4J8VB

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vB00
3AV2C 4H9OB 3X1TA 5AV6B 3REJD 1P3BA 3NQUB 5JRGD 1EQZA 4KUDC 1BH9A 3UTBD 3KUYA 1KX5C 3X1SD 2FJ7B 3AZHA 5B24C 1M1AB 4H9QB 4YS3D 3VH5W 2AROD 3UT9D 1P3OB 3B6FA 4XUJC 1HQ3D 3REHA 1M19A 2F8NB 2NQBA 1ID3B 3W99A 5B31D 3X1VC 3W97D 3REJA 3UTBA 4J8WC 4YM6B 3AZJC 5AV8D 4R8PC 4ZUXD 5CPIB 3AV1A 1A7WA 1JFIA 1P3FA 4YS3A 2AROA 1Q9CA 3LELB 5B2IB 5GT0A 5CPJC 4Z66B 2BYMB 3VH6T 3AN2D 1P3AA 5B32C 1ZLAC 2NZDA 3MVDB 1U35C 5CP6C 2LY8A 4UUZB 4J8VC 5AVCB 5B31A 3WA9D 3WTPB 3AZGD 1HTAA 3UTAC 5AV8A 3X1UD 2CV5D 4LD9B 3B0DC 3O62C 3WKJA 5GXQD 3AN2A 5AVBB 4Z5TA 3AZKA 4J8UA 5AV5B 3REKB 3AZLD 5GT3B 3W98B 3MGRB 4ZBJB 3X1UA 1P3MD 4WZSB 4KHAA 5CPKC 3NQJB 1AOID 3AZEA 5AV6C 3LZ0D 3KWQB 4XZQD 3A6NB 5B33B 2FJ7C 1P34B 2PYOB 5BO0A 1M1AC 3AZLA 1BH8A 4CAYB 5B2JB 3LJAB 1P3MA 4X23A 3MNNA 3KXBA 3AZMB 3AZID 3V9RA 1TZYC 5B24B 4YM6C 3MGQA 5CPIC 3RELB 1P3GD 3C1BD 3MGSB 3VH6W 4QLCD 3LELC 5B2IC 3LZ1D 5KDMA 3WAAD 3MVDC 5B0YC 5DNND 4KGCD 4JJNA 5B40D 5F99D 3WTPC 3TU4A 4R8PB 5AV9A 1P3PB 5E5AB 5B1MB 1P3GA 5CPJB 3W96A 2YFVB 3AV2A 3AYWB 4KUDA 4WU8B 5AVBC 5CP6B 1U35B 4J8VB 5AY8D 1F66C 3C1CC 1KX5A 3REKC 1B6WA 5GSUD 5GT3C 3W98C 4WV4B 3UTAB 1S32C 4CSRA 3MGRC 1KX3D 1KX4D 5BS7C 1H3OB 3REIB 4J8XB 4WU9A 4XUJA 1P3KD 1P3IC 4H9PA 5B1LB 1P3BD 1EQZD 3KUYD 3X1VA 3B6GD 5BNVB 4J8WA 3A6NC 3AZJA 3AZHD 2HIOB 4G91C 5FUGB 1P34C 3AZFC 4E44A 4H9RB 1KX3A 5B2JC 4Z2MH 3LJAC 2YFWA 3REHD 1M19D 5CPKB 5B32A 1ZLAA 1B67A 3W99D 4WNNA 2F8NH 3AZMC 3AFAB 3B6GA 3AV1D 1P3FD 1TAFA 3MGPC 5DNMC 3RELC 3MGSC 5GT0D 3B0CW 4DRAA 5JRGB 1P3AD 2NZDD 3O62A 3R45B 3X1SB 4NE3A 2JSSA 4H9NB 1M18C 3UT9B 3AZNC 4QLCC 1TZYB 2HUEC 1N1JB 5CHLB 1HQ3B 1P3PC 5E5AC 5B1MC 1P3OD 3W97B 3WKJD 1ID3D 4H9OA 4Z5TD 3AZKD 5AV6A 4J8UD 3AYWC 3NQUA 4ZUXB 5B0YB 1P3LC 4WU8C 5G49B 2FJ7A 1KU5A 1M1AA 4H9QA 1WWIA 3REIC 4J8XC 4Z66D 1P3OA 5B32G 4HGAB 2F8NA 3WA9B 4AWLC 5B1LC 3AZED 1ID3A 3AZGB 5AVCD 1F66B 4DRBA 3C1CB 5B0ZC 4YM6A 2HIOC 2CV5B 5CPIA 1S32B 3X1TC 5GXQB 3LELA 4EO5C 4X23D 5B2IA 4LD9D 3MNND 1P3IB 4Z66A 2BYMA 3KXBD 3MVDA 5AV5D 1ULYA 4UUZA 5AVCA 3AFAC 2RVQD 3WTPA 3MGQD 4G91B 3B6FC 5BT1C 3WTPE 3AZFB 2NQBC 1AOIB 3VH5A 3REJC 3LZ0B 5JRGC 4XZQB 3UTBC 4LD9A 3KWQD 3X1SC 5AVBA 2BYKB 4JJND 4YS3C 5B33D 5AV5A 4NE6A 3REKA 2AROC 3UT9C 3TU4D 2PYOD 5AV9D 5GT3A 3W98A 2F8NK 3MGPB 3MGRA 5DNMB 5BS7A 4Z2MG 1HQ3C 3W96D 5B31C 3W97C 3AV2D 3AZIB 4NFTA 3NQJA 2F8NG 4KUDD 5AV8C 4ZUXC 3KWQA 1KX5D 1M18B 3AZNB 5B24D 3A6NA 3C1BB 5B33A 4QLCB 2HUEB 1P34A 2PYOA 4WU9D 3LZ1B 3AN2C 4CAYA 5B2JA 3WAAB 3LJAA 4XUJD 5DNNB 4KGCB 5B40B 4HGAC 5F99B 5BNXB 3WA9C 3X1VD 1P3LB 3AZGC 3AZMA 3X1UC 4J8WD 3AZJD 3VH5T 4R8PD 5B24A 2CV5C 3RELA 3MGSA 3B0BA 5CPJD 5GXQC 5B32D 1ZLAD 5AY8B 4AWLB 1U35D 5CP6D 4J8VD 5GSUB 3AZLC 4M6BA 1KX4B 5B0ZB 1P3MC 3UTAD 4R8PA 5JA4B 1P3KB 1R4VA 1P3PA 5B1MA 3X1TB 1P3BB 1AOIC 1EQZB 4EO5B 1BH9B 3KUYB 5CPJA 3LZ0C 3O62D 4XZQC 2YFVA 3AZHB 3AYWA 1BFMA 4WU8A 5CP6A 1U35A 4J8VA 5C3IC 2L5AA 3B6FB 3UTAA 3REHB 1M19B 2NQBB 1H3OA 3REIA 4J8XA 3W99B 3REJB 5CPKD 3UTBB 3AZIC 3VH6A 5B1LA 5AV6D 3AV1B 1JFIB 1P3FB 4YS3B 5BNVA 2FJ7D 2AROB 1P3GC 1M1AD 3C1BC 2HIOA 3KSYA 5GT0B 5FUGA 4H9SC 1P3AB 2NZDB 3LZ1C 1WWSA 4H9RA 3WAAC 5B31B 5DNNC 5CPKA 2F8ND 4KGCC 5B40C 5F99C 5AV8B 3AFAA 4WU9C 1TZYD 4YM6D 5CPID 3WKJB 3AN2B 3LELD 5B2ID 4Z5TB 3AZKB 4J8UB 5JRGA 5AY8C 3MVDD 3R45A 3X1SA 5B0YD 5GSUC 3X1UB 4H9NA 2IO5B 3WTPD 3UT9A 1KX3C 1KX4C 1TZYA 4KHAB 4G92B 1N1JA 1P3KC 1HQ3A 3AZEB 1P3BC 1EQZC 3W97A 3KUYC 3B6GC 5AVBD 5BO0B 3AZHC 1F66D 3AZLB 4ZUXA 5B0YA 3C1CD 1BH8B 4E45A 3REKD 5GT3D 3W98D 5G49A 1P3MB 1S32D 4X23B 3MGRD 3MNNB 3REHC 1M19C 3KXBB 3W99C 1P3ID 1F1EA 3V9RB 2NQBD 3WA9A 3MGQB 3AZGA 3AV1C 1F66A 1P3FC 5C3IB 3A6ND 3C1CA 1P34D 3AZFD 5GT0C 2CV5A 1S32A 5KDMB 5B2JD 1P3AC 3LJAD 2NZDC 5GXQA 4JJNB 1P3IA 3TU4B 5AV9B 3AZMD 1P3GB 1P3OC 3MGPD 5DNMD 3RELD 3AZFA 3W96B 3AV2B 3MGSD 3WKJC 1ID3C 1AOIA 4KUDB 4Z5TC 3AZKC 5B31G 4NE5A 4J8UC 3LZ0A 4XZQA 1KX5B 2BYKA 4CSRB 1M18D 3AZND 4WU9B 2IO5C 4XUJB 4Z66C 5E5AD 3B0CT 4H9PB 5B1MD 5DNMA 3MGPA 4G92C 1P3PD 3AZEC 3X1VB 5AVCC 3AZIA 4J8WB 3AZJB 3AYWD 1P3LD 4WU8D 1M18A 1KX3B 3AZNA 3C1BA 4QLCA 2YFWB 4X23C 4H9SA 4LD9C 5B32B 3MNNC 1ZLAB 3REID 3LZ1A 5E5AA 4J8XD 4WNNB 3KXBC 3WAAA 5AV5C 5DNNA 3B6GB 5B1LD 4KGCA 5B40A 5F99A 5BNXA 2RVQC 3MGQC 1P3LA 1TAFB 4ZBJC 5B0ZD 2HIOD 3B0DB 3X1TD 3O62B 3KWQC 4JJNC 5AY8A 5B33C 2CWEA 2PYOC 3TU4C 5AV9C 5GSUA 3AFAD 1KX4A 3B6FD 5BT1D 5B0ZA 1P3KA 3W96C 5JA4A
chains in the Genus database with same CATH superfamily
3AV2C 4H9OB 3X1TA 5AV6B 3REJD 1P3BA 3NQUB 5JRGD 1EQZA 4KUDC 1BH9A 3UTBD 3KUYA 1T3UA 1KX5C 3X1SD 2FJ7B 3AZHA 5B24C 2UWXA 2XD5A 4H9QB 4YS3D 1M1AB 3VH5W 2AROD 3UT9D 2Y2NA 2J8PA 3IP4C 1P3OB 3B6FA 4XUJC 1HQ3D 2Y2LA 3REHA 1M19A 3A1IA 2F8NB 2NQBA 1ID3B 3W99A 5B31D 3X1VC 3W97D 3REJA 3UTBA 4J8WC 4YM6B 3AZJC 5AV8D 4R8PC 4ZUXD 5CPIB 3AV1A 1A7WA 1JFIA 1P3FA 4YS3A 2Y2HA 2AROA 1Q9CA 3LELB 5B2IB 5GT0A 5CPJC 4Z66B 2BYMB 3VH6T 3AN2D 1P3AA 5B32C 1ZLAC 2NZDA 3MVDB 1U35C 5CP6C 2LY8A 4UUZB 4J8VC 5AVCB 5B31A 3WA9D 2Y2GA 3WTPB 3AZGD 1HTAA 3UTAC 5AV8A 3X1UD 2ZY2A 2CV5D 4LD9B 3B0DC 3O62C 3WKJA 5GXQD 3AN2A 5AVBB 4Z5TA 3AZKA 4J8UA 5AV5B 3REKB 3AZLD 5GT3B 3W98B 3MGRB 4ZBJB 3X1UA 1P3MD 4WZSB 4KHAA 5CPKC 3NQJB 1AOID 3AZEA 5AV6C 3LZ0D 3KWQB 4XZQD 3A6NB 5B33B 2FJ7C 1P34B 2PYOB 5BO0A 2G5IC 1M1AC 3AZLA 2W8SA 1BH8A 4CAYB 5B2JB 3LJAB 1P3MA 4X23A 3MNNA 3KXBA 2RIQA 3AZMB 3AZID 3V9RA 2FFFB 1TZYC 5B24B 4YM6C 3MGQA 5CPIC 3RELB 2F2AC 1P3GD 3C1BD 3MGSB 3VH6W 4QLCD 3LELC 3F6TA 5B2IC 3LZ1D 5KDMA 3WAAD 3MVDC 5B0YC 5DNND 4KGCD 4JJNA 5B40D 5F99D 3WTPC 3TU4A 4R8PB 5AV9A 1P3PB 5E5AB 5B1MB 1P3GA 5CPJB 3W96A 2YFVB 3AV2A 2DF4C 4WJ3C 3AYWB 4KUDA 3A1KA 4WU8B 5AVBC 5CP6B 1U35B 4J8VB 5AY8D 1F66C 3C1CC 1KX5A 3REKC 1B6WA 5GSUD 5GT3C 3W98C 4WV4B 3UTAB 1S32C 4CSRA 3MGRC 1KX3D 1KX4D 5BS7C 1H3OB 3REIB 4J8XB 4WU9A 4XUJA 1P3KD 1P3IC 4H9PA 5B1LB 1P3BD 1EQZD 3KUYD 3X1VA 3B6GD 5BNVB 4J8WA 3A6NC 3AZJA 3AZHD 2HIOB 4G91C 5FUGB 1P34C 3AZFC 4E44A 4H9RB 1KX3A 5B2JC 4Z2MH 3LJAC 2YFWA 3REHD 1M19D 5CPKB 5B32A 1ZLAA 1B67A 3W99D 4WNNA 2F8NH 3AZMC 3AFAB 2ZY4A 3B6GA 3AV1D 1P3FD 1TAFA 3MGPC 5DNMC 3RELC 3KFUG 3MGSC 5GT0D 3B0CW 4DRAA 5JRGB 2JCHA 1P3AD 2NZDD 3O62A 3R45B 3X1SB 4NE3A 2JSSA 4H9NB 1M18C 3UT9B 3AZNC 4QLCC 1TZYB 2HUEC 1N1JB 5CHLB 1HQ3B 1P3PC 5E5AC 5B1MC 1P3OD 2ZM5A 3W97B 3WKJD 1ID3D 4H9OA 4Z5TD 3AZKD 5AV6A 4J8UD 3AYWC 3NQUA 4ZUXB 5B0YB 1P3LC 4WU8C 5G49B 2FJ7A 1KU5A 1M1AA 4H9QA 1WWIA 3REIC 4J8XC 4Z66D 1P3OA 5B32G 4HGAB 2F8NA 3WA9B 4AWLC 5B1LC 3AZED 1ID3A 3AZGB 5AVCD 1F66B 4DRBA 3C1CB 5B0ZC 4YM6A 2HIOC 2CV5B 5CPIA 2Y2IA 1S32B 2XD1A 2Y2JA 3X1TC 5GXQB 3LELA 4EO5C 4X23D 5B2IA 4LD9D 3MNND 1P3IB 4Z66A 2BYMA 3KXBD 3MVDA 5AV5D 1ULYA 4UUZA 5AVCA 3AFAC 4DQYB 2RVQD 3WTPA 3MGQD 4G91B 3B6FC 5BT1C 3WTPE 3AZFB 2NQBC 1AOIB 3H0RC 3VH5A 3REJC 3LZ0B 5JRGC 4XZQB 3UTBC 4LD9A 3KWQD 3X1SC 5AVBA 2BYKB 4JJND 4YS3C 5B33D 5AV5A 4NE6A 3REKA 2AROC 3UT9C 3TU4D 2PYOD 5AV9D 5GT3A 3W98A 2F8NK 1W2EA 3MGPB 3MGRA 5DNMB 5BS7A 4Z2MG 1HQ3C 3W96D 5B31C 3W97C 3AV2D 3AZIB 4NFTA 2Y2OA 3NQJA 2F8NG 4KUDD 3EPLA 5AV8C 4ZUXC 3KWQA 1KX5D 1M18B 3AZNB 5B24D 3A6NA 3C1BB 5B33A 4QLCB 2HUEB 1P34A 2PYOA 4WU9D 3LZ1B 3AN2C 4CAYA 5B2JA 3WAAB 3LJAA 3EPHA 4XUJD 5DNNB 4KGCB 5B40B 4HGAC 5F99B 5BNXB 3WA9C 3X1VD 1P3LB 3AZGC 3AZMA 3EPJA 3X1UC 4J8WD 3AZJD 3VH5T 4R8PD 2Y2KA 5B24A 2CV5C 3RELA 3MGSA 3B0BA 5CPJD 2G5HC 5GXQC 5B32D 1ZLAD 5AY8B 4AWLB 1U35D 5CP6D 2ZY5A 4J8VD 5GSUB 3AZLC 4M6BA 3EPKA 1KX4B 5B0ZB 1P3MC 3UTAD 4R8PA 2VQRA 5JA4B 1P3KB 1R4VA 1P3PA 5B1MA 3X1TB 1P3BB 1AOIC 1EQZB 4EO5B 1BH9B 3KUYB 5CPJA 3LZ0C 3O62D 4XZQC 2YFVA 3AZHB 3EG5B 3AYWA 1BFMA 4WU8A 5CP6A 1U35A 4J8VA 5C3IC 2L5AA 3B6FB 2Y2MA 3REHB 3UTAA 1M19B 2NQBB 1H3OA 3REIA 4J8XA 3W99B 3REJB 5CPKD 3UTBB 3AZIC 3VH6A 5B1LA 5AV6D 3AV1B 1JFIB 1P3FB 4YS3B 5BNVA 2FJ7D 2AROB 1P3GC 1M1AD 3C1BC 2HIOA 3KSYA 5GT0B 5FUGA 4H9SC 1P3AB 2NZDB 3LZ1C 1WWSA 4H9RA 3WAAC 1Z2CB 5B31B 5DNNC 5CPKA 2F8ND 4KGCC 5B40C 5F99C 5AV8B 3AFAA 4WU9C 1TZYD 4YM6D 5CPID 3WKJB 3AN2B 3LELD 5B2ID 3H0MC 2BG1A 4Z5TB 3AZKB 4J8UB 5JRGA 5AY8C 3MVDD 3R45A 3X1SA 5B0YD 5GSUC 2Y2QA 3X1UB 4H9NA 2IO5B 3WTPD 3UT9A 1KX3C 1KX4C 1TZYA 4KHAB 4G92B 1N1JA 1P3KC 1HQ3A 1PZRA 3AZEB 1P3BC 1EQZC 3W97A 3KUYC 3B6GC 2DQNC 5AVBD 5BO0B 3AZHC 1F66D 3AZLB 4ZUXA 5B0YA 3C1CD 1BH8B 4E45A 3REKD 5GT3D 3W98D 5G49A 1P3MB 1S32D 4X23B 3MGRD 3MNNB 3REHC 1M19C 3KXBB 3W99C 1P3ID 1F1EA 3V9RB 2NQBD 3WA9A 3MGQB 3AZGA 3AV1C 1F66A 1P3FC 5C3IB 3A6ND 3C1CA 1P34D 3AZFD 5GT0C 2CV5A 1S32A 5KDMB 5B2JD 1P3AC 3LJAD 2NZDC 5GXQA 4JJNB 1P3IA 3TU4B 5AV9B 3AZMD 3P5JB 1P3GB 1P3OC 3MGPD 5DNMD 3RELD 3AZFA 3W96B 3AV2B 3MGSD 3WKJC 1ID3C 1AOIA 4KUDB 4Z5TC 3AZKC 5B31G 4NE5A 4J8UC 3LZ0A 4XZQA 1KX5B 2BYKA 4CSRB 1M18D 3AZND 4WU9B 2IO5C 3H0LC 4XUJB 4Z66C 5E5AD 3B0CT 4H9PB 5B1MD 5DNMA 3MGPA 4G92C 1P3PD 3AL0C 3AZEC 3X1VB 5AVCC 2ZY3A 3AZIA 4J8WB 3AZJB 3AYWD 1P3LD 3FDDA 4WU8D 2Y2PA 1M18A 1KX3B 3AZNA 3C1BA 4QLCA 2YFWB 4X23C 4H9SA 4LD9C 5B32B 3MNNC 1ZLAB 3REID 3LZ1A 5E5AA 4J8XD 2JE5A 4WNNB 3KXBC 3WAAA 4UPKA 5AV5C 5DNNA 3B6GB 5B1LD 4KGCA 5B40A 5F99A 5BNXA 2RVQC 3MGQC 1P3LA 1TAFB 4ZBJC 5B0ZD 2HIOD 3B0DB 3X1TD 3O62B 3KWQC 4JJNC 5AY8A 5B33C 2CWEA 2PYOC 3TU4C 5AV9C 5GSUA 3AFAD 1KX4A 3B6FD 5BT1D 5B0ZA 1P3KA 3W96C 5JA4A
chains in the Genus database with same CATH topology
3AV2C 4H9OB 3X1TA 5AV6B 3REJD 1P3BA 3NQUB 5JRGD 1EQZA 4KUDC 1BH9A 3UTBD 3KUYA 1T3UA 1KX5C 3X1SD 2FJ7B 3AZHA 5B24C 2UWXA 2XD5A 4H9QB 4YS3D 1M1AB 3VH5W 2AROD 3UT9D 2Y2NA 2J8PA 3IP4C 1P3OB 3B6FA 4XUJC 1HQ3D 2Y2LA 3REHA 1M19A 3A1IA 2F8NB 2NQBA 1ID3B 3W99A 5B31D 3X1VC 3W97D 3REJA 3UTBA 4J8WC 4YM6B 3AZJC 5AV8D 4R8PC 4ZUXD 5CPIB 3AV1A 1A7WA 1JFIA 1P3FA 4YS3A 2Y2HA 2AROA 1Q9CA 3LELB 5B2IB 5GT0A 5CPJC 4Z66B 2BYMB 3VH6T 3AN2D 1P3AA 5B32C 1ZLAC 2NZDA 3MVDB 1U35C 5CP6C 2LY8A 4UUZB 4J8VC 5AVCB 5B31A 3WA9D 2Y2GA 3WTPB 3AZGD 1HTAA 3UTAC 5AV8A 3X1UD 2ZY2A 2CV5D 4LD9B 3B0DC 3O62C 3WKJA 5GXQD 3AN2A 5AVBB 4Z5TA 3AZKA 4J8UA 5AV5B 3REKB 3AZLD 5GT3B 3W98B 3MGRB 4ZBJB 3X1UA 1P3MD 4WZSB 4KHAA 5CPKC 3NQJB 1AOID 3AZEA 5AV6C 3LZ0D 3KWQB 4XZQD 3A6NB 5B33B 2FJ7C 1P34B 2PYOB 5BO0A 2G5IC 1M1AC 3AZLA 2W8SA 1BH8A 4CAYB 5B2JB 3LJAB 1P3MA 4X23A 3MNNA 3KXBA 2RIQA 3AZMB 3AZID 3V9RA 2FFFB 1TZYC 5B24B 4YM6C 3MGQA 5CPIC 3RELB 2F2AC 1P3GD 3C1BD 3MGSB 3VH6W 4QLCD 3LELC 3F6TA 5B2IC 3LZ1D 5KDMA 3WAAD 3MVDC 5B0YC 5DNND 4KGCD 4JJNA 5B40D 5F99D 3WTPC 3TU4A 4R8PB 5AV9A 1P3PB 5E5AB 5B1MB 1P3GA 5CPJB 3W96A 2YFVB 3AV2A 2DF4C 4WJ3C 3AYWB 4KUDA 3A1KA 4WU8B 5AVBC 5CP6B 1U35B 4J8VB 5AY8D 1F66C 3C1CC 1KX5A 3REKC 1B6WA 5GSUD 5GT3C 3W98C 4WV4B 3UTAB 1S32C 4CSRA 3MGRC 1KX3D 1KX4D 5BS7C 1H3OB 3REIB 4J8XB 4WU9A 4XUJA 1P3KD 1P3IC 4H9PA 5B1LB 1P3BD 1EQZD 3KUYD 3X1VA 3B6GD 5BNVB 4J8WA 3A6NC 3AZJA 3AZHD 2HIOB 4G91C 5FUGB 1P34C 3AZFC 4E44A 4H9RB 1KX3A 5B2JC 4Z2MH 3LJAC 2YFWA 3REHD 1M19D 5CPKB 5B32A 1ZLAA 1B67A 3W99D 4WNNA 2F8NH 3AZMC 3AFAB 2ZY4A 3B6GA 3AV1D 1P3FD 1TAFA 3MGPC 5DNMC 3RELC 3KFUG 3MGSC 5GT0D 3B0CW 4DRAA 5JRGB 2JCHA 1P3AD 2NZDD 3O62A 3R45B 3X1SB 4NE3A 2JSSA 4H9NB 1M18C 3UT9B 3AZNC 4QLCC 1TZYB 2HUEC 1N1JB 5CHLB 1HQ3B 1P3PC 5E5AC 5B1MC 1P3OD 2ZM5A 3W97B 3WKJD 1ID3D 4H9OA 4Z5TD 3AZKD 5AV6A 4J8UD 3AYWC 3NQUA 4ZUXB 5B0YB 1P3LC 4WU8C 5G49B 2FJ7A 1KU5A 1M1AA 4H9QA 1WWIA 3REIC 4J8XC 4Z66D 1P3OA 5B32G 4HGAB 2F8NA 3WA9B 4AWLC 5B1LC 3AZED 1ID3A 3AZGB 5AVCD 1F66B 4DRBA 3C1CB 5B0ZC 4YM6A 2HIOC 2CV5B 5CPIA 2Y2IA 1S32B 2XD1A 2Y2JA 3X1TC 5GXQB 3LELA 4EO5C 4X23D 5B2IA 4LD9D 3MNND 1P3IB 4Z66A 2BYMA 3KXBD 3MVDA 5AV5D 1ULYA 4UUZA 5AVCA 3AFAC 4DQYB 2RVQD 3WTPA 3MGQD 4G91B 3B6FC 5BT1C 3WTPE 3AZFB 2NQBC 1AOIB 3H0RC 3VH5A 3REJC 3LZ0B 5JRGC 4XZQB 3UTBC 4LD9A 3KWQD 3X1SC 5AVBA 2BYKB 4JJND 4YS3C 5B33D 5AV5A 4NE6A 3REKA 2AROC 3UT9C 3TU4D 2PYOD 5AV9D 5GT3A 3W98A 2F8NK 1W2EA 3MGPB 3MGRA 5DNMB 5BS7A 4Z2MG 1HQ3C 3W96D 5B31C 3W97C 3AV2D 3AZIB 4NFTA 2Y2OA 3NQJA 2F8NG 4KUDD 3EPLA 5AV8C 4ZUXC 3KWQA 1KX5D 1M18B 3AZNB 5B24D 3A6NA 3C1BB 5B33A 4QLCB 2HUEB 1P34A 2PYOA 4WU9D 3LZ1B 3AN2C 4CAYA 5B2JA 3WAAB 3LJAA 3EPHA 4XUJD 5DNNB 4KGCB 5B40B 4HGAC 5F99B 5BNXB 3WA9C 3X1VD 1P3LB 3AZGC 3AZMA 3EPJA 3X1UC 4J8WD 3AZJD 3VH5T 4R8PD 2Y2KA 5B24A 2CV5C 3RELA 3MGSA 3B0BA 5CPJD 2G5HC 5GXQC 5B32D 1ZLAD 5AY8B 4AWLB 1U35D 5CP6D 2ZY5A 4J8VD 5GSUB 3AZLC 4M6BA 3EPKA 1KX4B 5B0ZB 1P3MC 3UTAD 4R8PA 2VQRA 5JA4B 1P3KB 1R4VA 1P3PA 5B1MA 3X1TB 1P3BB 1AOIC 1EQZB 4EO5B 1BH9B 3KUYB 5CPJA 3LZ0C 3O62D 4XZQC 2YFVA 3AZHB 3EG5B 3AYWA 1BFMA 4WU8A 5CP6A 1U35A 4J8VA 5C3IC 2L5AA 3B6FB 2Y2MA 3REHB 3UTAA 1M19B 2NQBB 1H3OA 3REIA 4J8XA 3W99B 3REJB 5CPKD 3UTBB 3AZIC 3VH6A 5B1LA 5AV6D 3AV1B 1JFIB 1P3FB 4YS3B 5BNVA 2FJ7D 2AROB 1P3GC 1M1AD 3C1BC 2HIOA 3KSYA 5GT0B 5FUGA 4H9SC 1P3AB 2NZDB 3LZ1C 1WWSA 4H9RA 3WAAC 1Z2CB 5B31B 5DNNC 5CPKA 2F8ND 4KGCC 5B40C 5F99C 5AV8B 3AFAA 4WU9C 1TZYD 4YM6D 5CPID 3WKJB 3AN2B 3LELD 5B2ID 3H0MC 2BG1A 4Z5TB 3AZKB 4J8UB 5JRGA 5AY8C 3MVDD 3R45A 3X1SA 5B0YD 5GSUC 2Y2QA 3X1UB 4H9NA 2IO5B 3WTPD 3UT9A 1KX3C 1KX4C 1TZYA 4KHAB 4G92B 1N1JA 1P3KC 1HQ3A 1PZRA 3AZEB 1P3BC 1EQZC 3W97A 3KUYC 3B6GC 2DQNC 5AVBD 5BO0B 3AZHC 1F66D 3AZLB 4ZUXA 5B0YA 3C1CD 1BH8B 4E45A 3REKD 5GT3D 3W98D 5G49A 1P3MB 1S32D 4X23B 3MGRD 3MNNB 3REHC 1M19C 3KXBB 3W99C 1P3ID 1F1EA 3V9RB 2NQBD 3WA9A 3MGQB 3AZGA 3AV1C 1F66A 1P3FC 5C3IB 3A6ND 3C1CA 1P34D 3AZFD 5GT0C 2CV5A 1S32A 5KDMB 5B2JD 1P3AC 3LJAD 2NZDC 5GXQA 4JJNB 1P3IA 3TU4B 5AV9B 3AZMD 3P5JB 1P3GB 1P3OC 3MGPD 5DNMD 3RELD 3AZFA 3W96B 3AV2B 3MGSD 3WKJC 1ID3C 1AOIA 4KUDB 4Z5TC 3AZKC 5B31G 4NE5A 4J8UC 3LZ0A 4XZQA 1KX5B 2BYKA 4CSRB 1M18D 3AZND 4WU9B 2IO5C 3H0LC 4XUJB 4Z66C 5E5AD 3B0CT 4H9PB 5B1MD 5DNMA 3MGPA 4G92C 1P3PD 3AL0C 3AZEC 3X1VB 5AVCC 2ZY3A 3AZIA 4J8WB 3AZJB 3AYWD 1P3LD 3FDDA 4WU8D 2Y2PA 1M18A 1KX3B 3AZNA 3C1BA 4QLCA 2YFWB 4X23C 4H9SA 4LD9C 5B32B 3MNNC 1ZLAB 3REID 3LZ1A 5E5AA 4J8XD 2JE5A 4WNNB 3KXBC 3WAAA 4UPKA 5AV5C 5DNNA 3B6GB 5B1LD 4KGCA 5B40A 5F99A 5BNXA 2RVQC 3MGQC 1P3LA 1TAFB 4ZBJC 5B0ZD 2HIOD 3B0DB 3X1TD 3O62B 3KWQC 4JJNC 5AY8A 5B33C 2CWEA 2PYOC 3TU4C 5AV9C 5GSUA 3AFAD 1KX4A 3B6FD 5BT1D 5B0ZA 1P3KA 3W96C 5JA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 C;  4H9O B;  3X1T A;  5AV6 B;  3REJ D;  1P3B A;  3NQU B;  5JRG D;  1EQZ A;  4KUD C;  1BH9 A;  3UTB D;  3KUY A;  1KX5 C;  3X1S D;  2FJ7 B;  3AZH A;  5B24 C;  1M1A B;  4H9Q B;  4YS3 D;  3VH5 W;  2ARO D;  3UT9 D;  1P3O B;  3B6F A;  4XUJ C;  1HQ3 D;  3REH A;  1M19 A;  2F8N B;  2NQB A;  1ID3 B;  3W99 A;  5B31 D;  3X1V C;  3W97 D;  3REJ A;  3UTB A;  4J8W C;  4YM6 B;  3AZJ C;  5AV8 D;  4R8P C;  4ZUX D;  5CPI B;  3AV1 A;  1A7W A;  1JFI A;  1P3F A;  4YS3 A;  2ARO A;  1Q9C A;  3LEL B;  5B2I B;  5GT0 A;  5CPJ C;  4Z66 B;  2BYM B;  3VH6 T;  3AN2 D;  1P3A A;  5B32 C;  1ZLA C;  2NZD A;  3MVD B;  1U35 C;  5CP6 C;  2LY8 A;  4UUZ B;  4J8V C;  5AVC B;  5B31 A;  3WA9 D;  3WTP B;  3AZG D;  1HTA A;  3UTA C;  5AV8 A;  3X1U D;  2CV5 D;  4LD9 B;  3B0D C;  3O62 C;  3WKJ A;  5GXQ D;  3AN2 A;  5AVB B;  4Z5T A;  3AZK A;  4J8U A;  5AV5 B;  3REK B;  3AZL D;  5GT3 B;  3W98 B;  3MGR B;  4ZBJ B;  3X1U A;  1P3M D;  4WZS B;  4KHA A;  5CPK C;  3NQJ B;  1AOI D;  3AZE A;  5AV6 C;  3LZ0 D;  3KWQ B;  4XZQ D;  3A6N B;  5B33 B;  2FJ7 C;  1P34 B;  2PYO B;  5BO0 A;  1M1A C;  3AZL A;  1BH8 A;  4CAY B;  5B2J B;  3LJA B;  1P3M A;  4X23 A;  3MNN A;  3KXB A;  3AZM B;  3AZI D;  3V9R A;  1TZY C;  5B24 B;  4YM6 C;  3MGQ A;  5CPI C;  3REL B;  1P3G D;  3C1B D;  3MGS B;  3VH6 W;  4QLC D;  3LEL C;  5B2I C;  3LZ1 D;  5KDM A;  3WAA D;  3MVD C;  5B0Y C;  5DNN D;  4KGC D;  4JJN A;  5B40 D;  5F99 D;  3WTP C;  3TU4 A;  4R8P B;  5AV9 A;  1P3P B;  5E5A B;  5B1M B;  1P3G A;  5CPJ B;  3W96 A;  2YFV B;  3AV2 A;  3AYW B;  4KUD A;  4WU8 B;  5AVB C;  5CP6 B;  1U35 B;  4J8V B;  5AY8 D;  1F66 C;  3C1C C;  1KX5 A;  3REK C;  1B6W A;  5GSU D;  5GT3 C;  3W98 C;  4WV4 B;  3UTA B;  1S32 C;  4CSR A;  3MGR C;  1KX3 D;  1KX4 D;  5BS7 C;  1H3O B;  3REI B;  4J8X B;  4WU9 A;  4XUJ A;  1P3K D;  1P3I C;  4H9P A;  5B1L B;  1P3B D;  1EQZ D;  3KUY D;  3X1V A;  3B6G D;  5BNV B;  4J8W A;  3A6N C;  3AZJ A;  3AZH D;  2HIO B;  4G91 C;  5FUG B;  1P34 C;  3AZF C;  4E44 A;  4H9R B;  1KX3 A;  5B2J C;  4Z2M H;  3LJA C;  2YFW A;  3REH D;  1M19 D;  5CPK B;  5B32 A;  1ZLA A;  1B67 A;  3W99 D;  4WNN A;  2F8N H;  3AZM C;  3AFA B;  3B6G A;  3AV1 D;  1P3F D;  1TAF A;  3MGP C;  5DNM C;  3REL C;  3MGS C;  5GT0 D;  3B0C W;  4DRA A;  5JRG B;  1P3A D;  2NZD D;  3O62 A;  3R45 B;  3X1S B;  4NE3 A;  2JSS A;  4H9N B;  1M18 C;  3UT9 B;  3AZN C;  4QLC C;  1TZY B;  2HUE C;  1N1J B;  5CHL B;  1HQ3 B;  1P3P C;  5E5A C;  5B1M C;  1P3O D;  3W97 B;  3WKJ D;  1ID3 D;  4H9O A;  4Z5T D;  3AZK D;  5AV6 A;  4J8U D;  3AYW C;  3NQU A;  4ZUX B;  5B0Y B;  1P3L C;  4WU8 C;  5G49 B;  2FJ7 A;  1KU5 A;  1M1A A;  4H9Q A;  1WWI A;  3REI C;  4J8X C;  4Z66 D;  1P3O A;  5B32 G;  4HGA B;  2F8N A;  3WA9 B;  4AWL C;  5B1L C;  3AZE D;  1ID3 A;  3AZG B;  5AVC D;  1F66 B;  4DRB A;  3C1C B;  5B0Z C;  4YM6 A;  2HIO C;  2CV5 B;  5CPI A;  1S32 B;  3X1T C;  5GXQ B;  3LEL A;  4EO5 C;  4X23 D;  5B2I A;  4LD9 D;  3MNN D;  1P3I B;  4Z66 A;  2BYM A;  3KXB D;  3MVD A;  5AV5 D;  1ULY A;  4UUZ A;  5AVC A;  3AFA C;  2RVQ D;  3WTP A;  3MGQ D;  4G91 B;  3B6F C;  5BT1 C;  3WTP E;  3AZF B;  2NQB C;  1AOI B;  3VH5 A;  3REJ C;  3LZ0 B;  5JRG C;  4XZQ B;  3UTB C;  4LD9 A;  3KWQ D;  3X1S C;  5AVB A;  2BYK B;  4JJN D;  4YS3 C;  5B33 D;  5AV5 A;  4NE6 A;  3REK A;  2ARO C;  3UT9 C;  3TU4 D;  2PYO D;  5AV9 D;  5GT3 A;  3W98 A;  2F8N K;  3MGP B;  3MGR A;  5DNM B;  5BS7 A;  4Z2M G;  1HQ3 C;  3W96 D;  5B31 C;  3W97 C;  3AV2 D;  3AZI B;  4NFT A;  3NQJ A;  2F8N G;  4KUD D;  5AV8 C;  4ZUX C;  3KWQ A;  1KX5 D;  1M18 B;  3AZN B;  5B24 D;  3A6N A;  3C1B B;  5B33 A;  4QLC B;  2HUE B;  1P34 A;  2PYO A;  4WU9 D;  3LZ1 B;  3AN2 C;  4CAY A;  5B2J A;  3WAA B;  3LJA A;  4XUJ D;  5DNN B;  4KGC B;  5B40 B;  4HGA C;  5F99 B;  5BNX B;  3WA9 C;  3X1V D;  1P3L B;  3AZG C;  3AZM A;  3X1U C;  4J8W D;  3AZJ D;  3VH5 T;  4R8P D;  5B24 A;  2CV5 C;  3REL A;  3MGS A;  3B0B A;  5CPJ D;  5GXQ C;  5B32 D;  1ZLA D;  5AY8 B;  4AWL B;  1U35 D;  5CP6 D;  4J8V D;  5GSU B;  3AZL C;  4M6B A;  1KX4 B;  5B0Z B;  1P3M C;  3UTA D;  4R8P A;  5JA4 B;  1P3K B;  1R4V A;  1P3P A;  5B1M A;  3X1T B;  1P3B B;  1AOI C;  1EQZ B;  4EO5 B;  1BH9 B;  3KUY B;  5CPJ A;  3LZ0 C;  3O62 D;  4XZQ C;  2YFV A;  3AZH B;  3AYW A;  1BFM A;  4WU8 A;  5CP6 A;  1U35 A;  4J8V A;  5C3I C;  2L5A A;  3B6F B;  3UTA A;  3REH B;  1M19 B;  2NQB B;  1H3O A;  3REI A;  4J8X A;  3W99 B;  3REJ B;  5CPK D;  3UTB B;  3AZI C;  3VH6 A;  5B1L A;  5AV6 D;  3AV1 B;  1JFI B;  1P3F B;  4YS3 B;  5BNV A;  2FJ7 D;  2ARO B;  1P3G C;  1M1A D;  3C1B C;  2HIO A;  3KSY A;  5GT0 B;  5FUG A;  4H9S C;  1P3A B;  2NZD B;  3LZ1 C;  1WWS A;  4H9R A;  3WAA C;  5B31 B;  5DNN C;  5CPK A;  2F8N D;  4KGC C;  5B40 C;  5F99 C;  5AV8 B;  3AFA A;  4WU9 C;  1TZY D;  4YM6 D;  5CPI D;  3WKJ B;  3AN2 B;  3LEL D;  5B2I D;  4Z5T B;  3AZK B;  4J8U B;  5JRG A;  5AY8 C;  3MVD D;  3R45 A;  3X1S A;  5B0Y D;  5GSU C;  3X1U B;  4H9N A;  2IO5 B;  3WTP D;  3UT9 A;  1KX3 C;  1KX4 C;  1TZY A;  4KHA B;  4G92 B;  1N1J A;  1P3K C;  1HQ3 A;  3AZE B;  1P3B C;  1EQZ C;  3W97 A;  3KUY C;  3B6G C;  5AVB D;  5BO0 B;  3AZH C;  1F66 D;  3AZL B;  4ZUX A;  5B0Y A;  3C1C D;  1BH8 B;  4E45 A;  3REK D;  5GT3 D;  3W98 D;  5G49 A;  1P3M B;  1S32 D;  4X23 B;  3MGR D;  3MNN B;  3REH C;  1M19 C;  3KXB B;  3W99 C;  1P3I D;  1F1E A;  3V9R B;  2NQB D;  3WA9 A;  3MGQ B;  3AZG A;  3AV1 C;  1F66 A;  1P3F C;  5C3I B;  3A6N D;  3C1C A;  1P34 D;  3AZF D;  5GT0 C;  2CV5 A;  1S32 A;  5KDM B;  5B2J D;  1P3A C;  3LJA D;  2NZD C;  5GXQ A;  4JJN B;  1P3I A;  3TU4 B;  5AV9 B;  3AZM D;  1P3G B;  1P3O C;  3MGP D;  5DNM D;  3REL D;  3AZF A;  3W96 B;  3AV2 B;  3MGS D;  3WKJ C;  1ID3 C;  1AOI A;  4KUD B;  4Z5T C;  3AZK C;  5B31 G;  4NE5 A;  4J8U C;  3LZ0 A;  4XZQ A;  1KX5 B;  2BYK A;  4CSR B;  1M18 D;  3AZN D;  4WU9 B;  2IO5 C;  4XUJ B;  4Z66 C;  5E5A D;  3B0C T;  4H9P B;  5B1M D;  5DNM A;  3MGP A;  4G92 C;  1P3P D;  3AZE C;  3X1V B;  5AVC C;  3AZI A;  4J8W B;  3AZJ B;  3AYW D;  1P3L D;  4WU8 D;  1M18 A;  1KX3 B;  3AZN A;  3C1B A;  4QLC A;  2YFW B;  4X23 C;  4H9S A;  4LD9 C;  5B32 B;  3MNN C;  1ZLA B;  3REI D;  3LZ1 A;  5E5A A;  4J8X D;  4WNN B;  3KXB C;  3WAA A;  5AV5 C;  5DNN A;  3B6G B;  5B1L D;  4KGC A;  5B40 A;  5F99 A;  5BNX A;  2RVQ C;  3MGQ C;  1P3L A;  1TAF B;  4ZBJ C;  5B0Z D;  2HIO D;  3B0D B;  3X1T D;  3O62 B;  3KWQ C;  4JJN C;  5AY8 A;  5B33 C;  2CWE A;  2PYO C;  3TU4 C;  5AV9 C;  5GSU A;  3AFA D;  1KX4 A;  3B6F D;  5BT1 D;  5B0Z A;  1P3K A;  3W96 C;  5JA4 A; 
#chains in the Genus database with same CATH topology
 3AV2 C;  4H9O B;  3X1T A;  5AV6 B;  3REJ D;  1P3B A;  3NQU B;  5JRG D;  1EQZ A;  4KUD C;  1BH9 A;  3UTB D;  3KUY A;  1T3U A;  1KX5 C;  3X1S D;  2FJ7 B;  3AZH A;  5B24 C;  2UWX A;  2XD5 A;  4H9Q B;  4YS3 D;  1M1A B;  3VH5 W;  2ARO D;  3UT9 D;  2Y2N A;  2J8P A;  3IP4 C;  1P3O B;  3B6F A;  4XUJ C;  1HQ3 D;  2Y2L A;  3REH A;  1M19 A;  3A1I A;  2F8N B;  2NQB A;  1ID3 B;  3W99 A;  5B31 D;  3X1V C;  3W97 D;  3REJ A;  3UTB A;  4J8W C;  4YM6 B;  3AZJ C;  5AV8 D;  4R8P C;  4ZUX D;  5CPI B;  3AV1 A;  1A7W A;  1JFI A;  1P3F A;  4YS3 A;  2Y2H A;  2ARO A;  1Q9C A;  3LEL B;  5B2I B;  5GT0 A;  5CPJ C;  4Z66 B;  2BYM B;  3VH6 T;  3AN2 D;  1P3A A;  5B32 C;  1ZLA C;  2NZD A;  3MVD B;  1U35 C;  5CP6 C;  2LY8 A;  4UUZ B;  4J8V C;  5AVC B;  5B31 A;  3WA9 D;  2Y2G A;  3WTP B;  3AZG D;  1HTA A;  3UTA C;  5AV8 A;  3X1U D;  2ZY2 A;  2CV5 D;  4LD9 B;  3B0D C;  3O62 C;  3WKJ A;  5GXQ D;  3AN2 A;  5AVB B;  4Z5T A;  3AZK A;  4J8U A;  5AV5 B;  3REK B;  3AZL D;  5GT3 B;  3W98 B;  3MGR B;  4ZBJ B;  3X1U A;  1P3M D;  4WZS B;  4KHA A;  5CPK C;  3NQJ B;  1AOI D;  3AZE A;  5AV6 C;  3LZ0 D;  3KWQ B;  4XZQ D;  3A6N B;  5B33 B;  2FJ7 C;  1P34 B;  2PYO B;  5BO0 A;  2G5I C;  1M1A C;  3AZL A;  2W8S A;  1BH8 A;  4CAY B;  5B2J B;  3LJA B;  1P3M A;  4X23 A;  3MNN A;  3KXB A;  2RIQ A;  3AZM B;  3AZI D;  3V9R A;  2FFF B;  1TZY C;  5B24 B;  4YM6 C;  3MGQ A;  5CPI C;  3REL B;  2F2A C;  1P3G D;  3C1B D;  3MGS B;  3VH6 W;  4QLC D;  3LEL C;  3F6T A;  5B2I C;  3LZ1 D;  5KDM A;  3WAA D;  3MVD C;  5B0Y C;  5DNN D;  4KGC D;  4JJN A;  5B40 D;  5F99 D;  3WTP C;  3TU4 A;  4R8P B;  5AV9 A;  1P3P B;  5E5A B;  5B1M B;  1P3G A;  5CPJ B;  3W96 A;  2YFV B;  3AV2 A;  2DF4 C;  4WJ3 C;  3AYW B;  4KUD A;  3A1K A;  4WU8 B;  5AVB C;  5CP6 B;  1U35 B;  4J8V B;  5AY8 D;  1F66 C;  3C1C C;  1KX5 A;  3REK C;  1B6W A;  5GSU D;  5GT3 C;  3W98 C;  4WV4 B;  3UTA B;  1S32 C;  4CSR A;  3MGR C;  1KX3 D;  1KX4 D;  5BS7 C;  1H3O B;  3REI B;  4J8X B;  4WU9 A;  4XUJ A;  1P3K D;  1P3I C;  4H9P A;  5B1L B;  1P3B D;  1EQZ D;  3KUY D;  3X1V A;  3B6G D;  5BNV B;  4J8W A;  3A6N C;  3AZJ A;  3AZH D;  2HIO B;  4G91 C;  5FUG B;  1P34 C;  3AZF C;  4E44 A;  4H9R B;  1KX3 A;  5B2J C;  4Z2M H;  3LJA C;  2YFW A;  3REH D;  1M19 D;  5CPK B;  5B32 A;  1ZLA A;  1B67 A;  3W99 D;  4WNN A;  2F8N H;  3AZM C;  3AFA B;  2ZY4 A;  3B6G A;  3AV1 D;  1P3F D;  1TAF A;  3MGP C;  5DNM C;  3REL C;  3KFU G;  3MGS C;  5GT0 D;  3B0C W;  4DRA A;  5JRG B;  2JCH A;  1P3A D;  2NZD D;  3O62 A;  3R45 B;  3X1S B;  4NE3 A;  2JSS A;  4H9N B;  1M18 C;  3UT9 B;  3AZN C;  4QLC C;  1TZY B;  2HUE C;  1N1J B;  5CHL B;  1HQ3 B;  1P3P C;  5E5A C;  5B1M C;  1P3O D;  2ZM5 A;  3W97 B;  3WKJ D;  1ID3 D;  4H9O A;  4Z5T D;  3AZK D;  5AV6 A;  4J8U D;  3AYW C;  3NQU A;  4ZUX B;  5B0Y B;  1P3L C;  4WU8 C;  5G49 B;  2FJ7 A;  1KU5 A;  1M1A A;  4H9Q A;  1WWI A;  3REI C;  4J8X C;  4Z66 D;  1P3O A;  5B32 G;  4HGA B;  2F8N A;  3WA9 B;  4AWL C;  5B1L C;  3AZE D;  1ID3 A;  3AZG B;  5AVC D;  1F66 B;  4DRB A;  3C1C B;  5B0Z C;  4YM6 A;  2HIO C;  2CV5 B;  5CPI A;  2Y2I A;  1S32 B;  2XD1 A;  2Y2J A;  3X1T C;  5GXQ B;  3LEL A;  4EO5 C;  4X23 D;  5B2I A;  4LD9 D;  3MNN D;  1P3I B;  4Z66 A;  2BYM A;  3KXB D;  3MVD A;  5AV5 D;  1ULY A;  4UUZ A;  5AVC A;  3AFA C;  4DQY B;  2RVQ D;  3WTP A;  3MGQ D;  4G91 B;  3B6F C;  5BT1 C;  3WTP E;  3AZF B;  2NQB C;  1AOI B;  3H0R C;  3VH5 A;  3REJ C;  3LZ0 B;  5JRG C;  4XZQ B;  3UTB C;  4LD9 A;  3KWQ D;  3X1S C;  5AVB A;  2BYK B;  4JJN D;  4YS3 C;  5B33 D;  5AV5 A;  4NE6 A;  3REK A;  2ARO C;  3UT9 C;  3TU4 D;  2PYO D;  5AV9 D;  5GT3 A;  3W98 A;  2F8N K;  1W2E A;  3MGP B;  3MGR A;  5DNM B;  5BS7 A;  4Z2M G;  1HQ3 C;  3W96 D;  5B31 C;  3W97 C;  3AV2 D;  3AZI B;  4NFT A;  2Y2O A;  3NQJ A;  2F8N G;  4KUD D;  3EPL A;  5AV8 C;  4ZUX C;  3KWQ A;  1KX5 D;  1M18 B;  3AZN B;  5B24 D;  3A6N A;  3C1B B;  5B33 A;  4QLC B;  2HUE B;  1P34 A;  2PYO A;  4WU9 D;  3LZ1 B;  3AN2 C;  4CAY A;  5B2J A;  3WAA B;  3LJA A;  3EPH A;  4XUJ D;  5DNN B;  4KGC B;  5B40 B;  4HGA C;  5F99 B;  5BNX B;  3WA9 C;  3X1V D;  1P3L B;  3AZG C;  3AZM A;  3EPJ A;  3X1U C;  4J8W D;  3AZJ D;  3VH5 T;  4R8P D;  2Y2K A;  5B24 A;  2CV5 C;  3REL A;  3MGS A;  3B0B A;  5CPJ D;  2G5H C;  5GXQ C;  5B32 D;  1ZLA D;  5AY8 B;  4AWL B;  1U35 D;  5CP6 D;  2ZY5 A;  4J8V D;  5GSU B;  3AZL C;  4M6B A;  3EPK A;  1KX4 B;  5B0Z B;  1P3M C;  3UTA D;  4R8P A;  2VQR A;  5JA4 B;  1P3K B;  1R4V A;  1P3P A;  5B1M A;  3X1T B;  1P3B B;  1AOI C;  1EQZ B;  4EO5 B;  1BH9 B;  3KUY B;  5CPJ A;  3LZ0 C;  3O62 D;  4XZQ C;  2YFV A;  3AZH B;  3EG5 B;  3AYW A;  1BFM A;  4WU8 A;  5CP6 A;  1U35 A;  4J8V A;  5C3I C;  2L5A A;  3B6F B;  2Y2M A;  3REH B;  3UTA A;  1M19 B;  2NQB B;  1H3O A;  3REI A;  4J8X A;  3W99 B;  3REJ B;  5CPK D;  3UTB B;  3AZI C;  3VH6 A;  5B1L A;  5AV6 D;  3AV1 B;  1JFI B;  1P3F B;  4YS3 B;  5BNV A;  2FJ7 D;  2ARO B;  1P3G C;  1M1A D;  3C1B C;  2HIO A;  3KSY A;  5GT0 B;  5FUG A;  4H9S C;  1P3A B;  2NZD B;  3LZ1 C;  1WWS A;  4H9R A;  3WAA C;  1Z2C B;  5B31 B;  5DNN C;  5CPK A;  2F8N D;  4KGC C;  5B40 C;  5F99 C;  5AV8 B;  3AFA A;  4WU9 C;  1TZY D;  4YM6 D;  5CPI D;  3WKJ B;  3AN2 B;  3LEL D;  5B2I D;  3H0M C;  2BG1 A;  4Z5T B;  3AZK B;  4J8U B;  5JRG A;  5AY8 C;  3MVD D;  3R45 A;  3X1S A;  5B0Y D;  5GSU C;  2Y2Q A;  3X1U B;  4H9N A;  2IO5 B;  3WTP D;  3UT9 A;  1KX3 C;  1KX4 C;  1TZY A;  4KHA B;  4G92 B;  1N1J A;  1P3K C;  1HQ3 A;  1PZR A;  3AZE B;  1P3B C;  1EQZ C;  3W97 A;  3KUY C;  3B6G C;  2DQN C;  5AVB D;  5BO0 B;  3AZH C;  1F66 D;  3AZL B;  4ZUX A;  5B0Y A;  3C1C D;  1BH8 B;  4E45 A;  3REK D;  5GT3 D;  3W98 D;  5G49 A;  1P3M B;  1S32 D;  4X23 B;  3MGR D;  3MNN B;  3REH C;  1M19 C;  3KXB B;  3W99 C;  1P3I D;  1F1E A;  3V9R B;  2NQB D;  3WA9 A;  3MGQ B;  3AZG A;  3AV1 C;  1F66 A;  1P3F C;  5C3I B;  3A6N D;  3C1C A;  1P34 D;  3AZF D;  5GT0 C;  2CV5 A;  1S32 A;  5KDM B;  5B2J D;  1P3A C;  3LJA D;  2NZD C;  5GXQ A;  4JJN B;  1P3I A;  3TU4 B;  5AV9 B;  3AZM D;  3P5J B;  1P3G B;  1P3O C;  3MGP D;  5DNM D;  3REL D;  3AZF A;  3W96 B;  3AV2 B;  3MGS D;  3WKJ C;  1ID3 C;  1AOI A;  4KUD B;  4Z5T C;  3AZK C;  5B31 G;  4NE5 A;  4J8U C;  3LZ0 A;  4XZQ A;  1KX5 B;  2BYK A;  4CSR B;  1M18 D;  3AZN D;  4WU9 B;  2IO5 C;  3H0L C;  4XUJ B;  4Z66 C;  5E5A D;  3B0C T;  4H9P B;  5B1M D;  5DNM A;  3MGP A;  4G92 C;  1P3P D;  3AL0 C;  3AZE C;  3X1V B;  5AVC C;  2ZY3 A;  3AZI A;  4J8W B;  3AZJ B;  3AYW D;  1P3L D;  3FDD A;  4WU8 D;  2Y2P A;  1M18 A;  1KX3 B;  3AZN A;  3C1B A;  4QLC A;  2YFW B;  4X23 C;  4H9S A;  4LD9 C;  5B32 B;  3MNN C;  1ZLA B;  3REI D;  3LZ1 A;  5E5A A;  4J8X D;  2JE5 A;  4WNN B;  3KXB C;  3WAA A;  4UPK A;  5AV5 C;  5DNN A;  3B6G B;  5B1L D;  4KGC A;  5B40 A;  5F99 A;  5BNX A;  2RVQ C;  3MGQ C;  1P3L A;  1TAF B;  4ZBJ C;  5B0Z D;  2HIO D;  3B0D B;  3X1T D;  3O62 B;  3KWQ C;  4JJN C;  5AY8 A;  5B33 C;  2CWE A;  2PYO C;  3TU4 C;  5AV9 C;  5GSU A;  3AFA D;  1KX4 A;  3B6F D;  5BT1 D;  5B0Z A;  1P3K A;  3W96 C;  5JA4 A; 
#chains in the Genus database with same CATH homology
 3AV2 C;  4H9O B;  3X1T A;  5AV6 B;  3REJ D;  1P3B A;  3NQU B;  5JRG D;  1EQZ A;  4KUD C;  1BH9 A;  3UTB D;  3KUY A;  1T3U A;  1KX5 C;  3X1S D;  2FJ7 B;  3AZH A;  5B24 C;  2UWX A;  2XD5 A;  4H9Q B;  4YS3 D;  1M1A B;  3VH5 W;  2ARO D;  3UT9 D;  2Y2N A;  2J8P A;  3IP4 C;  1P3O B;  3B6F A;  4XUJ C;  1HQ3 D;  2Y2L A;  3REH A;  1M19 A;  3A1I A;  2F8N B;  2NQB A;  1ID3 B;  3W99 A;  5B31 D;  3X1V C;  3W97 D;  3REJ A;  3UTB A;  4J8W C;  4YM6 B;  3AZJ C;  5AV8 D;  4R8P C;  4ZUX D;  5CPI B;  3AV1 A;  1A7W A;  1JFI A;  1P3F A;  4YS3 A;  2Y2H A;  2ARO A;  1Q9C A;  3LEL B;  5B2I B;  5GT0 A;  5CPJ C;  4Z66 B;  2BYM B;  3VH6 T;  3AN2 D;  1P3A A;  5B32 C;  1ZLA C;  2NZD A;  3MVD B;  1U35 C;  5CP6 C;  2LY8 A;  4UUZ B;  4J8V C;  5AVC B;  5B31 A;  3WA9 D;  2Y2G A;  3WTP B;  3AZG D;  1HTA A;  3UTA C;  5AV8 A;  3X1U D;  2ZY2 A;  2CV5 D;  4LD9 B;  3B0D C;  3O62 C;  3WKJ A;  5GXQ D;  3AN2 A;  5AVB B;  4Z5T A;  3AZK A;  4J8U A;  5AV5 B;  3REK B;  3AZL D;  5GT3 B;  3W98 B;  3MGR B;  4ZBJ B;  3X1U A;  1P3M D;  4WZS B;  4KHA A;  5CPK C;  3NQJ B;  1AOI D;  3AZE A;  5AV6 C;  3LZ0 D;  3KWQ B;  4XZQ D;  3A6N B;  5B33 B;  2FJ7 C;  1P34 B;  2PYO B;  5BO0 A;  2G5I C;  1M1A C;  3AZL A;  2W8S A;  1BH8 A;  4CAY B;  5B2J B;  3LJA B;  1P3M A;  4X23 A;  3MNN A;  3KXB A;  2RIQ A;  3AZM B;  3AZI D;  3V9R A;  2FFF B;  1TZY C;  5B24 B;  4YM6 C;  3MGQ A;  5CPI C;  3REL B;  2F2A C;  1P3G D;  3C1B D;  3MGS B;  3VH6 W;  4QLC D;  3LEL C;  3F6T A;  5B2I C;  3LZ1 D;  5KDM A;  3WAA D;  3MVD C;  5B0Y C;  5DNN D;  4KGC D;  4JJN A;  5B40 D;  5F99 D;  3WTP C;  3TU4 A;  4R8P B;  5AV9 A;  1P3P B;  5E5A B;  5B1M B;  1P3G A;  5CPJ B;  3W96 A;  2YFV B;  3AV2 A;  2DF4 C;  4WJ3 C;  3AYW B;  4KUD A;  3A1K A;  4WU8 B;  5AVB C;  5CP6 B;  1U35 B;  4J8V B;  5AY8 D;  1F66 C;  3C1C C;  1KX5 A;  3REK C;  1B6W A;  5GSU D;  5GT3 C;  3W98 C;  4WV4 B;  3UTA B;  1S32 C;  4CSR A;  3MGR C;  1KX3 D;  1KX4 D;  5BS7 C;  1H3O B;  3REI B;  4J8X B;  4WU9 A;  4XUJ A;  1P3K D;  1P3I C;  4H9P A;  5B1L B;  1P3B D;  1EQZ D;  3KUY D;  3X1V A;  3B6G D;  5BNV B;  4J8W A;  3A6N C;  3AZJ A;  3AZH D;  2HIO B;  4G91 C;  5FUG B;  1P34 C;  3AZF C;  4E44 A;  4H9R B;  1KX3 A;  5B2J C;  4Z2M H;  3LJA C;  2YFW A;  3REH D;  1M19 D;  5CPK B;  5B32 A;  1ZLA A;  1B67 A;  3W99 D;  4WNN A;  2F8N H;  3AZM C;  3AFA B;  2ZY4 A;  3B6G A;  3AV1 D;  1P3F D;  1TAF A;  3MGP C;  5DNM C;  3REL C;  3KFU G;  3MGS C;  5GT0 D;  3B0C W;  4DRA A;  5JRG B;  2JCH A;  1P3A D;  2NZD D;  3O62 A;  3R45 B;  3X1S B;  4NE3 A;  2JSS A;  4H9N B;  1M18 C;  3UT9 B;  3AZN C;  4QLC C;  1TZY B;  2HUE C;  1N1J B;  5CHL B;  1HQ3 B;  1P3P C;  5E5A C;  5B1M C;  1P3O D;  2ZM5 A;  3W97 B;  3WKJ D;  1ID3 D;  4H9O A;  4Z5T D;  3AZK D;  5AV6 A;  4J8U D;  3AYW C;  3NQU A;  4ZUX B;  5B0Y B;  1P3L C;  4WU8 C;  5G49 B;  2FJ7 A;  1KU5 A;  1M1A A;  4H9Q A;  1WWI A;  3REI C;  4J8X C;  4Z66 D;  1P3O A;  5B32 G;  4HGA B;  2F8N A;  3WA9 B;  4AWL C;  5B1L C;  3AZE D;  1ID3 A;  3AZG B;  5AVC D;  1F66 B;  4DRB A;  3C1C B;  5B0Z C;  4YM6 A;  2HIO C;  2CV5 B;  5CPI A;  2Y2I A;  1S32 B;  2XD1 A;  2Y2J A;  3X1T C;  5GXQ B;  3LEL A;  4EO5 C;  4X23 D;  5B2I A;  4LD9 D;  3MNN D;  1P3I B;  4Z66 A;  2BYM A;  3KXB D;  3MVD A;  5AV5 D;  1ULY A;  4UUZ A;  5AVC A;  3AFA C;  4DQY B;  2RVQ D;  3WTP A;  3MGQ D;  4G91 B;  3B6F C;  5BT1 C;  3WTP E;  3AZF B;  2NQB C;  1AOI B;  3H0R C;  3VH5 A;  3REJ C;  3LZ0 B;  5JRG C;  4XZQ B;  3UTB C;  4LD9 A;  3KWQ D;  3X1S C;  5AVB A;  2BYK B;  4JJN D;  4YS3 C;  5B33 D;  5AV5 A;  4NE6 A;  3REK A;  2ARO C;  3UT9 C;  3TU4 D;  2PYO D;  5AV9 D;  5GT3 A;  3W98 A;  2F8N K;  1W2E A;  3MGP B;  3MGR A;  5DNM B;  5BS7 A;  4Z2M G;  1HQ3 C;  3W96 D;  5B31 C;  3W97 C;  3AV2 D;  3AZI B;  4NFT A;  2Y2O A;  3NQJ A;  2F8N G;  4KUD D;  3EPL A;  5AV8 C;  4ZUX C;  3KWQ A;  1KX5 D;  1M18 B;  3AZN B;  5B24 D;  3A6N A;  3C1B B;  5B33 A;  4QLC B;  2HUE B;  1P34 A;  2PYO A;  4WU9 D;  3LZ1 B;  3AN2 C;  4CAY A;  5B2J A;  3WAA B;  3LJA A;  3EPH A;  4XUJ D;  5DNN B;  4KGC B;  5B40 B;  4HGA C;  5F99 B;  5BNX B;  3WA9 C;  3X1V D;  1P3L B;  3AZG C;  3AZM A;  3EPJ A;  3X1U C;  4J8W D;  3AZJ D;  3VH5 T;  4R8P D;  2Y2K A;  5B24 A;  2CV5 C;  3REL A;  3MGS A;  3B0B A;  5CPJ D;  2G5H C;  5GXQ C;  5B32 D;  1ZLA D;  5AY8 B;  4AWL B;  1U35 D;  5CP6 D;  2ZY5 A;  4J8V D;  5GSU B;  3AZL C;  4M6B A;  3EPK A;  1KX4 B;  5B0Z B;  1P3M C;  3UTA D;  4R8P A;  2VQR A;  5JA4 B;  1P3K B;  1R4V A;  1P3P A;  5B1M A;  3X1T B;  1P3B B;  1AOI C;  1EQZ B;  4EO5 B;  1BH9 B;  3KUY B;  5CPJ A;  3LZ0 C;  3O62 D;  4XZQ C;  2YFV A;  3AZH B;  3EG5 B;  3AYW A;  1BFM A;  4WU8 A;  5CP6 A;  1U35 A;  4J8V A;  5C3I C;  2L5A A;  3B6F B;  2Y2M A;  3REH B;  3UTA A;  1M19 B;  2NQB B;  1H3O A;  3REI A;  4J8X A;  3W99 B;  3REJ B;  5CPK D;  3UTB B;  3AZI C;  3VH6 A;  5B1L A;  5AV6 D;  3AV1 B;  1JFI B;  1P3F B;  4YS3 B;  5BNV A;  2FJ7 D;  2ARO B;  1P3G C;  1M1A D;  3C1B C;  2HIO A;  3KSY A;  5GT0 B;  5FUG A;  4H9S C;  1P3A B;  2NZD B;  3LZ1 C;  1WWS A;  4H9R A;  3WAA C;  1Z2C B;  5B31 B;  5DNN C;  5CPK A;  2F8N D;  4KGC C;  5B40 C;  5F99 C;  5AV8 B;  3AFA A;  4WU9 C;  1TZY D;  4YM6 D;  5CPI D;  3WKJ B;  3AN2 B;  3LEL D;  5B2I D;  3H0M C;  2BG1 A;  4Z5T B;  3AZK B;  4J8U B;  5JRG A;  5AY8 C;  3MVD D;  3R45 A;  3X1S A;  5B0Y D;  5GSU C;  2Y2Q A;  3X1U B;  4H9N A;  2IO5 B;  3WTP D;  3UT9 A;  1KX3 C;  1KX4 C;  1TZY A;  4KHA B;  4G92 B;  1N1J A;  1P3K C;  1HQ3 A;  1PZR A;  3AZE B;  1P3B C;  1EQZ C;  3W97 A;  3KUY C;  3B6G C;  2DQN C;  5AVB D;  5BO0 B;  3AZH C;  1F66 D;  3AZL B;  4ZUX A;  5B0Y A;  3C1C D;  1BH8 B;  4E45 A;  3REK D;  5GT3 D;  3W98 D;  5G49 A;  1P3M B;  1S32 D;  4X23 B;  3MGR D;  3MNN B;  3REH C;  1M19 C;  3KXB B;  3W99 C;  1P3I D;  1F1E A;  3V9R B;  2NQB D;  3WA9 A;  3MGQ B;  3AZG A;  3AV1 C;  1F66 A;  1P3F C;  5C3I B;  3A6N D;  3C1C A;  1P34 D;  3AZF D;  5GT0 C;  2CV5 A;  1S32 A;  5KDM B;  5B2J D;  1P3A C;  3LJA D;  2NZD C;  5GXQ A;  4JJN B;  1P3I A;  3TU4 B;  5AV9 B;  3AZM D;  3P5J B;  1P3G B;  1P3O C;  3MGP D;  5DNM D;  3REL D;  3AZF A;  3W96 B;  3AV2 B;  3MGS D;  3WKJ C;  1ID3 C;  1AOI A;  4KUD B;  4Z5T C;  3AZK C;  5B31 G;  4NE5 A;  4J8U C;  3LZ0 A;  4XZQ A;  1KX5 B;  2BYK A;  4CSR B;  1M18 D;  3AZN D;  4WU9 B;  2IO5 C;  3H0L C;  4XUJ B;  4Z66 C;  5E5A D;  3B0C T;  4H9P B;  5B1M D;  5DNM A;  3MGP A;  4G92 C;  1P3P D;  3AL0 C;  3AZE C;  3X1V B;  5AVC C;  2ZY3 A;  3AZI A;  4J8W B;  3AZJ B;  3AYW D;  1P3L D;  3FDD A;  4WU8 D;  2Y2P A;  1M18 A;  1KX3 B;  3AZN A;  3C1B A;  4QLC A;  2YFW B;  4X23 C;  4H9S A;  4LD9 C;  5B32 B;  3MNN C;  1ZLA B;  3REI D;  3LZ1 A;  5E5A A;  4J8X D;  2JE5 A;  4WNN B;  3KXB C;  3WAA A;  4UPK A;  5AV5 C;  5DNN A;  3B6G B;  5B1L D;  4KGC A;  5B40 A;  5F99 A;  5BNX A;  2RVQ C;  3MGQ C;  1P3L A;  1TAF B;  4ZBJ C;  5B0Z D;  2HIO D;  3B0D B;  3X1T D;  3O62 B;  3KWQ C;  4JJN C;  5AY8 A;  5B33 C;  2CWE A;  2PYO C;  3TU4 C;  5AV9 C;  5GSU A;  3AFA D;  1KX4 A;  3B6F D;  5BT1 D;  5B0Z A;  1P3K A;  3W96 C;  5JA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...