2HIOD

Histone octamer (chicken), chromosomal protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQERTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE H2A)
publication title The nucleosomal core histone octamer at 3.1 A resolution: a tripartite protein assembly and a left-handed superhelix.
pubmed doi rcsb
molecule tags Structural protein,dna binding protein
total genus 23
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hioD00
4DRAA 5AV9B 3MGRD 3AYWC 5GT0C 4E44A 3LZ0A 2RVQC 5B32D 5AV8C 3WA9B 5B32G 1ULYA 3LZ0D 4HGAC 3AZIC 3AZMC 4WU8B 5AVBB 5B2JB 2CV5A 4G92C 5DNMA 4QLCA 5B0YA 2CV5D 2CWEA 3V9RA 5DNMD 4QLCD 4UUZA 5B0YD 5B1LB 4Z5TC 3AZKC 3AZFB 3X1TB 5AY8D 3MGSB 1P3IA 1Q9CA 4KGCD 3B6GA 4WU9D 1P34A 5BS7C 1P3ID 4KUDA 3B6GD 1TZYA 5C3IB 1P34D 3MGPB 1ID3B 4KUDD 2AROB 1TZYD 3MVDC 1M18A 1M18D 3AZLB 3AV2B 3WAAB 2HUEC 4M6BA 1P3AC 3X1UC 2BYKA 3UTBB 1H3OB 4Z2MH 3UTAA 3W97A 4XZQA 3C1BC 5AVCA 1P3GD 1KX4A 3W96A 4EO5C 3C1CC 1JFIA 3W97D 5AVCD 3W96D 2BYMB 4LD9C 3AZEA 3W99B 4J8WA 5GXQA 3AZED 1F66C 1U35A 4J8WD 5AV5C 5GXQD 3TU4B 2HIOA 5KDMA 1U35D 3AZHB 5B1MA 2FJ7B 2HIOD 5B40A 5B31A 4J8XB 4J8UA 2NZDA 5B1MD 1P3KC 4HGAB 5B40D 5B32C 5B31D 2YFVB 4J8UD 3REIC 5B31G 3AZIB 3AV1B 2NZDD 3RELA 5B33A 1S32A 3RELD 3O62A 3A6NB 5B33D 1S32D 1ZLAC 4KGCA 3LELC 4Z5TB 3O62D 1M19B 4YS3A 3KWQC 1P3BB 4YS3D 3MVDB 4WV4B 3REKC 4JJNA 1P3AB 3X1UB 4JJND 4Z66C 4H9SC 5DNNC 3VH5A 5JRGC 4EO5B 4R8PD 1N1JA 1P3PB 5BO0A 3WKJA 1P3OA 3KSYA 3VH6T 5AV9C 3WKJD 4H9OB 5GSUD 1KX5A 3AFAB 4J8VA 4YM6B 4WNNB 3WA9C 3UT9D 5FUGA 3MGRB 4H9PB 5B0ZA 4WU8C 5AVBC 1WWIA 1P3KB 5B32B 3KXBA 3REIB 5B0ZD 3VH5W 4XUJD 3KXBD 5E5AA 5B1LC 3AZFC 3X1TC 3MGSC 5CPIA 5E5AD 3B0DB 5CPID 3X1VC 2CV5B 5C3IC 3MGPC 5B0YB 4CAYA 3LJAC 1P3MD 1AOIA 2AROC 5AY8B 4UUZB 4KGCB 1AOID 2YFWA 3WTPA 4WU9B 5BNVB 3WAAC 4ZUXD 1P34B 5AV6A 1KX3D 1TZYB 5B24A 5AV6D 1KU5A 3KUYD 3REHD 1M18B 3LZ1C 3MNND 5B24D 4G91B 3R45A 1M1AD 5DNNB 1P3FA 3W99C 5CP6A 1P3GB 2BYKB 1P3FD 3W97B 4H9QA 5AVCB 5CP6D 3W96B 3TU4C 3AZHC 3AZGA 2FJ7C 4J8XC 3AZGD 3AZEB 1P3LA 3W98A 5GXQB 3AV1C 1U35B 4LD9A 2HIOB 2NQBA 3A6NC 5B40B 2NQBD 4H9NA 5B31B 4J8UB 2PYOA 5AV5A 2NZDB 4XUJC 2PYOD 5B2IC 1M19C 3RELB 3X1VB 5BNXB 5BT1D 5B33B 1P3BC 1BH8A 3LJAB 3REJA 5CPKA 3REJD 1A7WA 5CPKD 5CPJA 4YS3B 4ZUXC 1KX3C 3LZ1B 3KUYC 3REHC 3UTAD 1P3PC 3MNNC 4XZQD 1KX4D 3AZNA 4JJNB 3AZND 3AFAC 1B6WA 3NQJA 4R8PB 3B6FA 4H9RB 4YM6C 3B6FD 1N1JB 1HQ3A 3MGRC 4Z66A 3MGQA 5GSUB 4X23A 1F1EA 1HQ3D 1BH9A 5JRGA 4NE6A 4X23D 3VH6W 3LZ0C 3UT9B 3WTPE 5AV9A 1EQZA 5B0ZB 1EQZD 3B0DC 4XUJB 2CV5C 3KXBB 5B2IB 3AN2A 5DNMC 4QLCC 5B0YC 5AY8C 3AN2D 2F8NA 5E5AB 4KGCC 5B2JA 4WU9C 5CPIB 1P3IC 2F8ND 4NE5A 5B2JD 2F8NG 3B6GC 1P34C 1P3MB 4KUDC 3AZFA 1TZYC 3MGSA 1M18C 5F99A 4G91C 2YFWB 4ZUXB 1KX3B 5F99D 1ID3A 3KUYB 3REHB 1ID3D 3MNNB 3X1SA 5B24B 3AZLA 3AV2A 1P3GC 3X1SD 3W97C 1M1AB 1P3OD 4XZQC 3R45B 5AVCC 3AZJA 3W96C 5G49A 1KX5D 3AZJD 3UTBA 1H3OA 4CSRB 4J8VD 4KHAA 1P3FB 3AZEC 3UTBD 4J8WC 5GT3A 5GXQC 1U35C 5GT3D 2HIOC 3LZ0B 3AZGB 5B1MC 5B40C 2NZDC 5B31C 4J8UC 3AYWA 1B67A 5GT0A 2L5AA 3AYWD 5AV8A 5GT0D 3RELC 5B33C 2RVQD 5AV8D 4NE3A 4QLCB 5DNMB 1S32C 3AZIA 3O62C 3AZMA 3V9RB 2PYOB 3AZID 1P3IB 4WZSB 3AZMD 3B6GB 3NQUA 3WTPD 4KUDB 4YS3C 4Z5TA 3AZKA 4Z5TD 3AZKD 5BS7A 5CPKB 3MVDA 1BFMA 4JJNC 3MVDD 4R8PC 1TAFA 3UTAB 4XZQB 1KX4B 1P3AA 1JFIB 3X1UA 4NFTA 1P3AD 3WKJC 5GSUC 3X1UD 3AZNB 3C1BA 2JSSA 3C1CA 4J8WB 3C1BD 4J8VC 1P3LD 3B6FB 3UT9C 4ZBJB 3C1CD 3W98D 2F8NK 5KDMB 4H9OA 5B1MB 4LD9D 4X23B 5B0ZC 4WNNA 1F66A 3KXBC 1F66D 5AV5D 3MGRA 1R4VA 3VH5T 5E5AC 1S32B 1P3KA 1EQZB 5B32A 5JA4A 5CPIC 3O62B 3REIA 1P3KD 3REID 1P3MC 4Z2MG 3AN2B 1HTAA 1AOIC 1ZLAA 3LELA 5CPJD 2F8NB 3WTPC 1ZLAD 3LELD 5AY8A 5AV6C 3VH6A 3KWQA 4WU9A 5B24C 2IO5B 3B0CT 3KWQD 5BNVA 5F99B 1M1AC 4E45A 3REKA 3REKD 1P3FC 5BO0B 3X1SB 4AWLC 3WKJB 1P3OB 4H9SA 5CP6C 5DNNA 4Z66D 3MGQD 1KX5B 3AZJB 5G49B 5DNND 4J8VB 5JRGD 3AZGC 1P3GA 4KHAB 1P3LC 5FUGB 5AV9D 3W98C 5GT3B 3WA9A 3WA9D 2NQBC 4WU8A 5AVBA 2PYOC 3AYWB 5GT0B 4WU8D 5AVBD 5BT1C 5AV8B 1WWSA 5B1LA 3X1TA 4CAYB 1AOIB 3REJC 5B1LD 3AZFD 3AZMB 3X1TD 3MGSD 3X1VA 5CPKC 5BNXA 3WTPB 4G92B 3MGPA 3X1VD 3NQUB 3LJAA 5CPJC 2AROA 5AV6B 3MGPD 3LJAD 3AZKB 2AROD 3WAAA 3UTAC 3AZLD 3AV2D 1KX4C 3WAAD 3LZ1A 3AZNC 3LZ1D 4AWLB 5CP6B 5CHLB 1TAFB 3B6FC 4ZBJC 2HUEB 4H9QB 2BYMA 2F8NH 3W99A 1HQ3C 4R8PA 3MGQC 4H9RA 4X23C 3W99D 3C1BB 1P3LB 3C1CB 3TU4A 3W98B 3AZHA 2FJ7A 5GSUA 3TU4D 4J8XA 3AZHD 4LD9B 2NQBB 1EQZC 2FJ7D 4J8XD 2YFVA 3AV1A 4H9NB 3UT9A 1F66B 5AV5B 3AV1D 3AN2C 3A6NA 3A6ND 5B2JC 4XUJA 1BH8B 5JA4B 5B2IA 3REJB 1M19A 5B2ID 1M19D 1P3BA 2LY8A 4DRBA 5CPJB 2IO5C 1P3BD 1ZLAB 3LELB 5F99C 1P3MA 1ID3C 3B0BA 3KWQB 4ZUXA 3X1SC 1KX3A 1P3OC 3AZLC 3AV2C 3B0CW 3KUYA 3REHA 1KX5C 3AZJC 1P3PA 3MNNA 3NQJB 3REKB 1P3PD 3UTBC 1M1AA 1HQ3B 3AFAA 4Z66B 3MGQB 5GT3C 4YM6A 1BH9B 3AFAD 5JRGB 4CSRA 4YM6D 4H9PA
chains in the Genus database with same CATH superfamily
4DRAA 5AV9B 3MGRD 3AYWC 5GT0C 4E44A 3LZ0A 2RVQC 5B32D 5AV8C 3WA9B 5B32G 1ULYA 3LZ0D 4HGAC 3AZIC 3AZMC 4WU8B 5AVBB 5B2JB 2CV5A 1T3UA 4G92C 5DNMA 4QLCA 5B0YA 2CV5D 2CWEA 3V9RA 5DNMD 4QLCD 4UUZA 5B0YD 5B1LB 4Z5TC 3AZKC 3AZFB 3X1TB 5AY8D 3MGSB 1P3IA 1Q9CA 4KGCD 3B6GA 4WU9D 1P34A 5BS7C 1P3ID 4KUDA 3B6GD 1TZYA 2JCHA 5C3IB 3MGPB 1P34D 1ID3B 2XD1A 4KUDD 2AROB 1TZYD 3MVDC 1M18A 2F2AC 1M18D 3AZLB 3AV2B 3WAAB 2HUEC 4M6BA 1P3AC 3X1UC 2BYKA 3UTBB 1H3OB 4Z2MH 2Y2GA 3W97A 3UTAA 4XZQA 3C1BC 5AVCA 1P3GD 1KX4A 3W96A 4EO5C 3C1CC 1JFIA 3W97D 5AVCD 3W96D 2BYMB 4LD9C 3AZEA 3W99B 4J8WA 3H0LC 5GXQA 3AZED 1F66C 1U35A 4J8WD 5AV5C 5GXQD 3TU4B 2HIOA 2UWXA 5KDMA 1U35D 3AZHB 5B1MA 2FJ7B 2HIOD 5B40A 2Y2JA 5B31A 4J8XB 4J8UA 2NZDA 5B1MD 1P3KC 4HGAB 5B40D 5B32C 5B31D 2YFVB 4J8UD 3REIC 5B31G 3AZIB 3AV1B 2NZDD 3RELA 5B33A 1W2EA 1S32A 3RELD 3O62A 3A6NB 5B33D 1S32D 1ZLAC 4KGCA 3H0RC 4Z5TB 3O62D 3LELC 2Y2PA 1M19B 4YS3A 3KWQC 1P3BB 4YS3D 3MVDB 4WV4B 3REKC 4JJNA 1P3AB 3X1UB 3FDDA 4JJND 4Z66C 4H9SC 2XD5A 5DNNC 3VH5A 5JRGC 4EO5B 4R8PD 1N1JA 1P3PB 5BO0A 3WKJA 1P3OA 3KSYA 2DQNC 3VH6T 5AV9C 3WKJD 4H9OB 5GSUD 1KX5A 3AFAB 4J8VA 4YM6B 4WNNB 3WA9C 3UT9D 5FUGA 3MGRB 4H9PB 2Y2HA 5B0ZA 4WU8C 5AVBC 1WWIA 1P3KB 5B32B 3KXBA 3REIB 5B0ZD 3VH5W 4XUJD 3KXBD 5E5AA 5B1LC 3AZFC 3X1TC 3MGSC 5CPIA 5E5AD 3B0DB 5CPID 3X1VC 2CV5B 5C3IC 3MGPC 5B0YB 4CAYA 3LJAC 1P3MD 1AOIA 2AROC 5AY8B 2VQRA 4UUZB 4KGCB 1AOID 2YFWA 3WTPA 4WU9B 5BNVB 4UPKA 3WAAC 4ZUXD 1P34B 5AV6A 1KX3D 1TZYB 2Y2LA 5B24A 5AV6D 1KU5A 3KUYD 3REHD 1M18B 3LZ1C 3MNND 5B24D 4G91B 3R45A 1M1AD 5DNNB 2Y2IA 1P3FA 3W99C 5CP6A 1P3GB 2BYKB 1P3FD 3W97B 4H9QA 5AVCB 5CP6D 3W96B 3TU4C 3AZHC 3AZGA 3EPJA 2FJ7C 4J8XC 3AZGD 3AZEB 1P3LA 3W98A 5GXQB 3AV1C 1U35B 4LD9A 2HIOB 2NQBA 3A6NC 5B40B 2NQBD 4H9NA 5B31B 4J8UB 2PYOA 5AV5A 2NZDB 4XUJC 2PYOD 5B2IC 1M19C 3RELB 3X1VB 5BNXB 5BT1D 5B33B 1P3BC 1BH8A 3LJAB 3REJA 5CPKA 3REJD 1A7WA 5CPKD 5CPJA 4YS3B 3F6TA 4ZUXC 3IP4C 1KX3C 3LZ1B 3KUYC 3REHC 3UTAD 1P3PC 3MNNC 4XZQD 2G5IC 1KX4D 3AZNA 4JJNB 3AZND 3AFAC 1B6WA 3NQJA 4R8PB 3B6FA 4H9RB 4YM6C 2JE5A 3B6FD 1N1JB 1HQ3A 3MGRC 4Z66A 3MGQA 5GSUB 3EG5B 1F1EA 4X23A 1HQ3D 1BH9A 5JRGA 4NE6A 4X23D 3VH6W 3LZ0C 3UT9B 3WTPE 5AV9A 1EQZA 5B0ZB 1EQZD 3B0DC 4XUJB 2CV5C 3KXBB 5B2IB 3AN2A 5DNMC 4QLCC 5B0YC 2ZY3A 5AY8C 3AN2D 2F8NA 5E5AB 4KGCC 5B2JA 4WU9C 5CPIB 1P3IC 2F8ND 4NE5A 5B2JD 2F8NG 3B6GC 1P34C 1P3MB 4KUDC 3AZFA 1TZYC 3MGSA 1M18C 5F99A 4G91C 2YFWB 4ZUXB 1KX3B 5F99D 1ID3A 3KUYB 3REHB 1ID3D 3MNNB 3X1SA 5B24B 3AZLA 3AV2A 1P3GC 3X1SD 3A1KA 1M1AB 1P3OD 4XZQC 3R45B 5AVCC 3AZJA 2FFFB 3W96C 3W97C 5G49A 1KX5D 3AZJD 3UTBA 1H3OA 4CSRB 4J8VD 4KHAA 1P3FB 3AZEC 3UTBD 4J8WC 5GT3A 5GXQC 1U35C 5GT3D 2HIOC 3LZ0B 3AZGB 5B1MC 5B40C 2NZDC 5B31C 2Y2KA 4J8UC 3AYWA 1B67A 5GT0A 2L5AA 3AYWD 5AV8A 5GT0D 3RELC 5B33C 2RVQD 5AV8D 4NE3A 4QLCB 5DNMB 1S32C 3AZIA 3O62C 2ZM5A 3AZMA 3V9RB 2ZY5A 2PYOB 3AZID 3KFUG 1P3IB 4WZSB 3AZMD 3B6GB 3NQUA 3WTPD 4KUDB 4YS3C 4Z5TA 3AZKA 4Z5TD 3AZKD 5BS7A 5CPKB 3MVDA 1BFMA 4JJNC 2ZY2A 3MVDD 4R8PC 1TAFA 2ZY4A 3UTAB 4XZQB 1KX4B 1P3AA 1JFIB 3X1UA 4NFTA 1P3AD 3WKJC 5GSUC 3X1UD 3AZNB 3C1BA 2JSSA 3C1CA 4J8WB 3EPLA 3C1BD 4J8VC 1P3LD 3B6FB 3UT9C 4ZBJB 3C1CD 3W98D 2F8NK 5KDMB 4H9OA 5B1MB 4LD9D 4X23B 5B0ZC 4WNNA 1F66A 3KXBC 1F66D 5AV5D 3MGRA 1R4VA 3VH5T 5E5AC 1S32B 1P3KA 1EQZB 5B32A 5JA4A 5CPIC 3O62B 3REIA 1P3KD 3REID 1P3MC 4Z2MG 3AN2B 1HTAA 1AOIC 1ZLAA 3LELA 5CPJD 3EPKA 2F8NB 3WTPC 1ZLAD 3LELD 5AY8A 5AV6C 3VH6A 3KWQA 4WU9A 2RIQA 5B24C 2IO5B 3B0CT 3KWQD 5BNVA 5F99B 1M1AC 2W8SA 4E45A 3REKA 4DQYB 3REKD 1P3FC 5BO0B 3X1SB 4AWLC 3WKJB 1P3OB 4H9SA 5CP6C 5DNNA 4Z66D 3MGQD 1KX5B 3AZJB 3EPHA 5G49B 5DNND 4J8VB 5JRGD 3AZGC 1P3GA 3A1IA 4KHAB 1P3LC 5FUGB 5AV9D 3W98C 5GT3B 3WA9A 3WA9D 2NQBC 4WU8A 5AVBA 2PYOC 3AYWB 5GT0B 2J8PA 2Y2NA 5AVBD 4WU8D 5BT1C 5AV8B 1WWSA 5B1LA 3X1TA 4CAYB 1AOIB 1Z2CB 5B1LD 3REJC 3AZFD 3AZMB 3X1TD 3MGSD 3X1VA 5CPKC 5BNXA 3WTPB 4G92B 3MGPA 3X1VD 3NQUB 3LJAA 5CPJC 2AROA 5AV6B 3MGPD 3LJAD 3AZKB 2AROD 2Y2MA 4WJ3C 3WAAA 3UTAC 1PZRA 3AZLD 3AV2D 1KX4C 3WAAD 3LZ1A 3AZNC 3LZ1D 4AWLB 5CP6B 5CHLB 1TAFB 3B6FC 4ZBJC 2HUEB 4H9QB 2BYMA 2F8NH 3W99A 1HQ3C 4R8PA 3MGQC 4H9RA 4X23C 3W99D 3C1BB 1P3LB 3C1CB 3TU4A 3W98B 3AZHA 2FJ7A 2G5HC 5GSUA 4J8XA 3TU4D 3AZHD 4LD9B 2NQBB 3P5JB 1EQZC 2FJ7D 4J8XD 2YFVA 3AV1A 4H9NB 3UT9A 1F66B 2BG1A 5AV5B 3AV1D 3AN2C 3A6NA 3AL0C 3A6ND 5B2JC 4XUJA 1BH8B 5JA4B 5B2IA 3REJB 1M19A 5B2ID 1M19D 1P3BA 2DF4C 2LY8A 2Y2QA 4DRBA 5CPJB 2IO5C 1P3BD 1ZLAB 3LELB 5F99C 1P3MA 3H0MC 1ID3C 3B0BA 3KWQB 4ZUXA 3X1SC 1KX3A 1P3OC 3AZLC 3AV2C 3B0CW 3KUYA 3REHA 1KX5C 3AZJC 1P3PA 3MNNA 3NQJB 3REKB 1P3PD 3UTBC 1M1AA 1HQ3B 3AFAA 4Z66B 3MGQB 5GT3C 4YM6A 1BH9B 3AFAD 5JRGB 4CSRA 2Y2OA 4YM6D 4H9PA
chains in the Genus database with same CATH topology
4DRAA 5AV9B 3MGRD 3AYWC 5GT0C 4E44A 3LZ0A 2RVQC 5B32D 5AV8C 3WA9B 5B32G 1ULYA 3LZ0D 4HGAC 3AZIC 3AZMC 4WU8B 5AVBB 5B2JB 2CV5A 1T3UA 4G92C 5DNMA 4QLCA 5B0YA 2CV5D 2CWEA 3V9RA 5DNMD 4QLCD 4UUZA 5B0YD 5B1LB 4Z5TC 3AZKC 3AZFB 3X1TB 5AY8D 3MGSB 1P3IA 1Q9CA 4KGCD 3B6GA 4WU9D 1P34A 5BS7C 1P3ID 4KUDA 3B6GD 1TZYA 2JCHA 5C3IB 3MGPB 1P34D 1ID3B 2XD1A 4KUDD 2AROB 1TZYD 3MVDC 1M18A 2F2AC 1M18D 3AZLB 3AV2B 3WAAB 2HUEC 4M6BA 1P3AC 3X1UC 2BYKA 3UTBB 1H3OB 4Z2MH 2Y2GA 3W97A 3UTAA 4XZQA 3C1BC 5AVCA 1P3GD 1KX4A 3W96A 4EO5C 3C1CC 1JFIA 3W97D 5AVCD 3W96D 2BYMB 4LD9C 3AZEA 3W99B 4J8WA 3H0LC 5GXQA 3AZED 1F66C 1U35A 4J8WD 5AV5C 5GXQD 3TU4B 2HIOA 2UWXA 5KDMA 1U35D 3AZHB 5B1MA 2FJ7B 2HIOD 5B40A 2Y2JA 5B31A 4J8XB 4J8UA 2NZDA 5B1MD 1P3KC 4HGAB 5B40D 5B32C 5B31D 2YFVB 4J8UD 3REIC 5B31G 3AZIB 3AV1B 2NZDD 3RELA 5B33A 1W2EA 1S32A 3RELD 3O62A 3A6NB 5B33D 1S32D 1ZLAC 4KGCA 3H0RC 4Z5TB 3O62D 3LELC 2Y2PA 1M19B 4YS3A 3KWQC 1P3BB 4YS3D 3MVDB 4WV4B 3REKC 4JJNA 1P3AB 3X1UB 3FDDA 4JJND 4Z66C 4H9SC 2XD5A 5DNNC 3VH5A 5JRGC 4EO5B 4R8PD 1N1JA 1P3PB 5BO0A 3WKJA 1P3OA 3KSYA 2DQNC 3VH6T 5AV9C 3WKJD 4H9OB 5GSUD 1KX5A 3AFAB 4J8VA 4YM6B 4WNNB 3WA9C 3UT9D 5FUGA 3MGRB 4H9PB 2Y2HA 5B0ZA 4WU8C 5AVBC 1WWIA 1P3KB 5B32B 3KXBA 3REIB 5B0ZD 3VH5W 4XUJD 3KXBD 5E5AA 5B1LC 3AZFC 3X1TC 3MGSC 5CPIA 5E5AD 3B0DB 5CPID 3X1VC 2CV5B 5C3IC 3MGPC 5B0YB 4CAYA 3LJAC 1P3MD 1AOIA 2AROC 5AY8B 2VQRA 4UUZB 4KGCB 1AOID 2YFWA 3WTPA 4WU9B 5BNVB 4UPKA 3WAAC 4ZUXD 1P34B 5AV6A 1KX3D 1TZYB 2Y2LA 5B24A 5AV6D 1KU5A 3KUYD 3REHD 1M18B 3LZ1C 3MNND 5B24D 4G91B 3R45A 1M1AD 5DNNB 2Y2IA 1P3FA 3W99C 5CP6A 1P3GB 2BYKB 1P3FD 3W97B 4H9QA 5AVCB 5CP6D 3W96B 3TU4C 3AZHC 3AZGA 3EPJA 2FJ7C 4J8XC 3AZGD 3AZEB 1P3LA 3W98A 5GXQB 3AV1C 1U35B 4LD9A 2HIOB 2NQBA 3A6NC 5B40B 2NQBD 4H9NA 5B31B 4J8UB 2PYOA 5AV5A 2NZDB 4XUJC 2PYOD 5B2IC 1M19C 3RELB 3X1VB 5BNXB 5BT1D 5B33B 1P3BC 1BH8A 3LJAB 3REJA 5CPKA 3REJD 1A7WA 5CPKD 5CPJA 4YS3B 3F6TA 4ZUXC 3IP4C 1KX3C 3LZ1B 3KUYC 3REHC 3UTAD 1P3PC 3MNNC 4XZQD 2G5IC 1KX4D 3AZNA 4JJNB 3AZND 3AFAC 1B6WA 3NQJA 4R8PB 3B6FA 4H9RB 4YM6C 2JE5A 3B6FD 1N1JB 1HQ3A 3MGRC 4Z66A 3MGQA 5GSUB 3EG5B 1F1EA 4X23A 1HQ3D 1BH9A 5JRGA 4NE6A 4X23D 3VH6W 3LZ0C 3UT9B 3WTPE 5AV9A 1EQZA 5B0ZB 1EQZD 3B0DC 4XUJB 2CV5C 3KXBB 5B2IB 3AN2A 5DNMC 4QLCC 5B0YC 2ZY3A 5AY8C 3AN2D 2F8NA 5E5AB 4KGCC 5B2JA 4WU9C 5CPIB 1P3IC 2F8ND 4NE5A 5B2JD 2F8NG 3B6GC 1P34C 1P3MB 4KUDC 3AZFA 1TZYC 3MGSA 1M18C 5F99A 4G91C 2YFWB 4ZUXB 1KX3B 5F99D 1ID3A 3KUYB 3REHB 1ID3D 3MNNB 3X1SA 5B24B 3AZLA 3AV2A 1P3GC 3X1SD 3A1KA 1M1AB 1P3OD 4XZQC 3R45B 5AVCC 3AZJA 2FFFB 3W96C 3W97C 5G49A 1KX5D 3AZJD 3UTBA 1H3OA 4CSRB 4J8VD 4KHAA 1P3FB 3AZEC 3UTBD 4J8WC 5GT3A 5GXQC 1U35C 5GT3D 2HIOC 3LZ0B 3AZGB 5B1MC 5B40C 2NZDC 5B31C 2Y2KA 4J8UC 3AYWA 1B67A 5GT0A 2L5AA 3AYWD 5AV8A 5GT0D 3RELC 5B33C 2RVQD 5AV8D 4NE3A 4QLCB 5DNMB 1S32C 3AZIA 3O62C 2ZM5A 3AZMA 3V9RB 2ZY5A 2PYOB 3AZID 3KFUG 1P3IB 4WZSB 3AZMD 3B6GB 3NQUA 3WTPD 4KUDB 4YS3C 4Z5TA 3AZKA 4Z5TD 3AZKD 5BS7A 5CPKB 3MVDA 1BFMA 4JJNC 2ZY2A 3MVDD 4R8PC 1TAFA 2ZY4A 3UTAB 4XZQB 1KX4B 1P3AA 1JFIB 3X1UA 4NFTA 1P3AD 3WKJC 5GSUC 3X1UD 3AZNB 3C1BA 2JSSA 3C1CA 4J8WB 3EPLA 3C1BD 4J8VC 1P3LD 3B6FB 3UT9C 4ZBJB 3C1CD 3W98D 2F8NK 5KDMB 4H9OA 5B1MB 4LD9D 4X23B 5B0ZC 4WNNA 1F66A 3KXBC 1F66D 5AV5D 3MGRA 1R4VA 3VH5T 5E5AC 1S32B 1P3KA 1EQZB 5B32A 5JA4A 5CPIC 3O62B 3REIA 1P3KD 3REID 1P3MC 4Z2MG 3AN2B 1HTAA 1AOIC 1ZLAA 3LELA 5CPJD 3EPKA 2F8NB 3WTPC 1ZLAD 3LELD 5AY8A 5AV6C 3VH6A 3KWQA 4WU9A 2RIQA 5B24C 2IO5B 3B0CT 3KWQD 5BNVA 5F99B 1M1AC 2W8SA 4E45A 3REKA 4DQYB 3REKD 1P3FC 5BO0B 3X1SB 4AWLC 3WKJB 1P3OB 4H9SA 5CP6C 5DNNA 4Z66D 3MGQD 1KX5B 3AZJB 3EPHA 5G49B 5DNND 4J8VB 5JRGD 3AZGC 1P3GA 3A1IA 4KHAB 1P3LC 5FUGB 5AV9D 3W98C 5GT3B 3WA9A 3WA9D 2NQBC 4WU8A 5AVBA 2PYOC 3AYWB 5GT0B 2J8PA 2Y2NA 5AVBD 4WU8D 5BT1C 5AV8B 1WWSA 5B1LA 3X1TA 4CAYB 1AOIB 1Z2CB 5B1LD 3REJC 3AZFD 3AZMB 3X1TD 3MGSD 3X1VA 5CPKC 5BNXA 3WTPB 4G92B 3MGPA 3X1VD 3NQUB 3LJAA 5CPJC 2AROA 5AV6B 3MGPD 3LJAD 3AZKB 2AROD 2Y2MA 4WJ3C 3WAAA 3UTAC 1PZRA 3AZLD 3AV2D 1KX4C 3WAAD 3LZ1A 3AZNC 3LZ1D 4AWLB 5CP6B 5CHLB 1TAFB 3B6FC 4ZBJC 2HUEB 4H9QB 2BYMA 2F8NH 3W99A 1HQ3C 4R8PA 3MGQC 4H9RA 4X23C 3W99D 3C1BB 1P3LB 3C1CB 3TU4A 3W98B 3AZHA 2FJ7A 2G5HC 5GSUA 4J8XA 3TU4D 3AZHD 4LD9B 2NQBB 3P5JB 1EQZC 2FJ7D 4J8XD 2YFVA 3AV1A 4H9NB 3UT9A 1F66B 2BG1A 5AV5B 3AV1D 3AN2C 3A6NA 3AL0C 3A6ND 5B2JC 4XUJA 1BH8B 5JA4B 5B2IA 3REJB 1M19A 5B2ID 1M19D 1P3BA 2DF4C 2LY8A 2Y2QA 4DRBA 5CPJB 2IO5C 1P3BD 1ZLAB 3LELB 5F99C 1P3MA 3H0MC 1ID3C 3B0BA 3KWQB 4ZUXA 3X1SC 1KX3A 1P3OC 3AZLC 3AV2C 3B0CW 3KUYA 3REHA 1KX5C 3AZJC 1P3PA 3MNNA 3NQJB 3REKB 1P3PD 3UTBC 1M1AA 1HQ3B 3AFAA 4Z66B 3MGQB 5GT3C 4YM6A 1BH9B 3AFAD 5JRGB 4CSRA 2Y2OA 4YM6D 4H9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRA A;  5AV9 B;  3MGR D;  3AYW C;  5GT0 C;  4E44 A;  3LZ0 A;  2RVQ C;  5B32 D;  5AV8 C;  3WA9 B;  5B32 G;  1ULY A;  3LZ0 D;  4HGA C;  3AZI C;  3AZM C;  4WU8 B;  5AVB B;  5B2J B;  2CV5 A;  4G92 C;  5DNM A;  4QLC A;  5B0Y A;  2CV5 D;  2CWE A;  3V9R A;  5DNM D;  4QLC D;  4UUZ A;  5B0Y D;  5B1L B;  4Z5T C;  3AZK C;  3AZF B;  3X1T B;  5AY8 D;  3MGS B;  1P3I A;  1Q9C A;  4KGC D;  3B6G A;  4WU9 D;  1P34 A;  5BS7 C;  1P3I D;  4KUD A;  3B6G D;  1TZY A;  5C3I B;  1P34 D;  3MGP B;  1ID3 B;  4KUD D;  2ARO B;  1TZY D;  3MVD C;  1M18 A;  1M18 D;  3AZL B;  3AV2 B;  3WAA B;  2HUE C;  4M6B A;  1P3A C;  3X1U C;  2BYK A;  3UTB B;  1H3O B;  4Z2M H;  3UTA A;  3W97 A;  4XZQ A;  3C1B C;  5AVC A;  1P3G D;  1KX4 A;  3W96 A;  4EO5 C;  3C1C C;  1JFI A;  3W97 D;  5AVC D;  3W96 D;  2BYM B;  4LD9 C;  3AZE A;  3W99 B;  4J8W A;  5GXQ A;  3AZE D;  1F66 C;  1U35 A;  4J8W D;  5AV5 C;  5GXQ D;  3TU4 B;  2HIO A;  5KDM A;  1U35 D;  3AZH B;  5B1M A;  2FJ7 B;  2HIO D;  5B40 A;  5B31 A;  4J8X B;  4J8U A;  2NZD A;  5B1M D;  1P3K C;  4HGA B;  5B40 D;  5B32 C;  5B31 D;  2YFV B;  4J8U D;  3REI C;  5B31 G;  3AZI B;  3AV1 B;  2NZD D;  3REL A;  5B33 A;  1S32 A;  3REL D;  3O62 A;  3A6N B;  5B33 D;  1S32 D;  1ZLA C;  4KGC A;  3LEL C;  4Z5T B;  3O62 D;  1M19 B;  4YS3 A;  3KWQ C;  1P3B B;  4YS3 D;  3MVD B;  4WV4 B;  3REK C;  4JJN A;  1P3A B;  3X1U B;  4JJN D;  4Z66 C;  4H9S C;  5DNN C;  3VH5 A;  5JRG C;  4EO5 B;  4R8P D;  1N1J A;  1P3P B;  5BO0 A;  3WKJ A;  1P3O A;  3KSY A;  3VH6 T;  5AV9 C;  3WKJ D;  4H9O B;  5GSU D;  1KX5 A;  3AFA B;  4J8V A;  4YM6 B;  4WNN B;  3WA9 C;  3UT9 D;  5FUG A;  3MGR B;  4H9P B;  5B0Z A;  4WU8 C;  5AVB C;  1WWI A;  1P3K B;  5B32 B;  3KXB A;  3REI B;  5B0Z D;  3VH5 W;  4XUJ D;  3KXB D;  5E5A A;  5B1L C;  3AZF C;  3X1T C;  3MGS C;  5CPI A;  5E5A D;  3B0D B;  5CPI D;  3X1V C;  2CV5 B;  5C3I C;  3MGP C;  5B0Y B;  4CAY A;  3LJA C;  1P3M D;  1AOI A;  2ARO C;  5AY8 B;  4UUZ B;  4KGC B;  1AOI D;  2YFW A;  3WTP A;  4WU9 B;  5BNV B;  3WAA C;  4ZUX D;  1P34 B;  5AV6 A;  1KX3 D;  1TZY B;  5B24 A;  5AV6 D;  1KU5 A;  3KUY D;  3REH D;  1M18 B;  3LZ1 C;  3MNN D;  5B24 D;  4G91 B;  3R45 A;  1M1A D;  5DNN B;  1P3F A;  3W99 C;  5CP6 A;  1P3G B;  2BYK B;  1P3F D;  3W97 B;  4H9Q A;  5AVC B;  5CP6 D;  3W96 B;  3TU4 C;  3AZH C;  3AZG A;  2FJ7 C;  4J8X C;  3AZG D;  3AZE B;  1P3L A;  3W98 A;  5GXQ B;  3AV1 C;  1U35 B;  4LD9 A;  2HIO B;  2NQB A;  3A6N C;  5B40 B;  2NQB D;  4H9N A;  5B31 B;  4J8U B;  2PYO A;  5AV5 A;  2NZD B;  4XUJ C;  2PYO D;  5B2I C;  1M19 C;  3REL B;  3X1V B;  5BNX B;  5BT1 D;  5B33 B;  1P3B C;  1BH8 A;  3LJA B;  3REJ A;  5CPK A;  3REJ D;  1A7W A;  5CPK D;  5CPJ A;  4YS3 B;  4ZUX C;  1KX3 C;  3LZ1 B;  3KUY C;  3REH C;  3UTA D;  1P3P C;  3MNN C;  4XZQ D;  1KX4 D;  3AZN A;  4JJN B;  3AZN D;  3AFA C;  1B6W A;  3NQJ A;  4R8P B;  3B6F A;  4H9R B;  4YM6 C;  3B6F D;  1N1J B;  1HQ3 A;  3MGR C;  4Z66 A;  3MGQ A;  5GSU B;  4X23 A;  1F1E A;  1HQ3 D;  1BH9 A;  5JRG A;  4NE6 A;  4X23 D;  3VH6 W;  3LZ0 C;  3UT9 B;  3WTP E;  5AV9 A;  1EQZ A;  5B0Z B;  1EQZ D;  3B0D C;  4XUJ B;  2CV5 C;  3KXB B;  5B2I B;  3AN2 A;  5DNM C;  4QLC C;  5B0Y C;  5AY8 C;  3AN2 D;  2F8N A;  5E5A B;  4KGC C;  5B2J A;  4WU9 C;  5CPI B;  1P3I C;  2F8N D;  4NE5 A;  5B2J D;  2F8N G;  3B6G C;  1P34 C;  1P3M B;  4KUD C;  3AZF A;  1TZY C;  3MGS A;  1M18 C;  5F99 A;  4G91 C;  2YFW B;  4ZUX B;  1KX3 B;  5F99 D;  1ID3 A;  3KUY B;  3REH B;  1ID3 D;  3MNN B;  3X1S A;  5B24 B;  3AZL A;  3AV2 A;  1P3G C;  3X1S D;  3W97 C;  1M1A B;  1P3O D;  4XZQ C;  3R45 B;  5AVC C;  3AZJ A;  3W96 C;  5G49 A;  1KX5 D;  3AZJ D;  3UTB A;  1H3O A;  4CSR B;  4J8V D;  4KHA A;  1P3F B;  3AZE C;  3UTB D;  4J8W C;  5GT3 A;  5GXQ C;  1U35 C;  5GT3 D;  2HIO C;  3LZ0 B;  3AZG B;  5B1M C;  5B40 C;  2NZD C;  5B31 C;  4J8U C;  3AYW A;  1B67 A;  5GT0 A;  2L5A A;  3AYW D;  5AV8 A;  5GT0 D;  3REL C;  5B33 C;  2RVQ D;  5AV8 D;  4NE3 A;  4QLC B;  5DNM B;  1S32 C;  3AZI A;  3O62 C;  3AZM A;  3V9R B;  2PYO B;  3AZI D;  1P3I B;  4WZS B;  3AZM D;  3B6G B;  3NQU A;  3WTP D;  4KUD B;  4YS3 C;  4Z5T A;  3AZK A;  4Z5T D;  3AZK D;  5BS7 A;  5CPK B;  3MVD A;  1BFM A;  4JJN C;  3MVD D;  4R8P C;  1TAF A;  3UTA B;  4XZQ B;  1KX4 B;  1P3A A;  1JFI B;  3X1U A;  4NFT A;  1P3A D;  3WKJ C;  5GSU C;  3X1U D;  3AZN B;  3C1B A;  2JSS A;  3C1C A;  4J8W B;  3C1B D;  4J8V C;  1P3L D;  3B6F B;  3UT9 C;  4ZBJ B;  3C1C D;  3W98 D;  2F8N K;  5KDM B;  4H9O A;  5B1M B;  4LD9 D;  4X23 B;  5B0Z C;  4WNN A;  1F66 A;  3KXB C;  1F66 D;  5AV5 D;  3MGR A;  1R4V A;  3VH5 T;  5E5A C;  1S32 B;  1P3K A;  1EQZ B;  5B32 A;  5JA4 A;  5CPI C;  3O62 B;  3REI A;  1P3K D;  3REI D;  1P3M C;  4Z2M G;  3AN2 B;  1HTA A;  1AOI C;  1ZLA A;  3LEL A;  5CPJ D;  2F8N B;  3WTP C;  1ZLA D;  3LEL D;  5AY8 A;  5AV6 C;  3VH6 A;  3KWQ A;  4WU9 A;  5B24 C;  2IO5 B;  3B0C T;  3KWQ D;  5BNV A;  5F99 B;  1M1A C;  4E45 A;  3REK A;  3REK D;  1P3F C;  5BO0 B;  3X1S B;  4AWL C;  3WKJ B;  1P3O B;  4H9S A;  5CP6 C;  5DNN A;  4Z66 D;  3MGQ D;  1KX5 B;  3AZJ B;  5G49 B;  5DNN D;  4J8V B;  5JRG D;  3AZG C;  1P3G A;  4KHA B;  1P3L C;  5FUG B;  5AV9 D;  3W98 C;  5GT3 B;  3WA9 A;  3WA9 D;  2NQB C;  4WU8 A;  5AVB A;  2PYO C;  3AYW B;  5GT0 B;  4WU8 D;  5AVB D;  5BT1 C;  5AV8 B;  1WWS A;  5B1L A;  3X1T A;  4CAY B;  1AOI B;  3REJ C;  5B1L D;  3AZF D;  3AZM B;  3X1T D;  3MGS D;  3X1V A;  5CPK C;  5BNX A;  3WTP B;  4G92 B;  3MGP A;  3X1V D;  3NQU B;  3LJA A;  5CPJ C;  2ARO A;  5AV6 B;  3MGP D;  3LJA D;  3AZK B;  2ARO D;  3WAA A;  3UTA C;  3AZL D;  3AV2 D;  1KX4 C;  3WAA D;  3LZ1 A;  3AZN C;  3LZ1 D;  4AWL B;  5CP6 B;  5CHL B;  1TAF B;  3B6F C;  4ZBJ C;  2HUE B;  4H9Q B;  2BYM A;  2F8N H;  3W99 A;  1HQ3 C;  4R8P A;  3MGQ C;  4H9R A;  4X23 C;  3W99 D;  3C1B B;  1P3L B;  3C1C B;  3TU4 A;  3W98 B;  3AZH A;  2FJ7 A;  5GSU A;  3TU4 D;  4J8X A;  3AZH D;  4LD9 B;  2NQB B;  1EQZ C;  2FJ7 D;  4J8X D;  2YFV A;  3AV1 A;  4H9N B;  3UT9 A;  1F66 B;  5AV5 B;  3AV1 D;  3AN2 C;  3A6N A;  3A6N D;  5B2J C;  4XUJ A;  1BH8 B;  5JA4 B;  5B2I A;  3REJ B;  1M19 A;  5B2I D;  1M19 D;  1P3B A;  2LY8 A;  4DRB A;  5CPJ B;  2IO5 C;  1P3B D;  1ZLA B;  3LEL B;  5F99 C;  1P3M A;  1ID3 C;  3B0B A;  3KWQ B;  4ZUX A;  3X1S C;  1KX3 A;  1P3O C;  3AZL C;  3AV2 C;  3B0C W;  3KUY A;  3REH A;  1KX5 C;  3AZJ C;  1P3P A;  3MNN A;  3NQJ B;  3REK B;  1P3P D;  3UTB C;  1M1A A;  1HQ3 B;  3AFA A;  4Z66 B;  3MGQ B;  5GT3 C;  4YM6 A;  1BH9 B;  3AFA D;  5JRG B;  4CSR A;  4YM6 D;  4H9P A; 
#chains in the Genus database with same CATH topology
 4DRA A;  5AV9 B;  3MGR D;  3AYW C;  5GT0 C;  4E44 A;  3LZ0 A;  2RVQ C;  5B32 D;  5AV8 C;  3WA9 B;  5B32 G;  1ULY A;  3LZ0 D;  4HGA C;  3AZI C;  3AZM C;  4WU8 B;  5AVB B;  5B2J B;  2CV5 A;  1T3U A;  4G92 C;  5DNM A;  4QLC A;  5B0Y A;  2CV5 D;  2CWE A;  3V9R A;  5DNM D;  4QLC D;  4UUZ A;  5B0Y D;  5B1L B;  4Z5T C;  3AZK C;  3AZF B;  3X1T B;  5AY8 D;  3MGS B;  1P3I A;  1Q9C A;  4KGC D;  3B6G A;  4WU9 D;  1P34 A;  5BS7 C;  1P3I D;  4KUD A;  3B6G D;  1TZY A;  2JCH A;  5C3I B;  3MGP B;  1P34 D;  1ID3 B;  2XD1 A;  4KUD D;  2ARO B;  1TZY D;  3MVD C;  1M18 A;  2F2A C;  1M18 D;  3AZL B;  3AV2 B;  3WAA B;  2HUE C;  4M6B A;  1P3A C;  3X1U C;  2BYK A;  3UTB B;  1H3O B;  4Z2M H;  2Y2G A;  3W97 A;  3UTA A;  4XZQ A;  3C1B C;  5AVC A;  1P3G D;  1KX4 A;  3W96 A;  4EO5 C;  3C1C C;  1JFI A;  3W97 D;  5AVC D;  3W96 D;  2BYM B;  4LD9 C;  3AZE A;  3W99 B;  4J8W A;  3H0L C;  5GXQ A;  3AZE D;  1F66 C;  1U35 A;  4J8W D;  5AV5 C;  5GXQ D;  3TU4 B;  2HIO A;  2UWX A;  5KDM A;  1U35 D;  3AZH B;  5B1M A;  2FJ7 B;  2HIO D;  5B40 A;  2Y2J A;  5B31 A;  4J8X B;  4J8U A;  2NZD A;  5B1M D;  1P3K C;  4HGA B;  5B40 D;  5B32 C;  5B31 D;  2YFV B;  4J8U D;  3REI C;  5B31 G;  3AZI B;  3AV1 B;  2NZD D;  3REL A;  5B33 A;  1W2E A;  1S32 A;  3REL D;  3O62 A;  3A6N B;  5B33 D;  1S32 D;  1ZLA C;  4KGC A;  3H0R C;  4Z5T B;  3O62 D;  3LEL C;  2Y2P A;  1M19 B;  4YS3 A;  3KWQ C;  1P3B B;  4YS3 D;  3MVD B;  4WV4 B;  3REK C;  4JJN A;  1P3A B;  3X1U B;  3FDD A;  4JJN D;  4Z66 C;  4H9S C;  2XD5 A;  5DNN C;  3VH5 A;  5JRG C;  4EO5 B;  4R8P D;  1N1J A;  1P3P B;  5BO0 A;  3WKJ A;  1P3O A;  3KSY A;  2DQN C;  3VH6 T;  5AV9 C;  3WKJ D;  4H9O B;  5GSU D;  1KX5 A;  3AFA B;  4J8V A;  4YM6 B;  4WNN B;  3WA9 C;  3UT9 D;  5FUG A;  3MGR B;  4H9P B;  2Y2H A;  5B0Z A;  4WU8 C;  5AVB C;  1WWI A;  1P3K B;  5B32 B;  3KXB A;  3REI B;  5B0Z D;  3VH5 W;  4XUJ D;  3KXB D;  5E5A A;  5B1L C;  3AZF C;  3X1T C;  3MGS C;  5CPI A;  5E5A D;  3B0D B;  5CPI D;  3X1V C;  2CV5 B;  5C3I C;  3MGP C;  5B0Y B;  4CAY A;  3LJA C;  1P3M D;  1AOI A;  2ARO C;  5AY8 B;  2VQR A;  4UUZ B;  4KGC B;  1AOI D;  2YFW A;  3WTP A;  4WU9 B;  5BNV B;  4UPK A;  3WAA C;  4ZUX D;  1P34 B;  5AV6 A;  1KX3 D;  1TZY B;  2Y2L A;  5B24 A;  5AV6 D;  1KU5 A;  3KUY D;  3REH D;  1M18 B;  3LZ1 C;  3MNN D;  5B24 D;  4G91 B;  3R45 A;  1M1A D;  5DNN B;  2Y2I A;  1P3F A;  3W99 C;  5CP6 A;  1P3G B;  2BYK B;  1P3F D;  3W97 B;  4H9Q A;  5AVC B;  5CP6 D;  3W96 B;  3TU4 C;  3AZH C;  3AZG A;  3EPJ A;  2FJ7 C;  4J8X C;  3AZG D;  3AZE B;  1P3L A;  3W98 A;  5GXQ B;  3AV1 C;  1U35 B;  4LD9 A;  2HIO B;  2NQB A;  3A6N C;  5B40 B;  2NQB D;  4H9N A;  5B31 B;  4J8U B;  2PYO A;  5AV5 A;  2NZD B;  4XUJ C;  2PYO D;  5B2I C;  1M19 C;  3REL B;  3X1V B;  5BNX B;  5BT1 D;  5B33 B;  1P3B C;  1BH8 A;  3LJA B;  3REJ A;  5CPK A;  3REJ D;  1A7W A;  5CPK D;  5CPJ A;  4YS3 B;  3F6T A;  4ZUX C;  3IP4 C;  1KX3 C;  3LZ1 B;  3KUY C;  3REH C;  3UTA D;  1P3P C;  3MNN C;  4XZQ D;  2G5I C;  1KX4 D;  3AZN A;  4JJN B;  3AZN D;  3AFA C;  1B6W A;  3NQJ A;  4R8P B;  3B6F A;  4H9R B;  4YM6 C;  2JE5 A;  3B6F D;  1N1J B;  1HQ3 A;  3MGR C;  4Z66 A;  3MGQ A;  5GSU B;  3EG5 B;  1F1E A;  4X23 A;  1HQ3 D;  1BH9 A;  5JRG A;  4NE6 A;  4X23 D;  3VH6 W;  3LZ0 C;  3UT9 B;  3WTP E;  5AV9 A;  1EQZ A;  5B0Z B;  1EQZ D;  3B0D C;  4XUJ B;  2CV5 C;  3KXB B;  5B2I B;  3AN2 A;  5DNM C;  4QLC C;  5B0Y C;  2ZY3 A;  5AY8 C;  3AN2 D;  2F8N A;  5E5A B;  4KGC C;  5B2J A;  4WU9 C;  5CPI B;  1P3I C;  2F8N D;  4NE5 A;  5B2J D;  2F8N G;  3B6G C;  1P34 C;  1P3M B;  4KUD C;  3AZF A;  1TZY C;  3MGS A;  1M18 C;  5F99 A;  4G91 C;  2YFW B;  4ZUX B;  1KX3 B;  5F99 D;  1ID3 A;  3KUY B;  3REH B;  1ID3 D;  3MNN B;  3X1S A;  5B24 B;  3AZL A;  3AV2 A;  1P3G C;  3X1S D;  3A1K A;  1M1A B;  1P3O D;  4XZQ C;  3R45 B;  5AVC C;  3AZJ A;  2FFF B;  3W96 C;  3W97 C;  5G49 A;  1KX5 D;  3AZJ D;  3UTB A;  1H3O A;  4CSR B;  4J8V D;  4KHA A;  1P3F B;  3AZE C;  3UTB D;  4J8W C;  5GT3 A;  5GXQ C;  1U35 C;  5GT3 D;  2HIO C;  3LZ0 B;  3AZG B;  5B1M C;  5B40 C;  2NZD C;  5B31 C;  2Y2K A;  4J8U C;  3AYW A;  1B67 A;  5GT0 A;  2L5A A;  3AYW D;  5AV8 A;  5GT0 D;  3REL C;  5B33 C;  2RVQ D;  5AV8 D;  4NE3 A;  4QLC B;  5DNM B;  1S32 C;  3AZI A;  3O62 C;  2ZM5 A;  3AZM A;  3V9R B;  2ZY5 A;  2PYO B;  3AZI D;  3KFU G;  1P3I B;  4WZS B;  3AZM D;  3B6G B;  3NQU A;  3WTP D;  4KUD B;  4YS3 C;  4Z5T A;  3AZK A;  4Z5T D;  3AZK D;  5BS7 A;  5CPK B;  3MVD A;  1BFM A;  4JJN C;  2ZY2 A;  3MVD D;  4R8P C;  1TAF A;  2ZY4 A;  3UTA B;  4XZQ B;  1KX4 B;  1P3A A;  1JFI B;  3X1U A;  4NFT A;  1P3A D;  3WKJ C;  5GSU C;  3X1U D;  3AZN B;  3C1B A;  2JSS A;  3C1C A;  4J8W B;  3EPL A;  3C1B D;  4J8V C;  1P3L D;  3B6F B;  3UT9 C;  4ZBJ B;  3C1C D;  3W98 D;  2F8N K;  5KDM B;  4H9O A;  5B1M B;  4LD9 D;  4X23 B;  5B0Z C;  4WNN A;  1F66 A;  3KXB C;  1F66 D;  5AV5 D;  3MGR A;  1R4V A;  3VH5 T;  5E5A C;  1S32 B;  1P3K A;  1EQZ B;  5B32 A;  5JA4 A;  5CPI C;  3O62 B;  3REI A;  1P3K D;  3REI D;  1P3M C;  4Z2M G;  3AN2 B;  1HTA A;  1AOI C;  1ZLA A;  3LEL A;  5CPJ D;  3EPK A;  2F8N B;  3WTP C;  1ZLA D;  3LEL D;  5AY8 A;  5AV6 C;  3VH6 A;  3KWQ A;  4WU9 A;  2RIQ A;  5B24 C;  2IO5 B;  3B0C T;  3KWQ D;  5BNV A;  5F99 B;  1M1A C;  2W8S A;  4E45 A;  3REK A;  4DQY B;  3REK D;  1P3F C;  5BO0 B;  3X1S B;  4AWL C;  3WKJ B;  1P3O B;  4H9S A;  5CP6 C;  5DNN A;  4Z66 D;  3MGQ D;  1KX5 B;  3AZJ B;  3EPH A;  5G49 B;  5DNN D;  4J8V B;  5JRG D;  3AZG C;  1P3G A;  3A1I A;  4KHA B;  1P3L C;  5FUG B;  5AV9 D;  3W98 C;  5GT3 B;  3WA9 A;  3WA9 D;  2NQB C;  4WU8 A;  5AVB A;  2PYO C;  3AYW B;  5GT0 B;  2J8P A;  2Y2N A;  5AVB D;  4WU8 D;  5BT1 C;  5AV8 B;  1WWS A;  5B1L A;  3X1T A;  4CAY B;  1AOI B;  1Z2C B;  5B1L D;  3REJ C;  3AZF D;  3AZM B;  3X1T D;  3MGS D;  3X1V A;  5CPK C;  5BNX A;  3WTP B;  4G92 B;  3MGP A;  3X1V D;  3NQU B;  3LJA A;  5CPJ C;  2ARO A;  5AV6 B;  3MGP D;  3LJA D;  3AZK B;  2ARO D;  2Y2M A;  4WJ3 C;  3WAA A;  3UTA C;  1PZR A;  3AZL D;  3AV2 D;  1KX4 C;  3WAA D;  3LZ1 A;  3AZN C;  3LZ1 D;  4AWL B;  5CP6 B;  5CHL B;  1TAF B;  3B6F C;  4ZBJ C;  2HUE B;  4H9Q B;  2BYM A;  2F8N H;  3W99 A;  1HQ3 C;  4R8P A;  3MGQ C;  4H9R A;  4X23 C;  3W99 D;  3C1B B;  1P3L B;  3C1C B;  3TU4 A;  3W98 B;  3AZH A;  2FJ7 A;  2G5H C;  5GSU A;  4J8X A;  3TU4 D;  3AZH D;  4LD9 B;  2NQB B;  3P5J B;  1EQZ C;  2FJ7 D;  4J8X D;  2YFV A;  3AV1 A;  4H9N B;  3UT9 A;  1F66 B;  2BG1 A;  5AV5 B;  3AV1 D;  3AN2 C;  3A6N A;  3AL0 C;  3A6N D;  5B2J C;  4XUJ A;  1BH8 B;  5JA4 B;  5B2I A;  3REJ B;  1M19 A;  5B2I D;  1M19 D;  1P3B A;  2DF4 C;  2LY8 A;  2Y2Q A;  4DRB A;  5CPJ B;  2IO5 C;  1P3B D;  1ZLA B;  3LEL B;  5F99 C;  1P3M A;  3H0M C;  1ID3 C;  3B0B A;  3KWQ B;  4ZUX A;  3X1S C;  1KX3 A;  1P3O C;  3AZL C;  3AV2 C;  3B0C W;  3KUY A;  3REH A;  1KX5 C;  3AZJ C;  1P3P A;  3MNN A;  3NQJ B;  3REK B;  1P3P D;  3UTB C;  1M1A A;  1HQ3 B;  3AFA A;  4Z66 B;  3MGQ B;  5GT3 C;  4YM6 A;  1BH9 B;  3AFA D;  5JRG B;  4CSR A;  2Y2O A;  4YM6 D;  4H9P A; 
#chains in the Genus database with same CATH homology
 4DRA A;  5AV9 B;  3MGR D;  3AYW C;  5GT0 C;  4E44 A;  3LZ0 A;  2RVQ C;  5B32 D;  5AV8 C;  3WA9 B;  5B32 G;  1ULY A;  3LZ0 D;  4HGA C;  3AZI C;  3AZM C;  4WU8 B;  5AVB B;  5B2J B;  2CV5 A;  1T3U A;  4G92 C;  5DNM A;  4QLC A;  5B0Y A;  2CV5 D;  2CWE A;  3V9R A;  5DNM D;  4QLC D;  4UUZ A;  5B0Y D;  5B1L B;  4Z5T C;  3AZK C;  3AZF B;  3X1T B;  5AY8 D;  3MGS B;  1P3I A;  1Q9C A;  4KGC D;  3B6G A;  4WU9 D;  1P34 A;  5BS7 C;  1P3I D;  4KUD A;  3B6G D;  1TZY A;  2JCH A;  5C3I B;  3MGP B;  1P34 D;  1ID3 B;  2XD1 A;  4KUD D;  2ARO B;  1TZY D;  3MVD C;  1M18 A;  2F2A C;  1M18 D;  3AZL B;  3AV2 B;  3WAA B;  2HUE C;  4M6B A;  1P3A C;  3X1U C;  2BYK A;  3UTB B;  1H3O B;  4Z2M H;  2Y2G A;  3W97 A;  3UTA A;  4XZQ A;  3C1B C;  5AVC A;  1P3G D;  1KX4 A;  3W96 A;  4EO5 C;  3C1C C;  1JFI A;  3W97 D;  5AVC D;  3W96 D;  2BYM B;  4LD9 C;  3AZE A;  3W99 B;  4J8W A;  3H0L C;  5GXQ A;  3AZE D;  1F66 C;  1U35 A;  4J8W D;  5AV5 C;  5GXQ D;  3TU4 B;  2HIO A;  2UWX A;  5KDM A;  1U35 D;  3AZH B;  5B1M A;  2FJ7 B;  2HIO D;  5B40 A;  2Y2J A;  5B31 A;  4J8X B;  4J8U A;  2NZD A;  5B1M D;  1P3K C;  4HGA B;  5B40 D;  5B32 C;  5B31 D;  2YFV B;  4J8U D;  3REI C;  5B31 G;  3AZI B;  3AV1 B;  2NZD D;  3REL A;  5B33 A;  1W2E A;  1S32 A;  3REL D;  3O62 A;  3A6N B;  5B33 D;  1S32 D;  1ZLA C;  4KGC A;  3H0R C;  4Z5T B;  3O62 D;  3LEL C;  2Y2P A;  1M19 B;  4YS3 A;  3KWQ C;  1P3B B;  4YS3 D;  3MVD B;  4WV4 B;  3REK C;  4JJN A;  1P3A B;  3X1U B;  3FDD A;  4JJN D;  4Z66 C;  4H9S C;  2XD5 A;  5DNN C;  3VH5 A;  5JRG C;  4EO5 B;  4R8P D;  1N1J A;  1P3P B;  5BO0 A;  3WKJ A;  1P3O A;  3KSY A;  2DQN C;  3VH6 T;  5AV9 C;  3WKJ D;  4H9O B;  5GSU D;  1KX5 A;  3AFA B;  4J8V A;  4YM6 B;  4WNN B;  3WA9 C;  3UT9 D;  5FUG A;  3MGR B;  4H9P B;  2Y2H A;  5B0Z A;  4WU8 C;  5AVB C;  1WWI A;  1P3K B;  5B32 B;  3KXB A;  3REI B;  5B0Z D;  3VH5 W;  4XUJ D;  3KXB D;  5E5A A;  5B1L C;  3AZF C;  3X1T C;  3MGS C;  5CPI A;  5E5A D;  3B0D B;  5CPI D;  3X1V C;  2CV5 B;  5C3I C;  3MGP C;  5B0Y B;  4CAY A;  3LJA C;  1P3M D;  1AOI A;  2ARO C;  5AY8 B;  2VQR A;  4UUZ B;  4KGC B;  1AOI D;  2YFW A;  3WTP A;  4WU9 B;  5BNV B;  4UPK A;  3WAA C;  4ZUX D;  1P34 B;  5AV6 A;  1KX3 D;  1TZY B;  2Y2L A;  5B24 A;  5AV6 D;  1KU5 A;  3KUY D;  3REH D;  1M18 B;  3LZ1 C;  3MNN D;  5B24 D;  4G91 B;  3R45 A;  1M1A D;  5DNN B;  2Y2I A;  1P3F A;  3W99 C;  5CP6 A;  1P3G B;  2BYK B;  1P3F D;  3W97 B;  4H9Q A;  5AVC B;  5CP6 D;  3W96 B;  3TU4 C;  3AZH C;  3AZG A;  3EPJ A;  2FJ7 C;  4J8X C;  3AZG D;  3AZE B;  1P3L A;  3W98 A;  5GXQ B;  3AV1 C;  1U35 B;  4LD9 A;  2HIO B;  2NQB A;  3A6N C;  5B40 B;  2NQB D;  4H9N A;  5B31 B;  4J8U B;  2PYO A;  5AV5 A;  2NZD B;  4XUJ C;  2PYO D;  5B2I C;  1M19 C;  3REL B;  3X1V B;  5BNX B;  5BT1 D;  5B33 B;  1P3B C;  1BH8 A;  3LJA B;  3REJ A;  5CPK A;  3REJ D;  1A7W A;  5CPK D;  5CPJ A;  4YS3 B;  3F6T A;  4ZUX C;  3IP4 C;  1KX3 C;  3LZ1 B;  3KUY C;  3REH C;  3UTA D;  1P3P C;  3MNN C;  4XZQ D;  2G5I C;  1KX4 D;  3AZN A;  4JJN B;  3AZN D;  3AFA C;  1B6W A;  3NQJ A;  4R8P B;  3B6F A;  4H9R B;  4YM6 C;  2JE5 A;  3B6F D;  1N1J B;  1HQ3 A;  3MGR C;  4Z66 A;  3MGQ A;  5GSU B;  3EG5 B;  1F1E A;  4X23 A;  1HQ3 D;  1BH9 A;  5JRG A;  4NE6 A;  4X23 D;  3VH6 W;  3LZ0 C;  3UT9 B;  3WTP E;  5AV9 A;  1EQZ A;  5B0Z B;  1EQZ D;  3B0D C;  4XUJ B;  2CV5 C;  3KXB B;  5B2I B;  3AN2 A;  5DNM C;  4QLC C;  5B0Y C;  2ZY3 A;  5AY8 C;  3AN2 D;  2F8N A;  5E5A B;  4KGC C;  5B2J A;  4WU9 C;  5CPI B;  1P3I C;  2F8N D;  4NE5 A;  5B2J D;  2F8N G;  3B6G C;  1P34 C;  1P3M B;  4KUD C;  3AZF A;  1TZY C;  3MGS A;  1M18 C;  5F99 A;  4G91 C;  2YFW B;  4ZUX B;  1KX3 B;  5F99 D;  1ID3 A;  3KUY B;  3REH B;  1ID3 D;  3MNN B;  3X1S A;  5B24 B;  3AZL A;  3AV2 A;  1P3G C;  3X1S D;  3A1K A;  1M1A B;  1P3O D;  4XZQ C;  3R45 B;  5AVC C;  3AZJ A;  2FFF B;  3W96 C;  3W97 C;  5G49 A;  1KX5 D;  3AZJ D;  3UTB A;  1H3O A;  4CSR B;  4J8V D;  4KHA A;  1P3F B;  3AZE C;  3UTB D;  4J8W C;  5GT3 A;  5GXQ C;  1U35 C;  5GT3 D;  2HIO C;  3LZ0 B;  3AZG B;  5B1M C;  5B40 C;  2NZD C;  5B31 C;  2Y2K A;  4J8U C;  3AYW A;  1B67 A;  5GT0 A;  2L5A A;  3AYW D;  5AV8 A;  5GT0 D;  3REL C;  5B33 C;  2RVQ D;  5AV8 D;  4NE3 A;  4QLC B;  5DNM B;  1S32 C;  3AZI A;  3O62 C;  2ZM5 A;  3AZM A;  3V9R B;  2ZY5 A;  2PYO B;  3AZI D;  3KFU G;  1P3I B;  4WZS B;  3AZM D;  3B6G B;  3NQU A;  3WTP D;  4KUD B;  4YS3 C;  4Z5T A;  3AZK A;  4Z5T D;  3AZK D;  5BS7 A;  5CPK B;  3MVD A;  1BFM A;  4JJN C;  2ZY2 A;  3MVD D;  4R8P C;  1TAF A;  2ZY4 A;  3UTA B;  4XZQ B;  1KX4 B;  1P3A A;  1JFI B;  3X1U A;  4NFT A;  1P3A D;  3WKJ C;  5GSU C;  3X1U D;  3AZN B;  3C1B A;  2JSS A;  3C1C A;  4J8W B;  3EPL A;  3C1B D;  4J8V C;  1P3L D;  3B6F B;  3UT9 C;  4ZBJ B;  3C1C D;  3W98 D;  2F8N K;  5KDM B;  4H9O A;  5B1M B;  4LD9 D;  4X23 B;  5B0Z C;  4WNN A;  1F66 A;  3KXB C;  1F66 D;  5AV5 D;  3MGR A;  1R4V A;  3VH5 T;  5E5A C;  1S32 B;  1P3K A;  1EQZ B;  5B32 A;  5JA4 A;  5CPI C;  3O62 B;  3REI A;  1P3K D;  3REI D;  1P3M C;  4Z2M G;  3AN2 B;  1HTA A;  1AOI C;  1ZLA A;  3LEL A;  5CPJ D;  3EPK A;  2F8N B;  3WTP C;  1ZLA D;  3LEL D;  5AY8 A;  5AV6 C;  3VH6 A;  3KWQ A;  4WU9 A;  2RIQ A;  5B24 C;  2IO5 B;  3B0C T;  3KWQ D;  5BNV A;  5F99 B;  1M1A C;  2W8S A;  4E45 A;  3REK A;  4DQY B;  3REK D;  1P3F C;  5BO0 B;  3X1S B;  4AWL C;  3WKJ B;  1P3O B;  4H9S A;  5CP6 C;  5DNN A;  4Z66 D;  3MGQ D;  1KX5 B;  3AZJ B;  3EPH A;  5G49 B;  5DNN D;  4J8V B;  5JRG D;  3AZG C;  1P3G A;  3A1I A;  4KHA B;  1P3L C;  5FUG B;  5AV9 D;  3W98 C;  5GT3 B;  3WA9 A;  3WA9 D;  2NQB C;  4WU8 A;  5AVB A;  2PYO C;  3AYW B;  5GT0 B;  2J8P A;  2Y2N A;  5AVB D;  4WU8 D;  5BT1 C;  5AV8 B;  1WWS A;  5B1L A;  3X1T A;  4CAY B;  1AOI B;  1Z2C B;  5B1L D;  3REJ C;  3AZF D;  3AZM B;  3X1T D;  3MGS D;  3X1V A;  5CPK C;  5BNX A;  3WTP B;  4G92 B;  3MGP A;  3X1V D;  3NQU B;  3LJA A;  5CPJ C;  2ARO A;  5AV6 B;  3MGP D;  3LJA D;  3AZK B;  2ARO D;  2Y2M A;  4WJ3 C;  3WAA A;  3UTA C;  1PZR A;  3AZL D;  3AV2 D;  1KX4 C;  3WAA D;  3LZ1 A;  3AZN C;  3LZ1 D;  4AWL B;  5CP6 B;  5CHL B;  1TAF B;  3B6F C;  4ZBJ C;  2HUE B;  4H9Q B;  2BYM A;  2F8N H;  3W99 A;  1HQ3 C;  4R8P A;  3MGQ C;  4H9R A;  4X23 C;  3W99 D;  3C1B B;  1P3L B;  3C1C B;  3TU4 A;  3W98 B;  3AZH A;  2FJ7 A;  2G5H C;  5GSU A;  4J8X A;  3TU4 D;  3AZH D;  4LD9 B;  2NQB B;  3P5J B;  1EQZ C;  2FJ7 D;  4J8X D;  2YFV A;  3AV1 A;  4H9N B;  3UT9 A;  1F66 B;  2BG1 A;  5AV5 B;  3AV1 D;  3AN2 C;  3A6N A;  3AL0 C;  3A6N D;  5B2J C;  4XUJ A;  1BH8 B;  5JA4 B;  5B2I A;  3REJ B;  1M19 A;  5B2I D;  1M19 D;  1P3B A;  2DF4 C;  2LY8 A;  2Y2Q A;  4DRB A;  5CPJ B;  2IO5 C;  1P3B D;  1ZLA B;  3LEL B;  5F99 C;  1P3M A;  3H0M C;  1ID3 C;  3B0B A;  3KWQ B;  4ZUX A;  3X1S C;  1KX3 A;  1P3O C;  3AZL C;  3AV2 C;  3B0C W;  3KUY A;  3REH A;  1KX5 C;  3AZJ C;  1P3P A;  3MNN A;  3NQJ B;  3REK B;  1P3P D;  3UTB C;  1M1A A;  1HQ3 B;  3AFA A;  4Z66 B;  3MGQ B;  5GT3 C;  4YM6 A;  1BH9 B;  3AFA D;  5JRG B;  4CSR A;  2Y2O A;  4YM6 D;  4H9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...