3REJD

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejD00
4CSRA 1KU5A 5GT3A 3LZ0B 4J8XA 1P3FB 1ID3A 3AN2C 3WTPE 3AZGD 5BNXB 3AZND 1JFIB 1ZLAC 3W99A 3MGPC 3B6GC 3KXBB 3AFAB 3UT9C 4J8UC 5AY8B 3KUYB 3WTPA 1P3GA 3REHB 4KHAB 3AZKC 1P3MC 3REJB 3MGSB 4G91B 4KUDB 2BYKB 4YM6A 3WAAB 5B31C 4XZQD 3MVDD 5AV8A 4UUZB 2HUEC 4WNNA 3LJAB 3B6FC 3NQUB 2CV5C 3AZLA 3C1CC 1AOID 5DNNA 1P3LC 5AV5A 5B1MD 3AV1A 1P3KC 5CPIA 3VH6W 3MNNB 3UT9D 1P3OC 2NQBA 4KGCD 4J8UD 5JA4A 5GT0B 2F8NB 5JRGB 3AZJA 1KX4A 5AVCD 3AZKD 3VH6A 1P3MD 3X1TC 1M18C 2IO5C 5B31D 1M19C 4G92B 3NQJA 5AV6D 5GT3B 3REKA 3AYWC 1P3AB 5BT1D 4J8VC 3C1CD 3VH6T 1TZYD 4Z66B 4H9OA 5F99B 5B2IB 3R45A 1TAFA 2NZDC 3V9RA 3AZGA 3AZNA 1EQZC 3MGRD 5B33B 3TU4C 1HQ3D 5AVBC 3KXBD 3AFAD 4CAYB 2JSSA 5GXQB 3KUYD 2FJ7A 1ULYA 3REHD 5AV8B 3REJD 5B1LC 3AZMC 4XZQA 4Z5TC 3X1UC 5B2JB 1M1AB 5CP6B 1P3PA 4KUDD 3WA9B 3REIC 3X1SB 3AZFC 4X23C 3UTBD 1AOIA 5B1MA 3A6NA 3MGQB 1KX3C 3TU4D 4ZUXC 4H9RA 5AVCA 3AZIB 3W97C 2YFVA 5B0ZD 3O62B 1P3ID 3W96A 5B24D 4Z5TD 5CPJB 4NE6A 5AV6A 4WU8A 5CPKC 4QLCB 4X23D 3B0BA 5E5AC 5B32C 2CWEA 4J8XC 1WWSA 3AZGB 5GSUB 3VH5W 5F99D 1P34C 1N1JB 3AZHB 4ZUXD 1JFIA 3VH5A 3KXBA 3AFAA 3KWQC 3AV2C 5AY8A 4YS3D 3KUYA 1BH8B 3REHA 4H9SA 4KHAA 3MVDB 4R8PB 3REJA 3MGSA 4YM6C 4KUDA 3C1BD 2BYKA 1M1AD 3WAAA 3AN2B 5B32D 5CP6D 4UUZA 3LJAA 3WKJD 3AZLC 5C3IB 3MGPB 3X1SD 3X1VC 3LZ1C 1ZLAB 4WU9C 3UT9B 1P34D 5DNNC 4J8UB 4KGCB 4JJNC 4H9RB 2RVQC 3AZKB 4E45A 3MNNA 3KWQD 1P3MB 1Q9CA 2F8NA 5GT0A 4NFTA 1KX4C 5JRGA 5B31B 5B0ZA 3AZID 5AV9C 3O62D 3B6FB 3C1CB 3AZEC 1TZYB 1S32C 1P3AA 1P3LB 1P3KB 2HIOC 3LZ1D 4QLCD 3RELC 2PYOD 3LELC 3MGRB 4Z66A 1H3OB 5F99A 5B2IA 4HGAC 1B6WA 5GSUD 2RVQD 1HQ3B 2AROC 3AZHD 5G49B 4AWLB 5B33A 4H9NB 5DNMC 1M18B 2IO5B 1B67A 1U35C 4CAYA 4EO5C 1BH9B 5B0YC 3AYWB 2FJ7C 5GXQA 4J8VB 1R4VA 3AZED 4R8PD 1M1AA 5B2JA 3UTBB 5CP6A 2NZDB 3AN2D 3RELD 3WA9A 1EQZB 3X1SA 3TU4B 1ZLAD 3MGPD 3B6GD 3A6NC 1F66C 2AROD 3MGQA 5B0ZB 1U35D 1P3IB 5B40C 5B1LB 5B24B 4Z5TB 3X1UB 3AZIA 2L5AA 3O62A 1HTAA 5BS7C 3AZFB 4X23B 1WWIA 5CPJA 5KDMB 4WU8C 2CV5D 3B6FD 4QLCA 2PYOA 1KX3B 4XUJC 1P3LD 4Z2MG 3UTAC 3LZ0C 1P3KD 1P3FC 4ZUXB 1P3OD 5GSUA 3W97B 1N1JA 3AZHA 1P3BC 4YS3B 3X1TD 4LD9C 1M18D 5AY8C 1M19D 3B0CW 3C1BB 4H9SC 4J8WC 1BH8A 5E5AB 5B32B 3AYWD 3MVDA 4R8PA 2LY8A 4J8VD 3WAAC 3KSYA 3WKJB 3AN2A 4XUJD 1P34B 3UTAD 3LJAC 2NZDD 1EQZD 1ZLAA 3MGPA 3KWQB 3UT9A 4KGCA 4J8UA 4DRAA 5AVBD 3B0CT 1P3BD 1KX5C 3AZKA 5GT0C 1P3MA 5FUGB 3W98C 5B1LD 5B31A 3AZMD 3X1UD 3REID 3B6FA 3AZFD 3LZ1B 4G92C 3C1CA 2PYOB 1TZYA 5GT3C 1P3AC 1ID3C 2F8NG 1P3LA 1P3KA 1KX3D 3MGRA 1H3OA 3W99C 1KX5D 3B0DB 1HQ3A 3W97D 5AV9B 5G49A 3WTPC 4H9NA 4Z2MH 1P3GC 1M18A 3AZEB 1BH9A 5GXQC 1S32B 3AYWA 5CHLB 2HIOB 4J8VA 5CPKD 3VH5T 5AV8C 5E5AD 3RELB 3LELB 4J8XD 3UTBA 4HGAB 2NZDA 3B6GB 4H9PB 2AROB 1EQZA 5AV5C 3AV1C 3W99D 3TU4A 5CPIC 2NQBC 1U35B 3MGQC 4EO5B 3AZJC 5B0YB 3WTPD 3AV2D 1P3GD 4WZSB 1P3IA 5B1LA 2HUEB 5B24A 4Z5TA 3X1UA 4YM6D 2CV5B 3AZFA 3REKC 4X23A 3AZLD 5KDMA 3X1VD 1F66B 4WU9D 1P3OB 5DNND 4JJND 2YFWB 5BNVB 1KX3A 3AZGC 4M6BA 5CPID 2NQBD 3AZNC 4ZUXA 3X1TB 1KX4D 3W97A 5BO0B 1M19B 4YS3A 5AV9D 3C1BA 4XZQC 1P3PC 5E5AA 5B32A 4XUJB 1S32D 3UTAB 2HIOD 3LELD 3WKJA 1AOIC 1P34A 5AVBB 1P3BB 5B1MC 5C3IC 4LD9B 5DNMD 4KGCC 3KWQA 3AV2A 4ZBJC 5AVCC 4J8WB 3AZMB 5B0YD 2FJ7D 5FUGA 3W96C 3REIB 1P3PD 5AV6C 5BT1C 3LZ1A 3X1VA 1TZYC 4WU9A 3A6ND 4JJNA 1F66D 1KX5B 4H9QB 5B31G 3MGRC 3W98B 1F1EA 2BYMB 4NE3A 1HQ3C 5B40D 3KXBC 3AFAC 4AWLC 5AV9A 3KUYC 3W96D 3REHC 5CPKB 3REJC 3AZEA 4CSRB 3MGSC 4J8XB 4G91C 4NE5A 4WU8D 1ID3B 4KUDC 1S32A 2HIOA 4WV4B 2F8NK 4DRBA 3RELA 3LELA 3LZ0D 3UTBC 1P3FD 3W99B 3B6GA 4H9PA 2AROA 3WTPB 5DNMA 3AV2B 1P3GB 4LD9D 3MNNC 1U35A 5AY8D 5JRGC 5B0YA 4YM6B 5B0ZC 4J8WD 1P3IC 4WNNB 5B24C 3MGSD 3WAAD 3AZLB 3X1VB 2CV5A 4WU9B 5DNNB 3LJAD 5AV5B 4JJNB 3AV1B 5CPIB 2NQBB 1F66A 5JA4B 4Z66C 1P3OA 5F99C 3AZJB 5B2IC 1KX4B 2YFWA 5BNVA 3MNND 2F8ND 5GT0D 3W98D 5B40A 5B33C 5JRGD 3X1TA 5BO0A 1M19A 4YS3C 3NQJB 5BS7A 3REKB 3C1BC 1M1AC 4H9OB 5GT3D 5B2JC 5CP6C 3R45B 1TAFB 1P3AD 4XUJA 1A7WA 3V9RB 3UTAA 3LZ0A 3AZNB 3WA9C 1P3FA 3WKJC 4Z66D 3X1SC 5B2ID 5DNMB 1BFMA 5BNXA 5AVBA 1P3BA 5B33D 4LD9A 2FJ7B 5B32G 1ID3D 4XZQB 3AZIC 4J8WA 3AZMA 1P3PB 5GXQD 3O62C 5AV8D 3REIA 5B2JD 1AOIB 5CPJC 4E44A 3WA9D 5B1MB 3A6NB 3NQUA 4QLCC 2PYOC 5AV5D 3AV1D 5GSUC 4ZBJB 5AVCB 3MGQD 4H9QA 5B40B 3AZJD 1KX5A 3AZHC 2YFVB 3W98A 2F8NH 3B0DC 2BYMA 3W96B 5AV6B 4WU8B 5CPKA 3REKD 3MVDC 4R8PC 5CPJD
chains in the Genus database with same CATH superfamily
2Y2QA 4CSRA 1KU5A 2Y2MA 5GT3A 3LZ0B 4J8XA 1P3FB 1ID3A 3AN2C 3WTPE 3AZGD 5BNXB 3AZND 1JFIB 4DQYB 1ZLAC 3MGPC 3B6GC 3W99A 2J8PA 3KXBB 3AFAB 3UT9C 4J8UC 5AY8B 3KUYB 3WTPA 1P3GA 3REHB 4KHAB 3AZKC 1P3MC 3REJB 3MGSB 4G91B 4KUDB 2BYKB 4YM6A 3WAAB 5B31C 4XZQD 1Z2CB 3MVDD 5AV8A 4UUZB 2HUEC 4WNNA 3LJAB 3B6FC 3NQUB 2CV5C 3AZLA 3A1IA 3C1CC 1AOID 5DNNA 1P3LC 5AV5A 5B1MD 3AV1A 1P3KC 5CPIA 3VH6W 3MNNB 3UT9D 1P3OC 2NQBA 4KGCD 4J8UD 5JA4A 5GT0B 2F8NB 5JRGB 3AZJA 1KX4A 3EPHA 5AVCD 3AZKD 3VH6A 1P3MD 2ZY3A 3X1TC 2DF4C 1M18C 2IO5C 5B31D 1M19C 4G92B 3NQJA 5AV6D 5GT3B 3REKA 3AYWC 1P3AB 1T3UA 5BT1D 4J8VC 3C1CD 3VH6T 2XD1A 1TZYD 4Z66B 4H9OA 5F99B 5B2IB 3R45A 1TAFA 2NZDC 3V9RA 3AZGA 3AZNA 1EQZC 3MGRD 5B33B 3TU4C 1HQ3D 5AVBC 3KXBD 3AFAD 4CAYB 2JSSA 5GXQB 3KUYD 2FJ7A 1ULYA 3REHD 1P3AD 5AV8B 3REJD 5B1LC 3AZMC 4XZQA 4Z5TC 3X1UC 5B2JB 1M1AB 5CP6B 1P3PA 4KUDD 3WA9B 3REIC 3X1SB 3AZFC 4X23C 3UTBD 1AOIA 2FFFB 2BG1A 2G5IC 5B1MA 3A6NA 3MGQB 1KX3C 3TU4D 4ZUXC 4H9RA 2JCHA 5AVCA 3AZIB 3W97C 2YFVA 5B0ZD 3O62B 1P3ID 3W96A 5B24D 4Z5TD 5CPJB 4NE6A 5AV6A 4WU8A 5CPKC 4QLCB 4X23D 3B0BA 5E5AC 5B32C 2CWEA 4J8XC 1WWSA 2ZM5A 3AZGB 5GSUB 3VH5W 5F99D 1P34C 1N1JB 3AZHB 4ZUXD 1JFIA 3VH5A 3KXBA 3AFAA 3KWQC 3AV2C 5AY8A 4YS3D 3KUYA 1BH8B 3REHA 4H9SA 4KHAA 3MVDB 4R8PB 3REJA 3MGSA 4YM6C 4KUDA 3C1BD 2BYKA 1M1AD 3WAAA 3AN2B 5B32D 3P5JB 5CP6D 4UUZA 3LJAA 3WKJD 3AZLC 5C3IB 3MGPB 3X1SD 3X1VC 3LZ1C 1ZLAB 4WU9C 2ZY5A 3UT9B 1P34D 5DNNC 4J8UB 4KGCB 4JJNC 4H9RB 2RVQC 3AZKB 4E45A 2RIQA 3MNNA 3KWQD 1P3MB 1Q9CA 2F8NA 5GT0A 4NFTA 1KX4C 5JRGA 5B31B 5B0ZA 3AZID 5AV9C 3O62D 3F6TA 3B6FB 3C1CB 3AZEC 1TZYB 1S32C 1P3AA 1P3LB 1P3KB 2HIOC 3LZ1D 4QLCD 3RELC 2PYOD 3LELC 3MGRB 4Z66A 1H3OB 5F99A 5B2IA 4HGAC 5GSUD 1B6WA 2RVQD 1HQ3B 2Y2PA 2Y2JA 2AROC 3AZHD 5G49B 4AWLB 5B33A 4H9NB 5DNMC 1W2EA 1M18B 2IO5B 1B67A 1U35C 4CAYA 4EO5C 1BH9B 2Y2NA 5B0YC 3AYWB 2FJ7C 5GXQA 4J8VB 1R4VA 3AZED 4R8PD 1M1AA 5B2JA 3UTBB 5CP6A 2NZDB 3AN2D 3RELD 3WA9A 1EQZB 3X1SA 3TU4B 1ZLAD 3MGPD 3B6GD 3A6NC 1F66C 2AROD 3MGQA 5B0ZB 1U35D 1P3IB 5B40C 5B1LB 5B24B 4Z5TB 3X1UB 3AZIA 2L5AA 3O62A 1HTAA 5BS7C 3AZFB 4X23B 1WWIA 5CPJA 5KDMB 4WU8C 2CV5D 3B6FD 4QLCA 2PYOA 1KX3B 4XUJC 1P3LD 4Z2MG 3UTAC 3LZ0C 1P3KD 1P3FC 2Y2LA 4ZUXB 1P3OD 5GSUA 3W97B 1N1JA 3AZHA 1P3BC 4YS3B 3X1TD 4LD9C 3EPKA 1M18D 5AY8C 1M19D 3B0CW 3C1BB 4H9SC 4J8WC 1BH8A 5E5AB 5B32B 3AYWD 3MVDA 4R8PA 2LY8A 4J8VD 3WAAC 3KSYA 3WKJB 3AN2A 4XUJD 1P34B 3UTAD 3LJAC 2NZDD 1EQZD 1ZLAA 3MGPA 3KWQB 3UT9A 4KGCA 4J8UA 4DRAA 5AVBD 2JE5A 3B0CT 2ZY2A 1P3BD 1KX5C 3AZKA 5GT0C 1P3MA 5FUGB 3W98C 5B1LD 5B31A 3AZMD 3X1UD 4WJ3C 3REID 3B6FA 3AZFD 3LZ1B 4G92C 3C1CA 2PYOB 1TZYA 5GT3C 1P3AC 1ID3C 2F8NG 1P3LA 1P3KA 1KX3D 2W8SA 3MGRA 1H3OA 3W99C 1KX5D 3B0DB 1HQ3A 3W97D 5AV9B 3H0LC 5G49A 3WTPC 4H9NA 4Z2MH 1P3GC 1M18A 3AZEB 3EPLA 1BH9A 5GXQC 1S32B 3AYWA 5CHLB 2HIOB 4J8VA 5CPKD 3VH5T 5AV8C 5E5AD 3RELB 2Y2KA 3LELB 4J8XD 2VQRA 3UTBA 4HGAB 2NZDA 3B6GB 4H9PB 2AROB 1EQZA 5AV5C 2Y2HA 3AV1C 3W99D 3TU4A 5CPIC 2NQBC 1U35B 3MGQC 4EO5B 3AZJC 5B0YB 3WTPD 3AV2D 1P3GD 4WZSB 1P3IA 5B1LA 2HUEB 5B24A 4Z5TA 3X1UA 4YM6D 1PZRA 2CV5B 3H0RC 3AZFA 3REKC 4X23A 3AZLD 5KDMA 3X1VD 1F66B 4WU9D 1P3OB 5DNND 4JJND 2YFWB 5BNVB 1KX3A 3AZGC 4M6BA 3AL0C 5CPID 2NQBD 3AZNC 4ZUXA 3X1TB 1KX4D 3W97A 5BO0B 1M19B 4YS3A 5AV9D 2ZY4A 3C1BA 2XD5A 4XZQC 1P3PC 5E5AA 5B32A 4XUJB 1S32D 3UTAB 2HIOD 3H0MC 3LELD 3WKJA 1AOIC 1P34A 5AVBB 1P3BB 5B1MC 5C3IC 4LD9B 5DNMD 4KGCC 3KWQA 3AV2A 4ZBJC 5AVCC 4J8WB 3AZMB 3A1KA 5B0YD 2FJ7D 5FUGA 3W96C 3REIB 1P3PD 2UWXA 5AV6C 5BT1C 3LZ1A 3X1VA 1TZYC 4WU9A 3A6ND 4JJNA 2Y2IA 1F66D 1KX5B 4H9QB 5B31G 3MGRC 3W98B 1F1EA 2BYMB 3EG5B 1HQ3C 4NE3A 5B40D 3KXBC 3AFAC 4AWLC 5AV9A 3KUYC 2F2AC 3W96D 3REHC 5CPKB 3REJC 3AZEA 4CSRB 3MGSC 4J8XB 4G91C 4NE5A 4WU8D 1ID3B 4KUDC 1S32A 2HIOA 4WV4B 2F8NK 4DRBA 3RELA 3LELA 3LZ0D 3UTBC 1P3FD 4UPKA 3W99B 3B6GA 4H9PA 2AROA 3WTPB 5DNMA 3IP4C 3AV2B 1P3GB 4LD9D 3MNNC 1U35A 5AY8D 5JRGC 5B0YA 4YM6B 5B0ZC 4J8WD 2Y2GA 1P3IC 4WNNB 5B24C 3MGSD 3WAAD 3AZLB 3X1VB 2CV5A 4WU9B 5DNNB 3FDDA 3LJAD 5AV5B 4JJNB 3AV1B 5CPIB 2NQBB 1F66A 5JA4B 4Z66C 1P3OA 2Y2OA 5F99C 5B2IC 3AZJB 1KX4B 2YFWA 5BNVA 3MNND 2F8ND 5GT0D 3W98D 5B40A 3EPJA 5JRGD 5B33C 3X1TA 5BO0A 1M19A 4YS3C 3NQJB 5BS7A 3REKB 3KFUG 3C1BC 1M1AC 4H9OB 5GT3D 5B2JC 5CP6C 2G5HC 3R45B 1TAFB 4XUJA 1A7WA 3V9RB 3UTAA 3LZ0A 3AZNB 3WA9C 1P3FA 3WKJC 4Z66D 3X1SC 5B2ID 5DNMB 1BFMA 5BNXA 2DQNC 5AVBA 1P3BA 5B33D 4LD9A 2FJ7B 5B32G 1ID3D 4XZQB 3AZIC 4J8WA 3AZMA 1P3PB 5GXQD 3O62C 5AV8D 3REIA 5B2JD 1AOIB 5CPJC 4E44A 3WA9D 5B1MB 3A6NB 3NQUA 4QLCC 2PYOC 5AV5D 3AV1D 5GSUC 4ZBJB 5AVCB 3MGQD 4H9QA 5B40B 3AZJD 1KX5A 3AZHC 2YFVB 3W98A 2F8NH 3B0DC 2BYMA 3W96B 5AV6B 4WU8B 5CPKA 3REKD 3MVDC 4R8PC 5CPJD
chains in the Genus database with same CATH topology
2Y2QA 4CSRA 1KU5A 2Y2MA 5GT3A 3LZ0B 4J8XA 1P3FB 1ID3A 3AN2C 3WTPE 3AZGD 5BNXB 3AZND 1JFIB 4DQYB 1ZLAC 3MGPC 3B6GC 3W99A 2J8PA 3KXBB 3AFAB 3UT9C 4J8UC 5AY8B 3KUYB 3WTPA 1P3GA 3REHB 4KHAB 3AZKC 1P3MC 3REJB 3MGSB 4G91B 4KUDB 2BYKB 4YM6A 3WAAB 5B31C 4XZQD 1Z2CB 3MVDD 5AV8A 4UUZB 2HUEC 4WNNA 3LJAB 3B6FC 3NQUB 2CV5C 3AZLA 3A1IA 3C1CC 1AOID 5DNNA 1P3LC 5AV5A 5B1MD 3AV1A 1P3KC 5CPIA 3VH6W 3MNNB 3UT9D 1P3OC 2NQBA 4KGCD 4J8UD 5JA4A 5GT0B 2F8NB 5JRGB 3AZJA 1KX4A 3EPHA 5AVCD 3AZKD 3VH6A 1P3MD 2ZY3A 3X1TC 2DF4C 1M18C 2IO5C 5B31D 1M19C 4G92B 3NQJA 5AV6D 5GT3B 3REKA 3AYWC 1P3AB 1T3UA 5BT1D 4J8VC 3C1CD 3VH6T 2XD1A 1TZYD 4Z66B 4H9OA 5F99B 5B2IB 3R45A 1TAFA 2NZDC 3V9RA 3AZGA 3AZNA 1EQZC 3MGRD 5B33B 3TU4C 1HQ3D 5AVBC 3KXBD 3AFAD 4CAYB 2JSSA 5GXQB 3KUYD 2FJ7A 1ULYA 3REHD 1P3AD 5AV8B 3REJD 5B1LC 3AZMC 4XZQA 4Z5TC 3X1UC 5B2JB 1M1AB 5CP6B 1P3PA 4KUDD 3WA9B 3REIC 3X1SB 3AZFC 4X23C 3UTBD 1AOIA 2FFFB 2BG1A 2G5IC 5B1MA 3A6NA 3MGQB 1KX3C 3TU4D 4ZUXC 4H9RA 2JCHA 5AVCA 3AZIB 3W97C 2YFVA 5B0ZD 3O62B 1P3ID 3W96A 5B24D 4Z5TD 5CPJB 4NE6A 5AV6A 4WU8A 5CPKC 4QLCB 4X23D 3B0BA 5E5AC 5B32C 2CWEA 4J8XC 1WWSA 2ZM5A 3AZGB 5GSUB 3VH5W 5F99D 1P34C 1N1JB 3AZHB 4ZUXD 1JFIA 3VH5A 3KXBA 3AFAA 3KWQC 3AV2C 5AY8A 4YS3D 3KUYA 1BH8B 3REHA 4H9SA 4KHAA 3MVDB 4R8PB 3REJA 3MGSA 4YM6C 4KUDA 3C1BD 2BYKA 1M1AD 3WAAA 3AN2B 5B32D 3P5JB 5CP6D 4UUZA 3LJAA 3WKJD 3AZLC 5C3IB 3MGPB 3X1SD 3X1VC 3LZ1C 1ZLAB 4WU9C 2ZY5A 3UT9B 1P34D 5DNNC 4J8UB 4KGCB 4JJNC 4H9RB 2RVQC 3AZKB 4E45A 2RIQA 3MNNA 3KWQD 1P3MB 1Q9CA 2F8NA 5GT0A 4NFTA 1KX4C 5JRGA 5B31B 5B0ZA 3AZID 5AV9C 3O62D 3F6TA 3B6FB 3C1CB 3AZEC 1TZYB 1S32C 1P3AA 1P3LB 1P3KB 2HIOC 3LZ1D 4QLCD 3RELC 2PYOD 3LELC 3MGRB 4Z66A 1H3OB 5F99A 5B2IA 4HGAC 5GSUD 1B6WA 2RVQD 1HQ3B 2Y2PA 2Y2JA 2AROC 3AZHD 5G49B 4AWLB 5B33A 4H9NB 5DNMC 1W2EA 1M18B 2IO5B 1B67A 1U35C 4CAYA 4EO5C 1BH9B 2Y2NA 5B0YC 3AYWB 2FJ7C 5GXQA 4J8VB 1R4VA 3AZED 4R8PD 1M1AA 5B2JA 3UTBB 5CP6A 2NZDB 3AN2D 3RELD 3WA9A 1EQZB 3X1SA 3TU4B 1ZLAD 3MGPD 3B6GD 3A6NC 1F66C 2AROD 3MGQA 5B0ZB 1U35D 1P3IB 5B40C 5B1LB 5B24B 4Z5TB 3X1UB 3AZIA 2L5AA 3O62A 1HTAA 5BS7C 3AZFB 4X23B 1WWIA 5CPJA 5KDMB 4WU8C 2CV5D 3B6FD 4QLCA 2PYOA 1KX3B 4XUJC 1P3LD 4Z2MG 3UTAC 3LZ0C 1P3KD 1P3FC 2Y2LA 4ZUXB 1P3OD 5GSUA 3W97B 1N1JA 3AZHA 1P3BC 4YS3B 3X1TD 4LD9C 3EPKA 1M18D 5AY8C 1M19D 3B0CW 3C1BB 4H9SC 4J8WC 1BH8A 5E5AB 5B32B 3AYWD 3MVDA 4R8PA 2LY8A 4J8VD 3WAAC 3KSYA 3WKJB 3AN2A 4XUJD 1P34B 3UTAD 3LJAC 2NZDD 1EQZD 1ZLAA 3MGPA 3KWQB 3UT9A 4KGCA 4J8UA 4DRAA 5AVBD 2JE5A 3B0CT 2ZY2A 1P3BD 1KX5C 3AZKA 5GT0C 1P3MA 5FUGB 3W98C 5B1LD 5B31A 3AZMD 3X1UD 4WJ3C 3REID 3B6FA 3AZFD 3LZ1B 4G92C 3C1CA 2PYOB 1TZYA 5GT3C 1P3AC 1ID3C 2F8NG 1P3LA 1P3KA 1KX3D 2W8SA 3MGRA 1H3OA 3W99C 1KX5D 3B0DB 1HQ3A 3W97D 5AV9B 3H0LC 5G49A 3WTPC 4H9NA 4Z2MH 1P3GC 1M18A 3AZEB 3EPLA 1BH9A 5GXQC 1S32B 3AYWA 5CHLB 2HIOB 4J8VA 5CPKD 3VH5T 5AV8C 5E5AD 3RELB 2Y2KA 3LELB 4J8XD 2VQRA 3UTBA 4HGAB 2NZDA 3B6GB 4H9PB 2AROB 1EQZA 5AV5C 2Y2HA 3AV1C 3W99D 3TU4A 5CPIC 2NQBC 1U35B 3MGQC 4EO5B 3AZJC 5B0YB 3WTPD 3AV2D 1P3GD 4WZSB 1P3IA 5B1LA 2HUEB 5B24A 4Z5TA 3X1UA 4YM6D 1PZRA 2CV5B 3H0RC 3AZFA 3REKC 4X23A 3AZLD 5KDMA 3X1VD 1F66B 4WU9D 1P3OB 5DNND 4JJND 2YFWB 5BNVB 1KX3A 3AZGC 4M6BA 3AL0C 5CPID 2NQBD 3AZNC 4ZUXA 3X1TB 1KX4D 3W97A 5BO0B 1M19B 4YS3A 5AV9D 2ZY4A 3C1BA 2XD5A 4XZQC 1P3PC 5E5AA 5B32A 4XUJB 1S32D 3UTAB 2HIOD 3H0MC 3LELD 3WKJA 1AOIC 1P34A 5AVBB 1P3BB 5B1MC 5C3IC 4LD9B 5DNMD 4KGCC 3KWQA 3AV2A 4ZBJC 5AVCC 4J8WB 3AZMB 3A1KA 5B0YD 2FJ7D 5FUGA 3W96C 3REIB 1P3PD 2UWXA 5AV6C 5BT1C 3LZ1A 3X1VA 1TZYC 4WU9A 3A6ND 4JJNA 2Y2IA 1F66D 1KX5B 4H9QB 5B31G 3MGRC 3W98B 1F1EA 2BYMB 3EG5B 1HQ3C 4NE3A 5B40D 3KXBC 3AFAC 4AWLC 5AV9A 3KUYC 2F2AC 3W96D 3REHC 5CPKB 3REJC 3AZEA 4CSRB 3MGSC 4J8XB 4G91C 4NE5A 4WU8D 1ID3B 4KUDC 1S32A 2HIOA 4WV4B 2F8NK 4DRBA 3RELA 3LELA 3LZ0D 3UTBC 1P3FD 4UPKA 3W99B 3B6GA 4H9PA 2AROA 3WTPB 5DNMA 3IP4C 3AV2B 1P3GB 4LD9D 3MNNC 1U35A 5AY8D 5JRGC 5B0YA 4YM6B 5B0ZC 4J8WD 2Y2GA 1P3IC 4WNNB 5B24C 3MGSD 3WAAD 3AZLB 3X1VB 2CV5A 4WU9B 5DNNB 3FDDA 3LJAD 5AV5B 4JJNB 3AV1B 5CPIB 2NQBB 1F66A 5JA4B 4Z66C 1P3OA 2Y2OA 5F99C 5B2IC 3AZJB 1KX4B 2YFWA 5BNVA 3MNND 2F8ND 5GT0D 3W98D 5B40A 3EPJA 5JRGD 5B33C 3X1TA 5BO0A 1M19A 4YS3C 3NQJB 5BS7A 3REKB 3KFUG 3C1BC 1M1AC 4H9OB 5GT3D 5B2JC 5CP6C 2G5HC 3R45B 1TAFB 4XUJA 1A7WA 3V9RB 3UTAA 3LZ0A 3AZNB 3WA9C 1P3FA 3WKJC 4Z66D 3X1SC 5B2ID 5DNMB 1BFMA 5BNXA 2DQNC 5AVBA 1P3BA 5B33D 4LD9A 2FJ7B 5B32G 1ID3D 4XZQB 3AZIC 4J8WA 3AZMA 1P3PB 5GXQD 3O62C 5AV8D 3REIA 5B2JD 1AOIB 5CPJC 4E44A 3WA9D 5B1MB 3A6NB 3NQUA 4QLCC 2PYOC 5AV5D 3AV1D 5GSUC 4ZBJB 5AVCB 3MGQD 4H9QA 5B40B 3AZJD 1KX5A 3AZHC 2YFVB 3W98A 2F8NH 3B0DC 2BYMA 3W96B 5AV6B 4WU8B 5CPKA 3REKD 3MVDC 4R8PC 5CPJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSR A;  1KU5 A;  5GT3 A;  3LZ0 B;  4J8X A;  1P3F B;  1ID3 A;  3AN2 C;  3WTP E;  3AZG D;  5BNX B;  3AZN D;  1JFI B;  1ZLA C;  3W99 A;  3MGP C;  3B6G C;  3KXB B;  3AFA B;  3UT9 C;  4J8U C;  5AY8 B;  3KUY B;  3WTP A;  1P3G A;  3REH B;  4KHA B;  3AZK C;  1P3M C;  3REJ B;  3MGS B;  4G91 B;  4KUD B;  2BYK B;  4YM6 A;  3WAA B;  5B31 C;  4XZQ D;  3MVD D;  5AV8 A;  4UUZ B;  2HUE C;  4WNN A;  3LJA B;  3B6F C;  3NQU B;  2CV5 C;  3AZL A;  3C1C C;  1AOI D;  5DNN A;  1P3L C;  5AV5 A;  5B1M D;  3AV1 A;  1P3K C;  5CPI A;  3VH6 W;  3MNN B;  3UT9 D;  1P3O C;  2NQB A;  4KGC D;  4J8U D;  5JA4 A;  5GT0 B;  2F8N B;  5JRG B;  3AZJ A;  1KX4 A;  5AVC D;  3AZK D;  3VH6 A;  1P3M D;  3X1T C;  1M18 C;  2IO5 C;  5B31 D;  1M19 C;  4G92 B;  3NQJ A;  5AV6 D;  5GT3 B;  3REK A;  3AYW C;  1P3A B;  5BT1 D;  4J8V C;  3C1C D;  3VH6 T;  1TZY D;  4Z66 B;  4H9O A;  5F99 B;  5B2I B;  3R45 A;  1TAF A;  2NZD C;  3V9R A;  3AZG A;  3AZN A;  1EQZ C;  3MGR D;  5B33 B;  3TU4 C;  1HQ3 D;  5AVB C;  3KXB D;  3AFA D;  4CAY B;  2JSS A;  5GXQ B;  3KUY D;  2FJ7 A;  1ULY A;  3REH D;  5AV8 B;  3REJ D;  5B1L C;  3AZM C;  4XZQ A;  4Z5T C;  3X1U C;  5B2J B;  1M1A B;  5CP6 B;  1P3P A;  4KUD D;  3WA9 B;  3REI C;  3X1S B;  3AZF C;  4X23 C;  3UTB D;  1AOI A;  5B1M A;  3A6N A;  3MGQ B;  1KX3 C;  3TU4 D;  4ZUX C;  4H9R A;  5AVC A;  3AZI B;  3W97 C;  2YFV A;  5B0Z D;  3O62 B;  1P3I D;  3W96 A;  5B24 D;  4Z5T D;  5CPJ B;  4NE6 A;  5AV6 A;  4WU8 A;  5CPK C;  4QLC B;  4X23 D;  3B0B A;  5E5A C;  5B32 C;  2CWE A;  4J8X C;  1WWS A;  3AZG B;  5GSU B;  3VH5 W;  5F99 D;  1P34 C;  1N1J B;  3AZH B;  4ZUX D;  1JFI A;  3VH5 A;  3KXB A;  3AFA A;  3KWQ C;  3AV2 C;  5AY8 A;  4YS3 D;  3KUY A;  1BH8 B;  3REH A;  4H9S A;  4KHA A;  3MVD B;  4R8P B;  3REJ A;  3MGS A;  4YM6 C;  4KUD A;  3C1B D;  2BYK A;  1M1A D;  3WAA A;  3AN2 B;  5B32 D;  5CP6 D;  4UUZ A;  3LJA A;  3WKJ D;  3AZL C;  5C3I B;  3MGP B;  3X1S D;  3X1V C;  3LZ1 C;  1ZLA B;  4WU9 C;  3UT9 B;  1P34 D;  5DNN C;  4J8U B;  4KGC B;  4JJN C;  4H9R B;  2RVQ C;  3AZK B;  4E45 A;  3MNN A;  3KWQ D;  1P3M B;  1Q9C A;  2F8N A;  5GT0 A;  4NFT A;  1KX4 C;  5JRG A;  5B31 B;  5B0Z A;  3AZI D;  5AV9 C;  3O62 D;  3B6F B;  3C1C B;  3AZE C;  1TZY B;  1S32 C;  1P3A A;  1P3L B;  1P3K B;  2HIO C;  3LZ1 D;  4QLC D;  3REL C;  2PYO D;  3LEL C;  3MGR B;  4Z66 A;  1H3O B;  5F99 A;  5B2I A;  4HGA C;  1B6W A;  5GSU D;  2RVQ D;  1HQ3 B;  2ARO C;  3AZH D;  5G49 B;  4AWL B;  5B33 A;  4H9N B;  5DNM C;  1M18 B;  2IO5 B;  1B67 A;  1U35 C;  4CAY A;  4EO5 C;  1BH9 B;  5B0Y C;  3AYW B;  2FJ7 C;  5GXQ A;  4J8V B;  1R4V A;  3AZE D;  4R8P D;  1M1A A;  5B2J A;  3UTB B;  5CP6 A;  2NZD B;  3AN2 D;  3REL D;  3WA9 A;  1EQZ B;  3X1S A;  3TU4 B;  1ZLA D;  3MGP D;  3B6G D;  3A6N C;  1F66 C;  2ARO D;  3MGQ A;  5B0Z B;  1U35 D;  1P3I B;  5B40 C;  5B1L B;  5B24 B;  4Z5T B;  3X1U B;  3AZI A;  2L5A A;  3O62 A;  1HTA A;  5BS7 C;  3AZF B;  4X23 B;  1WWI A;  5CPJ A;  5KDM B;  4WU8 C;  2CV5 D;  3B6F D;  4QLC A;  2PYO A;  1KX3 B;  4XUJ C;  1P3L D;  4Z2M G;  3UTA C;  3LZ0 C;  1P3K D;  1P3F C;  4ZUX B;  1P3O D;  5GSU A;  3W97 B;  1N1J A;  3AZH A;  1P3B C;  4YS3 B;  3X1T D;  4LD9 C;  1M18 D;  5AY8 C;  1M19 D;  3B0C W;  3C1B B;  4H9S C;  4J8W C;  1BH8 A;  5E5A B;  5B32 B;  3AYW D;  3MVD A;  4R8P A;  2LY8 A;  4J8V D;  3WAA C;  3KSY A;  3WKJ B;  3AN2 A;  4XUJ D;  1P34 B;  3UTA D;  3LJA C;  2NZD D;  1EQZ D;  1ZLA A;  3MGP A;  3KWQ B;  3UT9 A;  4KGC A;  4J8U A;  4DRA A;  5AVB D;  3B0C T;  1P3B D;  1KX5 C;  3AZK A;  5GT0 C;  1P3M A;  5FUG B;  3W98 C;  5B1L D;  5B31 A;  3AZM D;  3X1U D;  3REI D;  3B6F A;  3AZF D;  3LZ1 B;  4G92 C;  3C1C A;  2PYO B;  1TZY A;  5GT3 C;  1P3A C;  1ID3 C;  2F8N G;  1P3L A;  1P3K A;  1KX3 D;  3MGR A;  1H3O A;  3W99 C;  1KX5 D;  3B0D B;  1HQ3 A;  3W97 D;  5AV9 B;  5G49 A;  3WTP C;  4H9N A;  4Z2M H;  1P3G C;  1M18 A;  3AZE B;  1BH9 A;  5GXQ C;  1S32 B;  3AYW A;  5CHL B;  2HIO B;  4J8V A;  5CPK D;  3VH5 T;  5AV8 C;  5E5A D;  3REL B;  3LEL B;  4J8X D;  3UTB A;  4HGA B;  2NZD A;  3B6G B;  4H9P B;  2ARO B;  1EQZ A;  5AV5 C;  3AV1 C;  3W99 D;  3TU4 A;  5CPI C;  2NQB C;  1U35 B;  3MGQ C;  4EO5 B;  3AZJ C;  5B0Y B;  3WTP D;  3AV2 D;  1P3G D;  4WZS B;  1P3I A;  5B1L A;  2HUE B;  5B24 A;  4Z5T A;  3X1U A;  4YM6 D;  2CV5 B;  3AZF A;  3REK C;  4X23 A;  3AZL D;  5KDM A;  3X1V D;  1F66 B;  4WU9 D;  1P3O B;  5DNN D;  4JJN D;  2YFW B;  5BNV B;  1KX3 A;  3AZG C;  4M6B A;  5CPI D;  2NQB D;  3AZN C;  4ZUX A;  3X1T B;  1KX4 D;  3W97 A;  5BO0 B;  1M19 B;  4YS3 A;  5AV9 D;  3C1B A;  4XZQ C;  1P3P C;  5E5A A;  5B32 A;  4XUJ B;  1S32 D;  3UTA B;  2HIO D;  3LEL D;  3WKJ A;  1AOI C;  1P34 A;  5AVB B;  1P3B B;  5B1M C;  5C3I C;  4LD9 B;  5DNM D;  4KGC C;  3KWQ A;  3AV2 A;  4ZBJ C;  5AVC C;  4J8W B;  3AZM B;  5B0Y D;  2FJ7 D;  5FUG A;  3W96 C;  3REI B;  1P3P D;  5AV6 C;  5BT1 C;  3LZ1 A;  3X1V A;  1TZY C;  4WU9 A;  3A6N D;  4JJN A;  1F66 D;  1KX5 B;  4H9Q B;  5B31 G;  3MGR C;  3W98 B;  1F1E A;  2BYM B;  4NE3 A;  1HQ3 C;  5B40 D;  3KXB C;  3AFA C;  4AWL C;  5AV9 A;  3KUY C;  3W96 D;  3REH C;  5CPK B;  3REJ C;  3AZE A;  4CSR B;  3MGS C;  4J8X B;  4G91 C;  4NE5 A;  4WU8 D;  1ID3 B;  4KUD C;  1S32 A;  2HIO A;  4WV4 B;  2F8N K;  4DRB A;  3REL A;  3LEL A;  3LZ0 D;  3UTB C;  1P3F D;  3W99 B;  3B6G A;  4H9P A;  2ARO A;  3WTP B;  5DNM A;  3AV2 B;  1P3G B;  4LD9 D;  3MNN C;  1U35 A;  5AY8 D;  5JRG C;  5B0Y A;  4YM6 B;  5B0Z C;  4J8W D;  1P3I C;  4WNN B;  5B24 C;  3MGS D;  3WAA D;  3AZL B;  3X1V B;  2CV5 A;  4WU9 B;  5DNN B;  3LJA D;  5AV5 B;  4JJN B;  3AV1 B;  5CPI B;  2NQB B;  1F66 A;  5JA4 B;  4Z66 C;  1P3O A;  5F99 C;  3AZJ B;  5B2I C;  1KX4 B;  2YFW A;  5BNV A;  3MNN D;  2F8N D;  5GT0 D;  3W98 D;  5B40 A;  5B33 C;  5JRG D;  3X1T A;  5BO0 A;  1M19 A;  4YS3 C;  3NQJ B;  5BS7 A;  3REK B;  3C1B C;  1M1A C;  4H9O B;  5GT3 D;  5B2J C;  5CP6 C;  3R45 B;  1TAF B;  1P3A D;  4XUJ A;  1A7W A;  3V9R B;  3UTA A;  3LZ0 A;  3AZN B;  3WA9 C;  1P3F A;  3WKJ C;  4Z66 D;  3X1S C;  5B2I D;  5DNM B;  1BFM A;  5BNX A;  5AVB A;  1P3B A;  5B33 D;  4LD9 A;  2FJ7 B;  5B32 G;  1ID3 D;  4XZQ B;  3AZI C;  4J8W A;  3AZM A;  1P3P B;  5GXQ D;  3O62 C;  5AV8 D;  3REI A;  5B2J D;  1AOI B;  5CPJ C;  4E44 A;  3WA9 D;  5B1M B;  3A6N B;  3NQU A;  4QLC C;  2PYO C;  5AV5 D;  3AV1 D;  5GSU C;  4ZBJ B;  5AVC B;  3MGQ D;  4H9Q A;  5B40 B;  3AZJ D;  1KX5 A;  3AZH C;  2YFV B;  3W98 A;  2F8N H;  3B0D C;  2BYM A;  3W96 B;  5AV6 B;  4WU8 B;  5CPK A;  3REK D;  3MVD C;  4R8P C;  5CPJ D; 
#chains in the Genus database with same CATH topology
 2Y2Q A;  4CSR A;  1KU5 A;  2Y2M A;  5GT3 A;  3LZ0 B;  4J8X A;  1P3F B;  1ID3 A;  3AN2 C;  3WTP E;  3AZG D;  5BNX B;  3AZN D;  1JFI B;  4DQY B;  1ZLA C;  3MGP C;  3B6G C;  3W99 A;  2J8P A;  3KXB B;  3AFA B;  3UT9 C;  4J8U C;  5AY8 B;  3KUY B;  3WTP A;  1P3G A;  3REH B;  4KHA B;  3AZK C;  1P3M C;  3REJ B;  3MGS B;  4G91 B;  4KUD B;  2BYK B;  4YM6 A;  3WAA B;  5B31 C;  4XZQ D;  1Z2C B;  3MVD D;  5AV8 A;  4UUZ B;  2HUE C;  4WNN A;  3LJA B;  3B6F C;  3NQU B;  2CV5 C;  3AZL A;  3A1I A;  3C1C C;  1AOI D;  5DNN A;  1P3L C;  5AV5 A;  5B1M D;  3AV1 A;  1P3K C;  5CPI A;  3VH6 W;  3MNN B;  3UT9 D;  1P3O C;  2NQB A;  4KGC D;  4J8U D;  5JA4 A;  5GT0 B;  2F8N B;  5JRG B;  3AZJ A;  1KX4 A;  3EPH A;  5AVC D;  3AZK D;  3VH6 A;  1P3M D;  2ZY3 A;  3X1T C;  2DF4 C;  1M18 C;  2IO5 C;  5B31 D;  1M19 C;  4G92 B;  3NQJ A;  5AV6 D;  5GT3 B;  3REK A;  3AYW C;  1P3A B;  1T3U A;  5BT1 D;  4J8V C;  3C1C D;  3VH6 T;  2XD1 A;  1TZY D;  4Z66 B;  4H9O A;  5F99 B;  5B2I B;  3R45 A;  1TAF A;  2NZD C;  3V9R A;  3AZG A;  3AZN A;  1EQZ C;  3MGR D;  5B33 B;  3TU4 C;  1HQ3 D;  5AVB C;  3KXB D;  3AFA D;  4CAY B;  2JSS A;  5GXQ B;  3KUY D;  2FJ7 A;  1ULY A;  3REH D;  1P3A D;  5AV8 B;  3REJ D;  5B1L C;  3AZM C;  4XZQ A;  4Z5T C;  3X1U C;  5B2J B;  1M1A B;  5CP6 B;  1P3P A;  4KUD D;  3WA9 B;  3REI C;  3X1S B;  3AZF C;  4X23 C;  3UTB D;  1AOI A;  2FFF B;  2BG1 A;  2G5I C;  5B1M A;  3A6N A;  3MGQ B;  1KX3 C;  3TU4 D;  4ZUX C;  4H9R A;  2JCH A;  5AVC A;  3AZI B;  3W97 C;  2YFV A;  5B0Z D;  3O62 B;  1P3I D;  3W96 A;  5B24 D;  4Z5T D;  5CPJ B;  4NE6 A;  5AV6 A;  4WU8 A;  5CPK C;  4QLC B;  4X23 D;  3B0B A;  5E5A C;  5B32 C;  2CWE A;  4J8X C;  1WWS A;  2ZM5 A;  3AZG B;  5GSU B;  3VH5 W;  5F99 D;  1P34 C;  1N1J B;  3AZH B;  4ZUX D;  1JFI A;  3VH5 A;  3KXB A;  3AFA A;  3KWQ C;  3AV2 C;  5AY8 A;  4YS3 D;  3KUY A;  1BH8 B;  3REH A;  4H9S A;  4KHA A;  3MVD B;  4R8P B;  3REJ A;  3MGS A;  4YM6 C;  4KUD A;  3C1B D;  2BYK A;  1M1A D;  3WAA A;  3AN2 B;  5B32 D;  3P5J B;  5CP6 D;  4UUZ A;  3LJA A;  3WKJ D;  3AZL C;  5C3I B;  3MGP B;  3X1S D;  3X1V C;  3LZ1 C;  1ZLA B;  4WU9 C;  2ZY5 A;  3UT9 B;  1P34 D;  5DNN C;  4J8U B;  4KGC B;  4JJN C;  4H9R B;  2RVQ C;  3AZK B;  4E45 A;  2RIQ A;  3MNN A;  3KWQ D;  1P3M B;  1Q9C A;  2F8N A;  5GT0 A;  4NFT A;  1KX4 C;  5JRG A;  5B31 B;  5B0Z A;  3AZI D;  5AV9 C;  3O62 D;  3F6T A;  3B6F B;  3C1C B;  3AZE C;  1TZY B;  1S32 C;  1P3A A;  1P3L B;  1P3K B;  2HIO C;  3LZ1 D;  4QLC D;  3REL C;  2PYO D;  3LEL C;  3MGR B;  4Z66 A;  1H3O B;  5F99 A;  5B2I A;  4HGA C;  5GSU D;  1B6W A;  2RVQ D;  1HQ3 B;  2Y2P A;  2Y2J A;  2ARO C;  3AZH D;  5G49 B;  4AWL B;  5B33 A;  4H9N B;  5DNM C;  1W2E A;  1M18 B;  2IO5 B;  1B67 A;  1U35 C;  4CAY A;  4EO5 C;  1BH9 B;  2Y2N A;  5B0Y C;  3AYW B;  2FJ7 C;  5GXQ A;  4J8V B;  1R4V A;  3AZE D;  4R8P D;  1M1A A;  5B2J A;  3UTB B;  5CP6 A;  2NZD B;  3AN2 D;  3REL D;  3WA9 A;  1EQZ B;  3X1S A;  3TU4 B;  1ZLA D;  3MGP D;  3B6G D;  3A6N C;  1F66 C;  2ARO D;  3MGQ A;  5B0Z B;  1U35 D;  1P3I B;  5B40 C;  5B1L B;  5B24 B;  4Z5T B;  3X1U B;  3AZI A;  2L5A A;  3O62 A;  1HTA A;  5BS7 C;  3AZF B;  4X23 B;  1WWI A;  5CPJ A;  5KDM B;  4WU8 C;  2CV5 D;  3B6F D;  4QLC A;  2PYO A;  1KX3 B;  4XUJ C;  1P3L D;  4Z2M G;  3UTA C;  3LZ0 C;  1P3K D;  1P3F C;  2Y2L A;  4ZUX B;  1P3O D;  5GSU A;  3W97 B;  1N1J A;  3AZH A;  1P3B C;  4YS3 B;  3X1T D;  4LD9 C;  3EPK A;  1M18 D;  5AY8 C;  1M19 D;  3B0C W;  3C1B B;  4H9S C;  4J8W C;  1BH8 A;  5E5A B;  5B32 B;  3AYW D;  3MVD A;  4R8P A;  2LY8 A;  4J8V D;  3WAA C;  3KSY A;  3WKJ B;  3AN2 A;  4XUJ D;  1P34 B;  3UTA D;  3LJA C;  2NZD D;  1EQZ D;  1ZLA A;  3MGP A;  3KWQ B;  3UT9 A;  4KGC A;  4J8U A;  4DRA A;  5AVB D;  2JE5 A;  3B0C T;  2ZY2 A;  1P3B D;  1KX5 C;  3AZK A;  5GT0 C;  1P3M A;  5FUG B;  3W98 C;  5B1L D;  5B31 A;  3AZM D;  3X1U D;  4WJ3 C;  3REI D;  3B6F A;  3AZF D;  3LZ1 B;  4G92 C;  3C1C A;  2PYO B;  1TZY A;  5GT3 C;  1P3A C;  1ID3 C;  2F8N G;  1P3L A;  1P3K A;  1KX3 D;  2W8S A;  3MGR A;  1H3O A;  3W99 C;  1KX5 D;  3B0D B;  1HQ3 A;  3W97 D;  5AV9 B;  3H0L C;  5G49 A;  3WTP C;  4H9N A;  4Z2M H;  1P3G C;  1M18 A;  3AZE B;  3EPL A;  1BH9 A;  5GXQ C;  1S32 B;  3AYW A;  5CHL B;  2HIO B;  4J8V A;  5CPK D;  3VH5 T;  5AV8 C;  5E5A D;  3REL B;  2Y2K A;  3LEL B;  4J8X D;  2VQR A;  3UTB A;  4HGA B;  2NZD A;  3B6G B;  4H9P B;  2ARO B;  1EQZ A;  5AV5 C;  2Y2H A;  3AV1 C;  3W99 D;  3TU4 A;  5CPI C;  2NQB C;  1U35 B;  3MGQ C;  4EO5 B;  3AZJ C;  5B0Y B;  3WTP D;  3AV2 D;  1P3G D;  4WZS B;  1P3I A;  5B1L A;  2HUE B;  5B24 A;  4Z5T A;  3X1U A;  4YM6 D;  1PZR A;  2CV5 B;  3H0R C;  3AZF A;  3REK C;  4X23 A;  3AZL D;  5KDM A;  3X1V D;  1F66 B;  4WU9 D;  1P3O B;  5DNN D;  4JJN D;  2YFW B;  5BNV B;  1KX3 A;  3AZG C;  4M6B A;  3AL0 C;  5CPI D;  2NQB D;  3AZN C;  4ZUX A;  3X1T B;  1KX4 D;  3W97 A;  5BO0 B;  1M19 B;  4YS3 A;  5AV9 D;  2ZY4 A;  3C1B A;  2XD5 A;  4XZQ C;  1P3P C;  5E5A A;  5B32 A;  4XUJ B;  1S32 D;  3UTA B;  2HIO D;  3H0M C;  3LEL D;  3WKJ A;  1AOI C;  1P34 A;  5AVB B;  1P3B B;  5B1M C;  5C3I C;  4LD9 B;  5DNM D;  4KGC C;  3KWQ A;  3AV2 A;  4ZBJ C;  5AVC C;  4J8W B;  3AZM B;  3A1K A;  5B0Y D;  2FJ7 D;  5FUG A;  3W96 C;  3REI B;  1P3P D;  2UWX A;  5AV6 C;  5BT1 C;  3LZ1 A;  3X1V A;  1TZY C;  4WU9 A;  3A6N D;  4JJN A;  2Y2I A;  1F66 D;  1KX5 B;  4H9Q B;  5B31 G;  3MGR C;  3W98 B;  1F1E A;  2BYM B;  3EG5 B;  1HQ3 C;  4NE3 A;  5B40 D;  3KXB C;  3AFA C;  4AWL C;  5AV9 A;  3KUY C;  2F2A C;  3W96 D;  3REH C;  5CPK B;  3REJ C;  3AZE A;  4CSR B;  3MGS C;  4J8X B;  4G91 C;  4NE5 A;  4WU8 D;  1ID3 B;  4KUD C;  1S32 A;  2HIO A;  4WV4 B;  2F8N K;  4DRB A;  3REL A;  3LEL A;  3LZ0 D;  3UTB C;  1P3F D;  4UPK A;  3W99 B;  3B6G A;  4H9P A;  2ARO A;  3WTP B;  5DNM A;  3IP4 C;  3AV2 B;  1P3G B;  4LD9 D;  3MNN C;  1U35 A;  5AY8 D;  5JRG C;  5B0Y A;  4YM6 B;  5B0Z C;  4J8W D;  2Y2G A;  1P3I C;  4WNN B;  5B24 C;  3MGS D;  3WAA D;  3AZL B;  3X1V B;  2CV5 A;  4WU9 B;  5DNN B;  3FDD A;  3LJA D;  5AV5 B;  4JJN B;  3AV1 B;  5CPI B;  2NQB B;  1F66 A;  5JA4 B;  4Z66 C;  1P3O A;  2Y2O A;  5F99 C;  5B2I C;  3AZJ B;  1KX4 B;  2YFW A;  5BNV A;  3MNN D;  2F8N D;  5GT0 D;  3W98 D;  5B40 A;  3EPJ A;  5JRG D;  5B33 C;  3X1T A;  5BO0 A;  1M19 A;  4YS3 C;  3NQJ B;  5BS7 A;  3REK B;  3KFU G;  3C1B C;  1M1A C;  4H9O B;  5GT3 D;  5B2J C;  5CP6 C;  2G5H C;  3R45 B;  1TAF B;  4XUJ A;  1A7W A;  3V9R B;  3UTA A;  3LZ0 A;  3AZN B;  3WA9 C;  1P3F A;  3WKJ C;  4Z66 D;  3X1S C;  5B2I D;  5DNM B;  1BFM A;  5BNX A;  2DQN C;  5AVB A;  1P3B A;  5B33 D;  4LD9 A;  2FJ7 B;  5B32 G;  1ID3 D;  4XZQ B;  3AZI C;  4J8W A;  3AZM A;  1P3P B;  5GXQ D;  3O62 C;  5AV8 D;  3REI A;  5B2J D;  1AOI B;  5CPJ C;  4E44 A;  3WA9 D;  5B1M B;  3A6N B;  3NQU A;  4QLC C;  2PYO C;  5AV5 D;  3AV1 D;  5GSU C;  4ZBJ B;  5AVC B;  3MGQ D;  4H9Q A;  5B40 B;  3AZJ D;  1KX5 A;  3AZH C;  2YFV B;  3W98 A;  2F8N H;  3B0D C;  2BYM A;  3W96 B;  5AV6 B;  4WU8 B;  5CPK A;  3REK D;  3MVD C;  4R8P C;  5CPJ D; 
#chains in the Genus database with same CATH homology
 2Y2Q A;  4CSR A;  1KU5 A;  2Y2M A;  5GT3 A;  3LZ0 B;  4J8X A;  1P3F B;  1ID3 A;  3AN2 C;  3WTP E;  3AZG D;  5BNX B;  3AZN D;  1JFI B;  4DQY B;  1ZLA C;  3MGP C;  3B6G C;  3W99 A;  2J8P A;  3KXB B;  3AFA B;  3UT9 C;  4J8U C;  5AY8 B;  3KUY B;  3WTP A;  1P3G A;  3REH B;  4KHA B;  3AZK C;  1P3M C;  3REJ B;  3MGS B;  4G91 B;  4KUD B;  2BYK B;  4YM6 A;  3WAA B;  5B31 C;  4XZQ D;  1Z2C B;  3MVD D;  5AV8 A;  4UUZ B;  2HUE C;  4WNN A;  3LJA B;  3B6F C;  3NQU B;  2CV5 C;  3AZL A;  3A1I A;  3C1C C;  1AOI D;  5DNN A;  1P3L C;  5AV5 A;  5B1M D;  3AV1 A;  1P3K C;  5CPI A;  3VH6 W;  3MNN B;  3UT9 D;  1P3O C;  2NQB A;  4KGC D;  4J8U D;  5JA4 A;  5GT0 B;  2F8N B;  5JRG B;  3AZJ A;  1KX4 A;  3EPH A;  5AVC D;  3AZK D;  3VH6 A;  1P3M D;  2ZY3 A;  3X1T C;  2DF4 C;  1M18 C;  2IO5 C;  5B31 D;  1M19 C;  4G92 B;  3NQJ A;  5AV6 D;  5GT3 B;  3REK A;  3AYW C;  1P3A B;  1T3U A;  5BT1 D;  4J8V C;  3C1C D;  3VH6 T;  2XD1 A;  1TZY D;  4Z66 B;  4H9O A;  5F99 B;  5B2I B;  3R45 A;  1TAF A;  2NZD C;  3V9R A;  3AZG A;  3AZN A;  1EQZ C;  3MGR D;  5B33 B;  3TU4 C;  1HQ3 D;  5AVB C;  3KXB D;  3AFA D;  4CAY B;  2JSS A;  5GXQ B;  3KUY D;  2FJ7 A;  1ULY A;  3REH D;  1P3A D;  5AV8 B;  3REJ D;  5B1L C;  3AZM C;  4XZQ A;  4Z5T C;  3X1U C;  5B2J B;  1M1A B;  5CP6 B;  1P3P A;  4KUD D;  3WA9 B;  3REI C;  3X1S B;  3AZF C;  4X23 C;  3UTB D;  1AOI A;  2FFF B;  2BG1 A;  2G5I C;  5B1M A;  3A6N A;  3MGQ B;  1KX3 C;  3TU4 D;  4ZUX C;  4H9R A;  2JCH A;  5AVC A;  3AZI B;  3W97 C;  2YFV A;  5B0Z D;  3O62 B;  1P3I D;  3W96 A;  5B24 D;  4Z5T D;  5CPJ B;  4NE6 A;  5AV6 A;  4WU8 A;  5CPK C;  4QLC B;  4X23 D;  3B0B A;  5E5A C;  5B32 C;  2CWE A;  4J8X C;  1WWS A;  2ZM5 A;  3AZG B;  5GSU B;  3VH5 W;  5F99 D;  1P34 C;  1N1J B;  3AZH B;  4ZUX D;  1JFI A;  3VH5 A;  3KXB A;  3AFA A;  3KWQ C;  3AV2 C;  5AY8 A;  4YS3 D;  3KUY A;  1BH8 B;  3REH A;  4H9S A;  4KHA A;  3MVD B;  4R8P B;  3REJ A;  3MGS A;  4YM6 C;  4KUD A;  3C1B D;  2BYK A;  1M1A D;  3WAA A;  3AN2 B;  5B32 D;  3P5J B;  5CP6 D;  4UUZ A;  3LJA A;  3WKJ D;  3AZL C;  5C3I B;  3MGP B;  3X1S D;  3X1V C;  3LZ1 C;  1ZLA B;  4WU9 C;  2ZY5 A;  3UT9 B;  1P34 D;  5DNN C;  4J8U B;  4KGC B;  4JJN C;  4H9R B;  2RVQ C;  3AZK B;  4E45 A;  2RIQ A;  3MNN A;  3KWQ D;  1P3M B;  1Q9C A;  2F8N A;  5GT0 A;  4NFT A;  1KX4 C;  5JRG A;  5B31 B;  5B0Z A;  3AZI D;  5AV9 C;  3O62 D;  3F6T A;  3B6F B;  3C1C B;  3AZE C;  1TZY B;  1S32 C;  1P3A A;  1P3L B;  1P3K B;  2HIO C;  3LZ1 D;  4QLC D;  3REL C;  2PYO D;  3LEL C;  3MGR B;  4Z66 A;  1H3O B;  5F99 A;  5B2I A;  4HGA C;  5GSU D;  1B6W A;  2RVQ D;  1HQ3 B;  2Y2P A;  2Y2J A;  2ARO C;  3AZH D;  5G49 B;  4AWL B;  5B33 A;  4H9N B;  5DNM C;  1W2E A;  1M18 B;  2IO5 B;  1B67 A;  1U35 C;  4CAY A;  4EO5 C;  1BH9 B;  2Y2N A;  5B0Y C;  3AYW B;  2FJ7 C;  5GXQ A;  4J8V B;  1R4V A;  3AZE D;  4R8P D;  1M1A A;  5B2J A;  3UTB B;  5CP6 A;  2NZD B;  3AN2 D;  3REL D;  3WA9 A;  1EQZ B;  3X1S A;  3TU4 B;  1ZLA D;  3MGP D;  3B6G D;  3A6N C;  1F66 C;  2ARO D;  3MGQ A;  5B0Z B;  1U35 D;  1P3I B;  5B40 C;  5B1L B;  5B24 B;  4Z5T B;  3X1U B;  3AZI A;  2L5A A;  3O62 A;  1HTA A;  5BS7 C;  3AZF B;  4X23 B;  1WWI A;  5CPJ A;  5KDM B;  4WU8 C;  2CV5 D;  3B6F D;  4QLC A;  2PYO A;  1KX3 B;  4XUJ C;  1P3L D;  4Z2M G;  3UTA C;  3LZ0 C;  1P3K D;  1P3F C;  2Y2L A;  4ZUX B;  1P3O D;  5GSU A;  3W97 B;  1N1J A;  3AZH A;  1P3B C;  4YS3 B;  3X1T D;  4LD9 C;  3EPK A;  1M18 D;  5AY8 C;  1M19 D;  3B0C W;  3C1B B;  4H9S C;  4J8W C;  1BH8 A;  5E5A B;  5B32 B;  3AYW D;  3MVD A;  4R8P A;  2LY8 A;  4J8V D;  3WAA C;  3KSY A;  3WKJ B;  3AN2 A;  4XUJ D;  1P34 B;  3UTA D;  3LJA C;  2NZD D;  1EQZ D;  1ZLA A;  3MGP A;  3KWQ B;  3UT9 A;  4KGC A;  4J8U A;  4DRA A;  5AVB D;  2JE5 A;  3B0C T;  2ZY2 A;  1P3B D;  1KX5 C;  3AZK A;  5GT0 C;  1P3M A;  5FUG B;  3W98 C;  5B1L D;  5B31 A;  3AZM D;  3X1U D;  4WJ3 C;  3REI D;  3B6F A;  3AZF D;  3LZ1 B;  4G92 C;  3C1C A;  2PYO B;  1TZY A;  5GT3 C;  1P3A C;  1ID3 C;  2F8N G;  1P3L A;  1P3K A;  1KX3 D;  2W8S A;  3MGR A;  1H3O A;  3W99 C;  1KX5 D;  3B0D B;  1HQ3 A;  3W97 D;  5AV9 B;  3H0L C;  5G49 A;  3WTP C;  4H9N A;  4Z2M H;  1P3G C;  1M18 A;  3AZE B;  3EPL A;  1BH9 A;  5GXQ C;  1S32 B;  3AYW A;  5CHL B;  2HIO B;  4J8V A;  5CPK D;  3VH5 T;  5AV8 C;  5E5A D;  3REL B;  2Y2K A;  3LEL B;  4J8X D;  2VQR A;  3UTB A;  4HGA B;  2NZD A;  3B6G B;  4H9P B;  2ARO B;  1EQZ A;  5AV5 C;  2Y2H A;  3AV1 C;  3W99 D;  3TU4 A;  5CPI C;  2NQB C;  1U35 B;  3MGQ C;  4EO5 B;  3AZJ C;  5B0Y B;  3WTP D;  3AV2 D;  1P3G D;  4WZS B;  1P3I A;  5B1L A;  2HUE B;  5B24 A;  4Z5T A;  3X1U A;  4YM6 D;  1PZR A;  2CV5 B;  3H0R C;  3AZF A;  3REK C;  4X23 A;  3AZL D;  5KDM A;  3X1V D;  1F66 B;  4WU9 D;  1P3O B;  5DNN D;  4JJN D;  2YFW B;  5BNV B;  1KX3 A;  3AZG C;  4M6B A;  3AL0 C;  5CPI D;  2NQB D;  3AZN C;  4ZUX A;  3X1T B;  1KX4 D;  3W97 A;  5BO0 B;  1M19 B;  4YS3 A;  5AV9 D;  2ZY4 A;  3C1B A;  2XD5 A;  4XZQ C;  1P3P C;  5E5A A;  5B32 A;  4XUJ B;  1S32 D;  3UTA B;  2HIO D;  3H0M C;  3LEL D;  3WKJ A;  1AOI C;  1P34 A;  5AVB B;  1P3B B;  5B1M C;  5C3I C;  4LD9 B;  5DNM D;  4KGC C;  3KWQ A;  3AV2 A;  4ZBJ C;  5AVC C;  4J8W B;  3AZM B;  3A1K A;  5B0Y D;  2FJ7 D;  5FUG A;  3W96 C;  3REI B;  1P3P D;  2UWX A;  5AV6 C;  5BT1 C;  3LZ1 A;  3X1V A;  1TZY C;  4WU9 A;  3A6N D;  4JJN A;  2Y2I A;  1F66 D;  1KX5 B;  4H9Q B;  5B31 G;  3MGR C;  3W98 B;  1F1E A;  2BYM B;  3EG5 B;  1HQ3 C;  4NE3 A;  5B40 D;  3KXB C;  3AFA C;  4AWL C;  5AV9 A;  3KUY C;  2F2A C;  3W96 D;  3REH C;  5CPK B;  3REJ C;  3AZE A;  4CSR B;  3MGS C;  4J8X B;  4G91 C;  4NE5 A;  4WU8 D;  1ID3 B;  4KUD C;  1S32 A;  2HIO A;  4WV4 B;  2F8N K;  4DRB A;  3REL A;  3LEL A;  3LZ0 D;  3UTB C;  1P3F D;  4UPK A;  3W99 B;  3B6G A;  4H9P A;  2ARO A;  3WTP B;  5DNM A;  3IP4 C;  3AV2 B;  1P3G B;  4LD9 D;  3MNN C;  1U35 A;  5AY8 D;  5JRG C;  5B0Y A;  4YM6 B;  5B0Z C;  4J8W D;  2Y2G A;  1P3I C;  4WNN B;  5B24 C;  3MGS D;  3WAA D;  3AZL B;  3X1V B;  2CV5 A;  4WU9 B;  5DNN B;  3FDD A;  3LJA D;  5AV5 B;  4JJN B;  3AV1 B;  5CPI B;  2NQB B;  1F66 A;  5JA4 B;  4Z66 C;  1P3O A;  2Y2O A;  5F99 C;  5B2I C;  3AZJ B;  1KX4 B;  2YFW A;  5BNV A;  3MNN D;  2F8N D;  5GT0 D;  3W98 D;  5B40 A;  3EPJ A;  5JRG D;  5B33 C;  3X1T A;  5BO0 A;  1M19 A;  4YS3 C;  3NQJ B;  5BS7 A;  3REK B;  3KFU G;  3C1B C;  1M1A C;  4H9O B;  5GT3 D;  5B2J C;  5CP6 C;  2G5H C;  3R45 B;  1TAF B;  4XUJ A;  1A7W A;  3V9R B;  3UTA A;  3LZ0 A;  3AZN B;  3WA9 C;  1P3F A;  3WKJ C;  4Z66 D;  3X1S C;  5B2I D;  5DNM B;  1BFM A;  5BNX A;  2DQN C;  5AVB A;  1P3B A;  5B33 D;  4LD9 A;  2FJ7 B;  5B32 G;  1ID3 D;  4XZQ B;  3AZI C;  4J8W A;  3AZM A;  1P3P B;  5GXQ D;  3O62 C;  5AV8 D;  3REI A;  5B2J D;  1AOI B;  5CPJ C;  4E44 A;  3WA9 D;  5B1M B;  3A6N B;  3NQU A;  4QLC C;  2PYO C;  5AV5 D;  3AV1 D;  5GSU C;  4ZBJ B;  5AVC B;  3MGQ D;  4H9Q A;  5B40 B;  3AZJ D;  1KX5 A;  3AZH C;  2YFV B;  3W98 A;  2F8N H;  3B0D C;  2BYM A;  3W96 B;  5AV6 B;  4WU8 B;  5CPK A;  3REK D;  3MVD C;  4R8P C;  5CPJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...