  5B1M D;  5CPK C;  5JRG C;  1P3G C;  4H9O B;  2BYM A;  4X23 D;  1F1E A;  3X1U B;  5B1M C;  5C3I B;  5AY8 A;  1P3O B;  5GT0 B;  1F66 C;  1P3M C;  3AZI A;  2YFW A;  5B2I D;  3WAA D;  4X23 C;  4WU8 C;  4UUZ B;  3MVD B;  4J8V A;  3C1C C;  3W96 C;  4R8P A;  1P34 A;  5B2J D;  5B2I C;  3WAA C;  3REJ A;  3KWQ D;  4Z5T D;  1P3K B;  5BNX A;  3AFA B;  3MGS A;  5B32 C;  3WTP D;  1ZLA C;  3NQU A;  5GT3 B;  5CPI D;  5B24 C;  5B31 C;  4YS3 A;  3AYW B;  1WWS A;  4H9Q A;  1S32 D;  2HIO A;  1M19 B;  3WTP C;  2BYK A;  5GXQ B;  4H9O A;  1Q9C A;  5AY8 C;  3X1S A;  4ZBJ B;  3X1U A;  3AZG B;  4KGC D;  4ZUX A;  3AZI C;  1M18 B;  3MGS B;  3AZE A;  3WA9 A;  1P3O A;  5GT0 A;  5GSU B;  5B1L B;  1AOI B;  5DNN B;  3AV2 B;  5B0Y D;  3AZF D;  1P34 C;  4E44 A;  5DNM B;  3UT9 D;  5G49 A;  3WKJ D;  2ARO B;  3REJ C;  2CV5 A;  1A7W A;  5B40 B;  1P3L A;  4YM6 D;  4WZS B;  3UT9 C;  2FJ7 D;  3W98 D;  1P3K A;  5B32 G;  3AZK B;  3B6F B;  4EO5 C;  3AFA A;  4YS3 C;  5B31 G;  3W97 B;  1HQ3 B;  1F66 B;  2HIO C;  5E5A A;  3AYW A;  1KX5 B;  3C1C B;  3W96 B;  1M19 A;  3MVD D;  3X1U C;  3UTB B;  5GXQ A;  4ZUX C;  5C3I C;  3KXB D;  5BT1 D;  1P3O C;  5GT0 C;  3MNN B;  1KX3 D;  1P3A D;  1M18 A;  4XZQ A; 
#chains in the Genus database with same CATH topology
 4WU9 B;  5KDM B;  1U35 B;  3B6G B;  4H9N A;  3AV2 A;  1ZLA B;  1TZY B;  5AV6 B;  3UTA D;  5B24 B;  1N1J A;  3A1K A;  4J8X B;  1P3L C;  3REL D;  2ARO A;  2NZD A;  5GT3 D;  5AV5 A;  1P3K C;  3AFA C;  5AY8 B;  2G5I C;  3AZK A;  3X1T B;  3B6F A;  5B33 B;  1BH9 B;  4H9S A;  3MGP D;  5GT3 C;  2YFW B;  5E5A C;  1P3F A;  3AYW C;  3W97 A;  1HQ3 A;  4J8V B;  4J8W B;  3NQJ A;  4R8P B;  3AZG D;  1M19 C;  1KX5 A;  5GSU D;  5GXQ C;  2W8S A;  5B1L D;  3REJ B;  5DNN D;  1AOI D;  3UTB A;  5DNM D;  1M18 C;  4XZQ C;  5B0Z D;  3MGS C;  5AV8 B;  5BNX B;  3AV1 D;  3MNN A;  3AN2 A;  3REI A;  5B40 D;  1AOI C;  3AV2 C;  5CPK D;  1P3B B;  3NQU B;  4H9R A;  5KDM A;  5JRG D;  3B6G A;  5JA4 B;  5FUG A;  1TZY A;  2ARO C;  5B40 C;  2NZD C;  4J8X A;  2BYK B;  4LD9 B;  3FDD A;  1F66 D;  1P3M D;  5CPJ B;  3EPH A;  3KUY A;  3X1S B;  3B6F C;  3AZK C;  1Z2C B;  4WU8 D;  4H9S C;  4ZUX B;  3C1C D;  3AZE B;  1P3F C;  3EPL A;  3WA9 B;  3W96 D;  3X1V B;  2ZY4 A;  1HQ3 C;  3X1T A;  5B33 A;  3REH B;  1BH9 A;  3W97 C;  3EG5 B;  1KX5 C;  1B6W A;  5G49 B;  4J8W A;  4NE5 A;  2CV5 B;  1KX4 A;  2HUE B;  4WU9 D;  4AWL C;  3UTB C;  1P3L B;  1U35 D;  5B32 D;  4JJN A;  1ZLA D;  5AV6 D;  3MNN C;  1H3O A;  3P5J B;  3AN2 C;  5B24 D;  5B31 D;  5AV8 A;  4WU9 C;  1U35 C;  3B6G C;  3LJA B;  1P3B A;  1TZY C;  5AV6 C;  1P3I B;  5E5A B;  5JA4 A;  1WWI A;  4J8X C;  5BO0 A;  4J8U A;  4XUJ A;  3MGR A;  5AY8 D;  5AVC A;  2NQB B;  3AZI D;  3KUY C;  4LD9 A;  3REK B;  5CP6 B;  4QLC B;  5CPJ A;  4J8V D;  4R8P D;  4KUD B;  3X1T C;  1P34 D;  1HTA A;  4NE6 A;  2BG1 A;  5B33 C;  1JFI A;  2F8N A;  4XZQ B;  5AV9 B;  2JCH A;  2VQR A;  3AZL A;  5CHL B;  3X1V A;  3REH A;  3REJ D;  4J8V C;  4J8W C;  4H9N B;  4R8P C;  2F2A C;  1N1J B;  2RVQ C;  2ZY5 A;  1KX4 C;  2Y2M A;  2YFV B;  4JJN C;  1P3B D;  2ZM5 A;  2NZD B;  2JSS A;  4Z66 B;  4YS3 D;  5AV5 B;  1PZR A;  5AV8 C;  3LZ1 A;  1BFM A;  2HIO D;  3O62 B;  3W99 B;  3AL0 C;  1P3B C;  4NE3 A;  1M1A A;  1P3F B;  3LJA A;  4J8U C;  3LZ0 B;  1P3I A;  3X1S D;  3NQJ B;  5BNV A;  3X1U D;  3AZN A;  4ZUX D;  3AZE D;  2JE5 A;  3WA9 D;  1P3O D;  5GT0 D;  2NQB A;  4LD9 C;  1ID3 A;  5CPJ C;  3X1S C;  3REK A;  4AWL B;  5CP6 A;  4QLC A;  3AZE C;  3AZJ B;  4KUD A;  3C1B A;  3WA9 C;  3X1V C;  3REH C;  3LEL A;  3AN2 B;  3R45 B;  2CV5 D;  1P3P B;  3REI B;  5AV9 A;  1P3L D;  2LY8 A;  1EQZ B;  4H9R B;  3AZH A;  5FUG B;  3VH5 A;  5AVB A;  1P3K D;  2J8P A;  2CV5 C;  2HUE C;  3AFA D;  2YFV A;  3EPK A;  3LZ1 C;  1TAF A;  4Z66 A;  5E5A D;  3KUY B;  3AYW D;  3O62 A;  3W99 A;  1M19 D;  3LJA C;  1P3I C;  3B0C W;  4WNN A;  3B0C T;  3REK D;  3AZN C;  5GXQ D;  3LZ0 A;  4DRA A;  2NQB C;  3TU4 A;  1ID3 C;  2DF4 C;  1M18 D;  4KHA A;  4XZQ D;  3MGS D;  1KX4 B;  3REK C;  4Z5T B;  5CP6 C;  4QLC C;  2F8N G;  4JJN B;  3AV2 D;  3MGQ A;  4KUD C;  1H3O B;  3LEL C;  4UPK A;  3AZJ A;  5AV9 C;  2PYO A;  2ARO D;  1P3G A;  3R45 A;  3AZH C;  1P3P A;  1S32 B;  2NZD D;  1EQZ A;  5AV5 D;  5B1M A;  4HGA B;  4H9P A;  2IO5 B;  5BO0 B;  4J8U B;  4XUJ B;  3MGR B;  5AVC B;  3AZK D;  3B6F D;  4X23 A;  4Z66 C;  5AV5 C;  1P3F D;  4KGC B;  3W97 D;  1HQ3 D;  2Y2K A;  1KU5 A;  3LZ0 D;  3O62 C;  3W99 C;  5B2I A;  1KX5 D;  1JFI B;  2F8N B;  3WAA A;  5B0Y B;  3AZF B;  3V9R A;  2DQN C;  3AZL B;  3WKJ B;  3LZ0 C;  3WTP E;  3B0D B;  5B2J A;  3UTB D;  4YM6 B;  4G91 B;  3MNN D;  2CWE A;  3AN2 D;  3KWQ A;  3REI D;  2FJ7 B;  3MGQ C;  1B67 A;  4Z5T A;  3B6G D;  3AZJ C;  3LZ1 B;  2PYO C;  1TZY D;  5BS7 A;  3WTP A;  1P3P C;  3REI C;  4J8X D;  1EQZ C;  5CPI A;  2L5A A;  1M1A B;  1S32 A;  3H0R C;  3KUY D;  5BNV B;  3AZN B;  3X1T D;  5B33 D;  3KXB B;  1ID3 B;  2F8N H;  4DRB A;  4KGC A;  1KX3 B;  1P3A B;  4J8W D;  3C1B B;  3VH6 A;  3LEL B;  4G92 B;  3VH5 W;  5B0Y A;  3AZF A;  2RVQ D;  3B0B A;  3VH5 T;  3UTA B;  5B2J C;  1KX4 D;  3UT9 A;  3WKJ A;  4JJN D;  3AZH B;  3REL B;  3IP4 C;  4DQY B;  5AVB B;  3KWQ C;  4YM6 A;  4CAY A;  5AV8 D;  4Z5T C;  4NFT A;  2FJ7 A;  3W98 A;  5BS7 C;  1TAF B;  4WV4 B;  3AZM B;  3MGP B;  5CPI C;  4J8U D;  4XUJ D;  5F99 B;  3MGR D;  5AVC D;  1S32 C;  2Y2O A;  4LD9 D;  4WNN B;  4HGA C;  2IO5 C;  5CPJ D;  4XUJ C;  3MGR C;  5AVC C;  4E45 A;  2F8N D;  3TU4 B;  4KHA B;  4UUZ A;  3MVD A;  4KGC C;  3AZL D;  4Z2M H;  3X1V D;  3A6N B;  3REH D;  2RIQ A;  5B0Z B;  3KXB A;  3AV1 B;  1BH8 B;  3MGQ B;  1KX3 A;  1P3A A;  3KSY A;  5CPK B;  5B0Y C;  3AZF C;  2PYO B;  5JRG B;  3EPJ A;  3AZL C;  1P3G B;  3WKJ C;  3B0D C;  3UTA A;  5B1M B;  4YM6 C;  3REL A;  3LZ1 D;  4G91 C;  4H9P B;  1P3M B;  4CSR B;  2FJ7 C;  5GT3 A;  3W98 C;  4X23 B;  1M1A D;  4WU8 B;  3KFU G;  3LJA D;  1P3I D;  3AZM A;  3MGP A;  2Y2G A;  3AZN D;  5B2I B;  3A1I A;  5F99 A;  3WAA B;  2Y2H A;  1M1A C;  3V9R B;  2NQB D;  1ID3 D;  3AZG A;  5B2J B;  5CP6 D;  4QLC D;  5GSU A;  3MVD C;  4KUD D;  3C1B D;  5B32 B;  4WJ3 C;  5B1L A;  1AOI A;  5DNN A;  3KXB C;  3LEL D;  5BT1 C;  3KWQ B;  3F6T A;  5AV9 D;  5DNM A;  1KX3 C;  5B31 B;  1P3A C;  3A6N A;  5B0Z A;  3AV1 A;  3AZH D;  1BH8 A;  3C1B C;  4M6B A;  1ULY A;  3WTP B;  5B40 A;  5AVB D;  2Y2I A;  4G92 C;  5CPK A;  3UTA C;  5CPI B;  2BYM B;  2FFF B;  2Y2J A;  5JRG A;  3REL C;  4Z66 D;  3AZM D;  5AVB C;  3AZI B;  2Y2L A;  5F99 D;  3O62 D;  3W99 D;  1P3M A;  1F66 A;  4CSR A;  3VH6 W;  3VH6 T;  4WU8 A;  3AZM C;  1P34 B;  1R4V A;  3MGP C;  3C1C A;  3W96 A;  5F99 C;  3TU4 D;  4ZBJ C;  3AZG C;  3A6N D;  3UT9 B;  5GSU C;  3MGQ D;  2Y2P A;  5B1L C;  5DNN C;  3TU4 C;  4EO5 B;  4WU9 A;  3AZJ D;  4CAY B;  5DNM C;  1U35 A;  5B32 A;  4YS3 B;  2F8N K;  3A6N C;  1P3G D;  2PYO D;  5B0Z C;  3AV1 C;  1ZLA A;  5AV6 A;  4H9Q B;  1P3P D;  2HIO B;  1EQZ D;  3W98 B;  5B24 A;  5B31 A;  4Z2M G;  5B1M D;  5CPK C;  2ZY2 A;  5JRG C;  1P3G C;  4H9O B;  2BYM A;  4X23 D;  2XD5 A;  1F1E A;  3X1U B;  5B1M C;  5C3I B;  5AY8 A;  1P3O B;  5GT0 B;  1F66 C;  1P3M C;  3AZI A;  2YFW A;  5B2I D;  3WAA D;  4X23 C;  4WU8 C;  4UUZ B;  3MVD B;  2ZY3 A;  4J8V A;  3C1C C;  3W96 C;  4R8P A;  1P34 A;  5B2J D;  5B2I C;  3WAA C;  3REJ A;  3KWQ D;  4Z5T D;  2Y2N A;  1P3K B;  5BNX A;  3AFA B;  3MGS A;  5B32 C;  3WTP D;  1ZLA C;  3NQU A;  5GT3 B;  5CPI D;  5B24 C;  5B31 C;  4YS3 A;  3AYW B;  1WWS A;  4H9Q A;  1S32 D;  2HIO A;  1M19 B;  3WTP C;  2BYK A;  5GXQ B;  4H9O A;  1Q9C A;  3H0L C;  5AY8 C;  3X1S A;  4ZBJ B;  3X1U A;  3AZG B;  4KGC D;  4ZUX A;  3AZI C;  1M18 B;  3MGS B;  3AZE A;  3WA9 A;  1P3O A;  5GT0 A;  3H0M C;  2G5H C;  5GSU B;  5B1L B;  1AOI B;  5DNN B;  3AV2 B;  5B0Y D;  3AZF D;  1P34 C;  4E44 A;  5DNM B;  3UT9 D;  5G49 A;  3WKJ D;  2ARO B;  3REJ C;  2CV5 A;  1A7W A;  5B40 B;  1P3L A;  4YM6 D;  4WZS B;  1T3U A;  3UT9 C;  2FJ7 D;  3W98 D;  1P3K A;  5B32 G;  3AZK B;  3B6F B;  4EO5 C;  1W2E A;  3AFA A;  4YS3 C;  2XD1 A;  5B31 G;  3W97 B;  1HQ3 B;  1F66 B;  2HIO C;  5E5A A;  3AYW A;  1KX5 B;  2UWX A;  2Y2Q A;  3C1C B;  3W96 B;  1M19 A;  3MVD D;  3X1U C;  3UTB B;  5GXQ A;  4ZUX C;  5C3I C;  3KXB D;  5BT1 D;  1P3O C;  5GT0 C;  3MNN B;  1KX3 D;  1P3A D;  1M18 A;  4XZQ A; 
#chains in the Genus database with same CATH homology
 4WU9 B;  5KDM B;  1U35 B;  3B6G B;  4H9N A;  3AV2 A;  1ZLA B;  1TZY B;  5AV6 B;  3UTA D;  5B24 B;  1N1J A;  3A1K A;  4J8X B;  1P3L C;  3REL D;  2ARO A;  2NZD A;  5GT3 D;  5AV5 A;  1P3K C;  3AFA C;  5AY8 B;  2G5I C;  3AZK A;  3X1T B;  3B6F A;  5B33 B;  1BH9 B;  4H9S A;  3MGP D;  5GT3 C;  2YFW B;  5E5A C;  1P3F A;  3AYW C;  3W97 A;  1HQ3 A;  4J8V B;  4J8W B;  3NQJ A;  4R8P B;  3AZG D;  1M19 C;  1KX5 A;  5GSU D;  5GXQ C;  2W8S A;  5B1L D;  3REJ B;  5DNN D;  1AOI D;  3UTB A;  5DNM D;  1M18 C;  4XZQ C;  5B0Z D;  3MGS C;  5AV8 B;  5BNX B;  3AV1 D;  3MNN A;  3AN2 A;  3REI A;  5B40 D;  1AOI C;  3AV2 C;  5CPK D;  1P3B B;  3NQU B;  4H9R A;  5KDM A;  5JRG D;  3B6G A;  5JA4 B;  5FUG A;  1TZY A;  2ARO C;  5B40 C;  2NZD C;  4J8X A;  2BYK B;  4LD9 B;  3FDD A;  1F66 D;  1P3M D;  5CPJ B;  3EPH A;  3KUY A;  3X1S B;  3B6F C;  3AZK C;  1Z2C B;  4WU8 D;  4H9S C;  4ZUX B;  3C1C D;  3AZE B;  1P3F C;  3EPL A;  3WA9 B;  3W96 D;  3X1V B;  2ZY4 A;  1HQ3 C;  3X1T A;  5B33 A;  3REH B;  1BH9 A;  3W97 C;  3EG5 B;  1KX5 C;  1B6W A;  5G49 B;  4J8W A;  4NE5 A;  2CV5 B;  1KX4 A;  2HUE B;  4WU9 D;  4AWL C;  3UTB C;  1P3L B;  1U35 D;  5B32 D;  4JJN A;  1ZLA D;  5AV6 D;  3MNN C;  1H3O A;  3P5J B;  3AN2 C;  5B24 D;  5B31 D;  5AV8 A;  4WU9 C;  1U35 C;  3B6G C;  3LJA B;  1P3B A;  1TZY C;  5AV6 C;  1P3I B;  5E5A B;  5JA4 A;  1WWI A;  4J8X C;  5BO0 A;  4J8U A;  4XUJ A;  3MGR A;  5AY8 D;  5AVC A;  2NQB B;  3AZI D;  3KUY C;  4LD9 A;  3REK B;  5CP6 B;  4QLC B;  5CPJ A;  4J8V D;  4R8P D;  4KUD B;  3X1T C;  1P34 D;  1HTA A;  4NE6 A;  2BG1 A;  5B33 C;  1JFI A;  2F8N A;  4XZQ B;  5AV9 B;  2JCH A;  2VQR A;  3AZL A;  5CHL B;  3X1V A;  3REH A;  3REJ D;  4J8V C;  4J8W C;  4H9N B;  4R8P C;  2F2A C;  1N1J B;  2RVQ C;  2ZY5 A;  1KX4 C;  2Y2M A;  2YFV B;  4JJN C;  1P3B D;  2ZM5 A;  2NZD B;  2JSS A;  4Z66 B;  4YS3 D;  5AV5 B;  1PZR A;  5AV8 C;  3LZ1 A;  1BFM A;  2HIO D;  3O62 B;  3W99 B;  3AL0 C;  1P3B C;  4NE3 A;  1M1A A;  1P3F B;  3LJA A;  4J8U C;  3LZ0 B;  1P3I A;  3X1S D;  3NQJ B;  5BNV A;  3X1U D;  3AZN A;  4ZUX D;  3AZE D;  2JE5 A;  3WA9 D;  1P3O D;  5GT0 D;  2NQB A;  4LD9 C;  1ID3 A;  5CPJ C;  3X1S C;  3REK A;  4AWL B;  5CP6 A;  4QLC A;  3AZE C;  3AZJ B;  4KUD A;  3C1B A;  3WA9 C;  3X1V C;  3REH C;  3LEL A;  3AN2 B;  3R45 B;  2CV5 D;  1P3P B;  3REI B;  5AV9 A;  1P3L D;  2LY8 A;  1EQZ B;  4H9R B;  3AZH A;  5FUG B;  3VH5 A;  5AVB A;  1P3K D;  2J8P A;  2CV5 C;  2HUE C;  3AFA D;  2YFV A;  3EPK A;  3LZ1 C;  1TAF A;  4Z66 A;  5E5A D;  3KUY B;  3AYW D;  3O62 A;  3W99 A;  1M19 D;  3LJA C;  1P3I C;  3B0C W;  4WNN A;  3B0C T;  3REK D;  3AZN C;  5GXQ D;  3LZ0 A;  4DRA A;  2NQB C;  3TU4 A;  1ID3 C;  2DF4 C;  1M18 D;  4KHA A;  4XZQ D;  3MGS D;  1KX4 B;  3REK C;  4Z5T B;  5CP6 C;  4QLC C;  2F8N G;  4JJN B;  3AV2 D;  3MGQ A;  4KUD C;  1H3O B;  3LEL C;  4UPK A;  3AZJ A;  5AV9 C;  2PYO A;  2ARO D;  1P3G A;  3R45 A;  3AZH C;  1P3P A;  1S32 B;  2NZD D;  1EQZ A;  5AV5 D;  5B1M A;  4HGA B;  4H9P A;  2IO5 B;  5BO0 B;  4J8U B;  4XUJ B;  3MGR B;  5AVC B;  3AZK D;  3B6F D;  4X23 A;  4Z66 C;  5AV5 C;  1P3F D;  4KGC B;  3W97 D;  1HQ3 D;  2Y2K A;  1KU5 A;  3LZ0 D;  3O62 C;  3W99 C;  5B2I A;  1KX5 D;  1JFI B;  2F8N B;  3WAA A;  5B0Y B;  3AZF B;  3V9R A;  2DQN C;  3AZL B;  3WKJ B;  3LZ0 C;  3WTP E;  3B0D B;  5B2J A;  3UTB D;  4YM6 B;  4G91 B;  3MNN D;  2CWE A;  3AN2 D;  3KWQ A;  3REI D;  2FJ7 B;  3MGQ C;  1B67 A;  4Z5T A;  3B6G D;  3AZJ C;  3LZ1 B;  2PYO C;  1TZY D;  5BS7 A;  3WTP A;  1P3P C;  3REI C;  4J8X D;  1EQZ C;  5CPI A;  2L5A A;  1M1A B;  1S32 A;  3H0R C;  3KUY D;  5BNV B;  3AZN B;  3X1T D;  5B33 D;  3KXB B;  1ID3 B;  2F8N H;  4DRB A;  4KGC A;  1KX3 B;  1P3A B;  4J8W D;  3C1B B;  3VH6 A;  3LEL B;  4G92 B;  3VH5 W;  5B0Y A;  3AZF A;  2RVQ D;  3B0B A;  3VH5 T;  3UTA B;  5B2J C;  1KX4 D;  3UT9 A;  3WKJ A;  4JJN D;  3AZH B;  3REL B;  3IP4 C;  4DQY B;  5AVB B;  3KWQ C;  4YM6 A;  4CAY A;  5AV8 D;  4Z5T C;  4NFT A;  2FJ7 A;  3W98 A;  5BS7 C;  1TAF B;  4WV4 B;  3AZM B;  3MGP B;  5CPI C;  4J8U D;  4XUJ D;  5F99 B;  3MGR D;  5AVC D;  1S32 C;  2Y2O A;  4LD9 D;  4WNN B;  4HGA C;  2IO5 C;  5CPJ D;  4XUJ C;  3MGR C;  5AVC C;  4E45 A;  2F8N D;  3TU4 B;  4KHA B;  4UUZ A;  3MVD A;  4KGC C;  3AZL D;  4Z2M H;  3X1V D;  3A6N B;  3REH D;  2RIQ A;  5B0Z B;  3KXB A;  3AV1 B;  1BH8 B;  3MGQ B;  1KX3 A;  1P3A A;  3KSY A;  5CPK B;  5B0Y C;  3AZF C;  2PYO B;  5JRG B;  3EPJ A;  3AZL C;  1P3G B;  3WKJ C;  3B0D C;  3UTA A;  5B1M B;  4YM6 C;  3REL A;  3LZ1 D;  4G91 C;  4H9P B;  1P3M B;  4CSR B;  2FJ7 C;  5GT3 A;  3W98 C;  4X23 B;  1M1A D;  4WU8 B;  3KFU G;  3LJA D;  1P3I D;  3AZM A;  3MGP A;  2Y2G A;  3AZN D;  5B2I B;  3A1I A;  5F99 A;  3WAA B;  2Y2H A;  1M1A C;  3V9R B;  2NQB D;  1ID3 D;  3AZG A;  5B2J B;  5CP6 D;  4QLC D;  5GSU A;  3MVD C;  4KUD D;  3C1B D;  5B32 B;  4WJ3 C;  5B1L A;  1AOI A;  5DNN A;  3KXB C;  3LEL D;  5BT1 C;  3KWQ B;  3F6T A;  5AV9 D;  5DNM A;  1KX3 C;  5B31 B;  1P3A C;  3A6N A;  5B0Z A;  3AV1 A;  3AZH D;  1BH8 A;  3C1B C;  4M6B A;  1ULY A;  3WTP B;  5B40 A;  5AVB D;  2Y2I A;  4G92 C;  5CPK A;  3UTA C;  5CPI B;  2BYM B;  2FFF B;  2Y2J A;  5JRG A;  3REL C;  4Z66 D;  3AZM D;  5AVB C;  3AZI B;  2Y2L A;  5F99 D;  3O62 D;  3W99 D;  1P3M A;  1F66 A;  4CSR A;  3VH6 W;  3VH6 T;  4WU8 A;  3AZM C;  1P34 B;  1R4V A;  3MGP C;  3C1C A;  3W96 A;  5F99 C;  3TU4 D;  4ZBJ C;  3AZG C;  3A6N D;  3UT9 B;  5GSU C;  3MGQ D;  2Y2P A;  5B1L C;  5DNN C;  3TU4 C;  4EO5 B;  4WU9 A;  3AZJ D;  4CAY B;  5DNM C;  1U35 A;  5B32 A;  4YS3 B;  2F8N K;  3A6N C;  1P3G D;  2PYO D;  5B0Z C;  3AV1 C;  1ZLA A;  5AV6 A;  4H9Q B;  1P3P D;  2HIO B;  1EQZ D;  3W98 B;  5B24 A;  5B31 A;  4Z2M G;  5B1M D;  5CPK C;  2ZY2 A;  5JRG C;  1P3G C;  4H9O B;  2BYM A;  4X23 D;  2XD5 A;  1F1E A;  3X1U B;  5B1M C;  5C3I B;  5AY8 A;  1P3O B;  5GT0 B;  1F66 C;  1P3M C;  3AZI A;  2YFW A;  5B2I D;  3WAA D;  4X23 C;  4WU8 C;  4UUZ B;  3MVD B;  2ZY3 A;  4J8V A;  3C1C C;  3W96 C;  4R8P A;  1P34 A;  5B2J D;  5B2I C;  3WAA C;  3REJ A;  3KWQ D;  4Z5T D;  2Y2N A;  1P3K B;  5BNX A;  3AFA B;  3MGS A;  5B32 C;  3WTP D;  1ZLA C;  3NQU A;  5GT3 B;  5CPI D;  5B24 C;  5B31 C;  4YS3 A;  3AYW B;  1WWS A;  4H9Q A;  1S32 D;  2HIO A;  1M19 B;  3WTP C;  2BYK A;  5GXQ B;  4H9O A;  1Q9C A;  3H0L C;  5AY8 C;  3X1S A;  4ZBJ B;  3X1U A;  3AZG B;  4KGC D;  4ZUX A;  3AZI C;  1M18 B;  3MGS B;  3AZE A;  3WA9 A;  1P3O A;  5GT0 A;  3H0M C;  2G5H C;  5GSU B;  5B1L B;  1AOI B;  5DNN B;  3AV2 B;  5B0Y D;  3AZF D;  1P34 C;  4E44 A;  5DNM B;  3UT9 D;  5G49 A;  3WKJ D;  2ARO B;  3REJ C;  2CV5 A;  1A7W A;  5B40 B;  1P3L A;  4YM6 D;  4WZS B;  1T3U A;  3UT9 C;  2FJ7 D;  3W98 D;  1P3K A;  5B32 G;  3AZK B;  3B6F B;  4EO5 C;  1W2E A;  3AFA A;  4YS3 C;  2XD1 A;  5B31 G;  3W97 B;  1HQ3 B;  1F66 B;  2HIO C;  5E5A A;  3AYW A;  1KX5 B;  2UWX A;  2Y2Q A;  3C1C B;  3W96 B;  1M19 A;  3MVD D;  3X1U C;  3UTB B;  5GXQ A;  4ZUX C;  5C3I C;  3KXB D;  5BT1 D;  1P3O C;  5GT0 C;  3MNN B;  1KX3 D;  1P3A D;  1M18 A;  4XZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...