3REJD

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejD00
4H9OB 3NQJA 4QLCC 1BH9A 5AV6B 2HIOB 5CPJC 3UTAC 4J8UB 4G92B 3B0DB 5DNNA 3RELA 3UTBD 3AZHB 3REJD 4DRBA 3REHA 5E5AA 2CWEA 3AZKA 2CV5B 4WU9C 1P3KD 5CHLB 3LZ1C 3AZID 1R4VA 3AZHC 3LJAA 3WA9A 3AFAB 5GT0C 3W97D 3AZND 3X1UC 5AVCA 4J8WB 4YS3A 1P3OB 3AN2B 1P3MA 1BFMA 4ZUXD 5B1LA 2FJ7C 4CSRA 3AFAC 4H9RA 5B40D 3AZEA 5FUGA 5AV6D 2YFWA 3MGPB 3AV2A 3W98A 4NFTA 4J8UD 3W96B 4KUDB 5B2JA 3AZGC 3B6FB 5B32A 4YM6B 3MGQA 5AV8D 1P3GC 2HUEB 2CV5D 4KGCB 1KX4B 3B6GB 5GT3A 5AV5D 4QLCA 3KXBB 2HUEC 2NZDD 4J8WD 4KGCC 1P3BB 3C1CB 2NQBC 4H9SC 4H9OA 4R8PC 5KDMB 3KWQB 3KXBC 2HIOA 1P3LB 3W96D 4KUDD 4WU9A 5B2IB 4Z66B 3AZHA 1EQZC 5GT0A 4J8VD 1KX5D 4HGAB 3MGSB 3AZMB 3X1UA 1KX4D 1KX3B 4WU8C 5BO0B 3MNNC 4Z66C 3AZJB 2FJ7A 2JSSA 3AFAA 3AZLB 1P3AD 5AV9C 4WNNB 3AZMC 3WAAB 3VH5W 5GXQB 1P3OA 1M1AB 3AN2A 3C1CD 3AZJC 1HTAA 1HQ3D 3AZLC 5AY8C 1P3GA 3MGPA 4J8XD 1P3ID 3B6FA 3W99C 4CAYB 4Z2MH 3REID 5B0ZB 3MGRC 3REHB 4YM6A 3AZKB 3MGSD 3A6NB 1KX3D 4KGCA 3B6GA 5B0ZC 3X1VD 1M18D 4H9SA 1S32D 5GSUD 4R8PA 5CPIB 5B24D 1P3FB 3KXBA 5B1MC 1N1JA 5GXQD 4Z5TB 3KSYA 4CSRB 1P3BA 1F66C 5FUGB 1EQZA 3W98B 1Q9CA 3V9RB 3KWQA 4XUJB 5DNND 3RELD 1P3LA 4Z5TC 5B32B 4WU8A 1U35C 3MNNA 5B2IA 3REHD 5E5AD 4Z66A 3MVDC 4UUZA 5B33B 3AZKD 5AV9A 3AZMA 1TZYB 1P3PB 4ZBJB 5GT3B 3LJAD 3WA9D 3O62B 5BO0A 5CPKC 2F8NH 3AZJA 2F8NK 5JA4B 5B33C 3AZFC 5AVCD 3AZLA 5CPJB 4YS3D 3LZ0C 3UTAB 3KUYB 1P3MD 4WNNA 2IO5B 3WAAA 1TZYC 5B1LD 4G91B 5BNXA 5B0YC 1P3PC 3W99A 3AZED 1M1AA 5B31C 3AV2D 3W98D 3LELC 4WV4B 5B2JD 3KUYC 4WU9B 2IO5C 3LZ1B 4G91C 5B32D 3MGQD 4CAYA 1B67A 5GT0B 5B0ZA 1P34B 3X1UB 3A6NA 5GT3D 2FJ7B 4KHAA 5B32G 4QLCD 1F66A 5F99B 1P34C 5CPIA 1P3FA 3AZGB 3W97C 3AZNC 4Z5TA 1ZLAB 3REKB 3MVDA 1P3GB 2HIOD 5F99C 5AVBC 3V9RA 4WU9D 4XUJA 3LZ1D 5B40C 1A7WA 4NE3A 1H3OB 3AZHD 1ZLAC 3REKC 5GT0D 3X1TC 5B33A 1M19B 3X1UD 3AZFA 1JFIB 3LELD 3VH6A 1TZYA 1P3PA 2FJ7D 4X23C 2NQBB 5DNMC 3O62A 3AFAD 4R8PB 5B31A 5JA4A 1N1JB 1M19C 5CPJA 3B0BA 3UTAA 1P3OD 3AN2D 3KUYA 1EQZB 3B0CW 1P3GD 3MGPD 3B6FD 4WU8B 3MNNB 3LZ1A 4YM6D 4UUZB 2AROB 5AV9B 1P34A 4KGCD 5BS7C 3WTPB 5CP6B 3B6GD 1KX5C 4J8VC 3X1SB 5JRGC 5C3IC 4R8PD 2BYMA 5BNVA 2AROC 3KXBD 1AOIB 5AY8B 5F99A 5CP6C 3WTPC 5AVBA 5BNXB 4AWLC 3AZGA 3X1SC 1P3BD 3TU4C 1P3AC 3W99B 3MGRB 1ZLAA 3REKA 1EQZD 3X1TA 3KWQD 1AOIC 4Z2MG 2F8NB 4JJNC 1P3LD 2L5AA 4WU8D 3MNND 4M6BA 5B2ID 2RVQD 1H3OA 4Z66D 1ID3C 4X23A 4J8XC 5DNMA 3WKJC 3B0CT 3AV1C 2PYOC 3REIC 5AV9D 3AZMD 5B1MB 1M19A 1JFIA 4KHAB 3C1BC 1F66B 3UT9C 3AZJD 2NQBA 3AYWB 3AZLD 3VH6W 1KU5A 3WAAD 3X1VC 1S32C 3W99D 5GSUC 1M1AD 1U35B 3MVDB 3AYWC 5BS7A 5B0ZD 5CPKB 4XZQC 5JRGA 4LD9B 5DNNC 3RELC 3AZFB 4NE5A 4H9QB 2AROA 3LZ0B 3A6ND 2F8NG 1F1EA 5CP6A 5B0YB 3WTPA 3X1SA 1F66D 3TU4A 5B31B 4LD9C 5CPID 3LELB 1M18B 1P3FD 1AOIA 5AY8A 1WWSA 4JJNA 4Z5TD 4YS3C 3MVDD 3MGRA 1ID3A 3WKJA 5B1LC 3VH6T 3WTPE 3AV1A 2PYOA 1M18C 4XUJD 2F8NA 2YFVA 3AV2C 2BYKB 5BT1D 3C1BA 5B2JC 3UT9A 1P3KB 5B33D 3AZFD 3UTBC 3REJC 3W97B 5B1MA 1TZYD 1P3PD 3AZNB 3O62D 1ULYA 2BYMB 5B31D 5BNVB 1P3KC 3NQUB 4E44A 3AZIC 3AYWA 5CPJD 3UTAD 5AVBB 3KUYD 5B40B 4H9NA 3R45B 1U35A 5G49A 3X1TB 4XZQA 5B31G 4ZUXC 4WZSB 5AV8B 5AV6C 2HIOC 1BH8A 4X23B 5DNMB 4J8UC 5CPKA 4G92C 4LD9A 3B0DC 1P34D 4H9QA 3VH5A 5AV5B 3LZ0A 5AV8C 5B0YA 2CV5C 2NZDB 5F99D 1TAFB 5AVBD 3LELA 4NE6A 1M18A 3AZGD 5AV5C 1ZLAD 3REKD 3X1TD 2NZDC 4J8WC 1P3OC 3AN2C 3UTBA 3REJA 1KX5B 4J8VB 3MGPC 2BYKA 5JRGB 4X23D 5DNMD 3W96C 5C3IB 4KUDC 3B6FC 1P3KA 1M19D 3AZIA 4YM6C 4AWLB 3W97A 3TU4B 1P3AB 3AZNA 2NQBD 4EO5B 4H9PB 1KX4C 3B6GC 3NQUA 4JJNB 4ZUXA 1B6WA 1HQ3B 5B40A 3R45A 5AV6A 4EO5C 1ID3B 3WKJB 4J8XB 1P3IB 4J8UA 3AV1B 2PYOB 1P3BC 3REIB 2YFVB 3C1CC 1HQ3C 3KWQC 3C1BB 5JRGD 5AV8A 3UT9B 1P3LC 2CV5A 1P3IC 2AROD 5B2IC 2RVQC 5CP6D 3WTPD 3X1VB 3X1SD 5AV5A 3TU4D 5GSUB 4HGAC 1S32B 5B24B 3MGSC 2NZDA 4J8WA 1KX3C 1AOID 5AY8D 4JJND 3NQJB 1BH9B 1TAFA 4H9NB 1WWIA 5G49B 4E45A 5B24C 3MGRD 3WAAC 4XZQB 1ID3D 3WKJD 5DNNB 3RELB 3W96A 5GXQC 3AV1D 2PYOD 4KUDA 1M1AC 2F8ND 5E5AB 3C1BD 1BH8B 1KX5A 4J8VA 3UT9D 3LJAB 3WA9B 1KX4A 5B1MD 3REHC 5E5AC 3AZKC 5AVCB 1P3AA 4YS3B 3A6NC 1P3MB 4H9PA 3AYWD 5B1LB 3LJAC 3WA9C 4H9RB 3AZEB 3C1CA 2YFWB 3AV2B 1HQ3A 5CPIC 5KDMA 5AVCC 1U35D 5B2JB 4XZQD 1P3FC 3VH5T 1P3MC 4J8XA 1P3IA 3MGQB 3UTBB 3REJB 3REIA 3AZEC 4DRAA 2LY8A 3W98C 5CPKD 4XUJC 4LD9D 3MGSA 3AZIB 5BT1C 5B32C 1KX3A 3MGQC 3LZ0D 4QLCB 5B0YD 3X1VA 1S32A 5GSUA 5B24A 4ZBJC 5GT3C 5GXQA 3O62C 4ZUXB
chains in the Genus database with same CATH superfamily
4H9OB 3NQJA 4QLCC 1BH9A 5AV6B 2HIOB 5CPJC 3UTAC 4J8UB 4G92B 3B0DB 5DNNA 3RELA 3UTBD 3AZHB 3REJD 4DRBA 3REHA 5E5AA 2CWEA 3AZKA 2CV5B 3KFUG 4WU9C 1P3KD 5CHLB 3LZ1C 3AZID 1R4VA 3AZHC 3LJAA 3WA9A 3A1KA 3AFAB 5GT0C 3W97D 3AZND 3X1UC 5AVCA 4J8WB 4YS3A 1P3OB 3AN2B 1P3MA 1BFMA 4ZUXD 5B1LA 2FJ7C 4CSRA 3AFAC 4H9RA 5B40D 3AZEA 5FUGA 5AV6D 2YFWA 3MGPB 3AV2A 3W98A 2Y2QA 4NFTA 4J8UD 3W96B 4KUDB 5B2JA 3AZGC 3B6FB 5B32A 4YM6B 3MGQA 5AV8D 1P3GC 2HUEB 2CV5D 3IP4C 4KGCB 1KX4B 3B6GB 2F2AC 5GT3A 5AV5D 4QLCA 3KXBB 2HUEC 2NZDD 4J8WD 4KGCC 1P3BB 2Y2KA 3C1CB 2NQBC 4H9SC 4H9OA 4R8PC 5KDMB 3KWQB 3KXBC 2HIOA 1P3LB 3W96D 4KUDD 4WU9A 2G5IC 5B2IB 4Z66B 3AZHA 1EQZC 5GT0A 4J8VD 1KX5D 4HGAB 2ZY3A 3MGSB 3AZMB 3X1UA 1KX4D 1KX3B 4WU8C 5BO0B 3MNNC 3P5JB 2Y2OA 4Z66C 3AZJB 2FJ7A 2JSSA 3AFAA 3AZLB 1P3AD 5AV9C 4WNNB 3AZMC 3WAAB 3VH5W 5GXQB 1P3OA 1M1AB 3AN2A 3C1CD 3AZJC 1HTAA 1HQ3D 3AZLC 3EPKA 5AY8C 1P3GA 3MGPA 4J8XD 1P3ID 3B6FA 3W99C 4CAYB 4Z2MH 3REID 5B0ZB 3MGRC 3REHB 4YM6A 3AZKB 3MGSD 3A6NB 1KX3D 2W8SA 4KGCA 3B6GA 5B0ZC 3X1VD 1M18D 4H9SA 1S32D 5GSUD 4R8PA 5CPIB 5B24D 1P3FB 3KXBA 5B1MC 1N1JA 5GXQD 4Z5TB 4UPKA 3KSYA 4CSRB 1P3BA 1F66C 5FUGB 1EQZA 3W98B 1Q9CA 3V9RB 3KWQA 4XUJB 2Y2HA 5DNND 3RELD 4Z5TC 1P3LA 5B32B 4WU8A 1U35C 3MNNA 5B2IA 3REHD 5E5AD 4Z66A 3MVDC 4UUZA 5B33B 3AZKD 3EPHA 5AV9A 3AZMA 1TZYB 1P3PB 4ZBJB 5GT3B 3LJAD 3WA9D 3O62B 5BO0A 5CPKC 2F8NH 3AZJA 2F8NK 5JA4B 5B33C 3AZFC 5AVCD 3AZLA 5CPJB 4YS3D 3LZ0C 3UTAB 3KUYB 1P3MD 4WNNA 2IO5B 3WAAA 1TZYC 5B1LD 4G91B 5BNXA 5B0YC 1P3PC 3W99A 3AZED 1M1AA 5B31C 3AV2D 3W98D 3LELC 4WV4B 5B2JD 3KUYC 4WU9B 2IO5C 3LZ1B 4G91C 5B32D 3MGQD 4CAYA 1B67A 5GT0B 5B0ZA 1P34B 3X1UB 3A6NA 5GT3D 3A1IA 2FJ7B 4KHAA 5B32G 4QLCD 1F66A 5F99B 1P34C 5CPIA 1P3FA 3AZGB 3W97C 3AL0C 3AZNC 4Z5TA 1ZLAB 3REKB 3MVDA 1P3GB 2HIOD 5F99C 2RIQA 5AVBC 3V9RA 4WU9D 4XUJA 3LZ1D 5B40C 1A7WA 4NE3A 1H3OB 3AZHD 2ZY4A 1ZLAC 3REKC 5GT0D 3X1TC 5B33A 1M19B 3X1UD 3AZFA 1JFIB 3LELD 3VH6A 3EPLA 1TZYA 1P3PA 2FJ7D 4X23C 2NQBB 5DNMC 3O62A 3AFAD 4R8PB 5B31A 5JA4A 1N1JB 1M19C 5CPJA 3B0BA 3UTAA 1P3OD 3AN2D 3KUYA 1EQZB 3B0CW 1P3GD 3MGPD 1Z2CB 3B6FD 4WU8B 3MNNB 3LZ1A 4YM6D 4UUZB 2AROB 5AV9B 1P34A 4KGCD 2XD1A 3WTPB 5BS7C 5CP6B 3B6GD 1KX5C 4J8VC 3X1SB 5JRGC 5C3IC 4R8PD 2BYMA 5BNVA 2AROC 3KXBD 1AOIB 5AY8B 5F99A 5CP6C 5AVBA 5BNXB 3WTPC 4AWLC 3AZGA 3X1SC 1P3BD 3TU4C 1P3AC 3W99B 3MGRB 1ZLAA 3REKA 1EQZD 3X1TA 3KWQD 1AOIC 4Z2MG 2F8NB 4JJNC 1P3LD 2L5AA 4WU8D 3MNND 5B2ID 4M6BA 3EG5B 2RVQD 1H3OA 4Z66D 1ID3C 4X23A 4J8XC 5DNMA 3WKJC 3B0CT 3AV1C 2PYOC 2ZY2A 3REIC 5AV9D 3AZMD 4WJ3C 5B1MB 1M19A 1JFIA 4KHAB 3C1BC 1F66B 3UT9C 3AZJD 2NQBA 3AYWB 3AZLD 3VH6W 1KU5A 3WAAD 2Y2PA 3X1VC 1S32C 3W99D 5GSUC 1M1AD 1U35B 3MVDB 2VQRA 3AYWC 2ZY5A 5BS7A 5B0ZD 5CPKB 4XZQC 5JRGA 4LD9B 5DNNC 3RELC 3AZFB 4NE5A 4H9QB 2AROA 3LZ0B 3A6ND 2FFFB 2F8NG 1F1EA 5CP6A 5B0YB 3WTPA 3X1SA 1F66D 3TU4A 3H0MC 5B31B 4LD9C 5CPID 3LELB 1M18B 1P3FD 1AOIA 5AY8A 1WWSA 4JJNA 4Z5TD 4YS3C 3MVDD 3MGRA 1ID3A 3WKJA 5B1LC 3VH6T 3WTPE 3AV1A 2PYOA 1M18C 1PZRA 4XUJD 2F8NA 2YFVA 3AV2C 2BYKB 5BT1D 3C1BA 5B2JC 3F6TA 3UT9A 1P3KB 5B33D 3AZFD 2Y2IA 2J8PA 3UTBC 3REJC 3W97B 5B1MA 1TZYD 1P3PD 3AZNB 3O62D 1ULYA 2BYMB 5B31D 5BNVB 2JE5A 1P3KC 3NQUB 4E44A 3AZIC 3AYWA 5CPJD 3UTAD 5AVBB 2G5HC 3KUYD 5B40B 4H9NA 3R45B 2Y2MA 1U35A 5G49A 3X1TB 4XZQA 5B31G 4ZUXC 4WZSB 5AV8B 5AV6C 2HIOC 1BH8A 4X23B 5DNMB 4J8UC 5CPKA 4G92C 4LD9A 3B0DC 3H0LC 1P34D 1W2EA 4H9QA 3VH5A 5AV5B 3LZ0A 5AV8C 5B0YA 2CV5C 2NZDB 5F99D 1TAFB 2XD5A 5AVBD 3LELA 4NE6A 1M18A 3AZGD 2Y2GA 5AV5C 1ZLAD 3REKD 3X1TD 2NZDC 4J8WC 1P3OC 3AN2C 3UTBA 3REJA 1KX5B 4J8VB 3MGPC 2BYKA 5JRGB 4X23D 5DNMD 2Y2LA 3W96C 5C3IB 4KUDC 3B6FC 1P3KA 1M19D 3AZIA 4YM6C 4AWLB 3W97A 3TU4B 3H0RC 1P3AB 3AZNA 2NQBD 4EO5B 4H9PB 1KX4C 3B6GC 3NQUA 4JJNB 2DQNC 4ZUXA 1B6WA 1HQ3B 5B40A 2UWXA 3R45A 5AV6A 4EO5C 1ID3B 3WKJB 4J8XB 1P3IB 4J8UA 3AV1B 2PYOB 1P3BC 3REIB 2YFVB 3C1CC 1HQ3C 3KWQC 3C1BB 5JRGD 5AV8A 3UT9B 1P3LC 2CV5A 1P3IC 2Y2JA 2AROD 5B2IC 2RVQC 5CP6D 3WTPD 3X1VB 3X1SD 5AV5A 3TU4D 5GSUB 4HGAC 1S32B 5B24B 3MGSC 2NZDA 2Y2NA 4J8WA 1KX3C 1AOID 5AY8D 4DQYB 4JJND 3NQJB 1BH9B 1TAFA 4H9NB 1WWIA 2BG1A 5G49B 4E45A 5B24C 3MGRD 3WAAC 4XZQB 1ID3D 3WKJD 5DNNB 3RELB 3W96A 5GXQC 3AV1D 2PYOD 4KUDA 1M1AC 2F8ND 5E5AB 3FDDA 1BH8B 3C1BD 1KX5A 4J8VA 3UT9D 3LJAB 3WA9B 1KX4A 5B1MD 3REHC 5E5AC 3AZKC 5AVCB 1P3AA 4YS3B 3A6NC 1P3MB 4H9PA 3AYWD 5B1LB 3LJAC 3WA9C 4H9RB 3AZEB 3C1CA 2YFWB 3AV2B 3EPJA 1HQ3A 5CPIC 5KDMA 5AVCC 2JCHA 1U35D 5B2JB 4XZQD 1P3FC 3VH5T 2ZM5A 2DF4C 1P3MC 4J8XA 1P3IA 3MGQB 3UTBB 3REJB 3REIA 3AZEC 4DRAA 2LY8A 3W98C 5CPKD 4XUJC 4LD9D 3MGSA 3AZIB 5BT1C 5B32C 1KX3A 3MGQC 3LZ0D 4QLCB 5B0YD 1T3UA 3X1VA 1S32A 5GSUA 5B24A 4ZBJC 5GT3C 5GXQA 3O62C 4ZUXB
chains in the Genus database with same CATH topology
4H9OB 3NQJA 4QLCC 1BH9A 5AV6B 2HIOB 5CPJC 3UTAC 4J8UB 4G92B 3B0DB 5DNNA 3RELA 3UTBD 3AZHB 3REJD 4DRBA 3REHA 5E5AA 2CWEA 3AZKA 2CV5B 3KFUG 4WU9C 1P3KD 5CHLB 3LZ1C 3AZID 1R4VA 3AZHC 3LJAA 3WA9A 3A1KA 3AFAB 5GT0C 3W97D 3AZND 3X1UC 5AVCA 4J8WB 4YS3A 1P3OB 3AN2B 1P3MA 1BFMA 4ZUXD 5B1LA 2FJ7C 4CSRA 3AFAC 4H9RA 5B40D 3AZEA 5FUGA 5AV6D 2YFWA 3MGPB 3AV2A 3W98A 2Y2QA 4NFTA 4J8UD 3W96B 4KUDB 5B2JA 3AZGC 3B6FB 5B32A 4YM6B 3MGQA 5AV8D 1P3GC 2HUEB 2CV5D 3IP4C 4KGCB 1KX4B 3B6GB 2F2AC 5GT3A 5AV5D 4QLCA 3KXBB 2HUEC 2NZDD 4J8WD 4KGCC 1P3BB 2Y2KA 3C1CB 2NQBC 4H9SC 4H9OA 4R8PC 5KDMB 3KWQB 3KXBC 2HIOA 1P3LB 3W96D 4KUDD 4WU9A 2G5IC 5B2IB 4Z66B 3AZHA 1EQZC 5GT0A 4J8VD 1KX5D 4HGAB 2ZY3A 3MGSB 3AZMB 3X1UA 1KX4D 1KX3B 4WU8C 5BO0B 3MNNC 3P5JB 2Y2OA 4Z66C 3AZJB 2FJ7A 2JSSA 3AFAA 3AZLB 1P3AD 5AV9C 4WNNB 3AZMC 3WAAB 3VH5W 5GXQB 1P3OA 1M1AB 3AN2A 3C1CD 3AZJC 1HTAA 1HQ3D 3AZLC 3EPKA 5AY8C 1P3GA 3MGPA 4J8XD 1P3ID 3B6FA 3W99C 4CAYB 4Z2MH 3REID 5B0ZB 3MGRC 3REHB 4YM6A 3AZKB 3MGSD 3A6NB 1KX3D 2W8SA 4KGCA 3B6GA 5B0ZC 3X1VD 1M18D 4H9SA 1S32D 5GSUD 4R8PA 5CPIB 5B24D 1P3FB 3KXBA 5B1MC 1N1JA 5GXQD 4Z5TB 4UPKA 3KSYA 4CSRB 1P3BA 1F66C 5FUGB 1EQZA 3W98B 1Q9CA 3V9RB 3KWQA 4XUJB 2Y2HA 5DNND 3RELD 4Z5TC 1P3LA 5B32B 4WU8A 1U35C 3MNNA 5B2IA 3REHD 5E5AD 4Z66A 3MVDC 4UUZA 5B33B 3AZKD 3EPHA 5AV9A 3AZMA 1TZYB 1P3PB 4ZBJB 5GT3B 3LJAD 3WA9D 3O62B 5BO0A 5CPKC 2F8NH 3AZJA 2F8NK 5JA4B 5B33C 3AZFC 5AVCD 3AZLA 5CPJB 4YS3D 3LZ0C 3UTAB 3KUYB 1P3MD 4WNNA 2IO5B 3WAAA 1TZYC 5B1LD 4G91B 5BNXA 5B0YC 1P3PC 3W99A 3AZED 1M1AA 5B31C 3AV2D 3W98D 3LELC 4WV4B 5B2JD 3KUYC 4WU9B 2IO5C 3LZ1B 4G91C 5B32D 3MGQD 4CAYA 1B67A 5GT0B 5B0ZA 1P34B 3X1UB 3A6NA 5GT3D 3A1IA 2FJ7B 4KHAA 5B32G 4QLCD 1F66A 5F99B 1P34C 5CPIA 1P3FA 3AZGB 3W97C 3AL0C 3AZNC 4Z5TA 1ZLAB 3REKB 3MVDA 1P3GB 2HIOD 5F99C 2RIQA 5AVBC 3V9RA 4WU9D 4XUJA 3LZ1D 5B40C 1A7WA 4NE3A 1H3OB 3AZHD 2ZY4A 1ZLAC 3REKC 5GT0D 3X1TC 5B33A 1M19B 3X1UD 3AZFA 1JFIB 3LELD 3VH6A 3EPLA 1TZYA 1P3PA 2FJ7D 4X23C 2NQBB 5DNMC 3O62A 3AFAD 4R8PB 5B31A 5JA4A 1N1JB 1M19C 5CPJA 3B0BA 3UTAA 1P3OD 3AN2D 3KUYA 1EQZB 3B0CW 1P3GD 3MGPD 1Z2CB 3B6FD 4WU8B 3MNNB 3LZ1A 4YM6D 4UUZB 2AROB 5AV9B 1P34A 4KGCD 2XD1A 3WTPB 5BS7C 5CP6B 3B6GD 1KX5C 4J8VC 3X1SB 5JRGC 5C3IC 4R8PD 2BYMA 5BNVA 2AROC 3KXBD 1AOIB 5AY8B 5F99A 5CP6C 5AVBA 5BNXB 3WTPC 4AWLC 3AZGA 3X1SC 1P3BD 3TU4C 1P3AC 3W99B 3MGRB 1ZLAA 3REKA 1EQZD 3X1TA 3KWQD 1AOIC 4Z2MG 2F8NB 4JJNC 1P3LD 2L5AA 4WU8D 3MNND 5B2ID 4M6BA 3EG5B 2RVQD 1H3OA 4Z66D 1ID3C 4X23A 4J8XC 5DNMA 3WKJC 3B0CT 3AV1C 2PYOC 2ZY2A 3REIC 5AV9D 3AZMD 4WJ3C 5B1MB 1M19A 1JFIA 4KHAB 3C1BC 1F66B 3UT9C 3AZJD 2NQBA 3AYWB 3AZLD 3VH6W 1KU5A 3WAAD 2Y2PA 3X1VC 1S32C 3W99D 5GSUC 1M1AD 1U35B 3MVDB 2VQRA 3AYWC 2ZY5A 5BS7A 5B0ZD 5CPKB 4XZQC 5JRGA 4LD9B 5DNNC 3RELC 3AZFB 4NE5A 4H9QB 2AROA 3LZ0B 3A6ND 2FFFB 2F8NG 1F1EA 5CP6A 5B0YB 3WTPA 3X1SA 1F66D 3TU4A 3H0MC 5B31B 4LD9C 5CPID 3LELB 1M18B 1P3FD 1AOIA 5AY8A 1WWSA 4JJNA 4Z5TD 4YS3C 3MVDD 3MGRA 1ID3A 3WKJA 5B1LC 3VH6T 3WTPE 3AV1A 2PYOA 1M18C 1PZRA 4XUJD 2F8NA 2YFVA 3AV2C 2BYKB 5BT1D 3C1BA 5B2JC 3F6TA 3UT9A 1P3KB 5B33D 3AZFD 2Y2IA 2J8PA 3UTBC 3REJC 3W97B 5B1MA 1TZYD 1P3PD 3AZNB 3O62D 1ULYA 2BYMB 5B31D 5BNVB 2JE5A 1P3KC 3NQUB 4E44A 3AZIC 3AYWA 5CPJD 3UTAD 5AVBB 2G5HC 3KUYD 5B40B 4H9NA 3R45B 2Y2MA 1U35A 5G49A 3X1TB 4XZQA 5B31G 4ZUXC 4WZSB 5AV8B 5AV6C 2HIOC 1BH8A 4X23B 5DNMB 4J8UC 5CPKA 4G92C 4LD9A 3B0DC 3H0LC 1P34D 1W2EA 4H9QA 3VH5A 5AV5B 3LZ0A 5AV8C 5B0YA 2CV5C 2NZDB 5F99D 1TAFB 2XD5A 5AVBD 3LELA 4NE6A 1M18A 3AZGD 2Y2GA 5AV5C 1ZLAD 3REKD 3X1TD 2NZDC 4J8WC 1P3OC 3AN2C 3UTBA 3REJA 1KX5B 4J8VB 3MGPC 2BYKA 5JRGB 4X23D 5DNMD 2Y2LA 3W96C 5C3IB 4KUDC 3B6FC 1P3KA 1M19D 3AZIA 4YM6C 4AWLB 3W97A 3TU4B 3H0RC 1P3AB 3AZNA 2NQBD 4EO5B 4H9PB 1KX4C 3B6GC 3NQUA 4JJNB 2DQNC 4ZUXA 1B6WA 1HQ3B 5B40A 2UWXA 3R45A 5AV6A 4EO5C 1ID3B 3WKJB 4J8XB 1P3IB 4J8UA 3AV1B 2PYOB 1P3BC 3REIB 2YFVB 3C1CC 1HQ3C 3KWQC 3C1BB 5JRGD 5AV8A 3UT9B 1P3LC 2CV5A 1P3IC 2Y2JA 2AROD 5B2IC 2RVQC 5CP6D 3WTPD 3X1VB 3X1SD 5AV5A 3TU4D 5GSUB 4HGAC 1S32B 5B24B 3MGSC 2NZDA 2Y2NA 4J8WA 1KX3C 1AOID 5AY8D 4DQYB 4JJND 3NQJB 1BH9B 1TAFA 4H9NB 1WWIA 2BG1A 5G49B 4E45A 5B24C 3MGRD 3WAAC 4XZQB 1ID3D 3WKJD 5DNNB 3RELB 3W96A 5GXQC 3AV1D 2PYOD 4KUDA 1M1AC 2F8ND 5E5AB 3FDDA 1BH8B 3C1BD 1KX5A 4J8VA 3UT9D 3LJAB 3WA9B 1KX4A 5B1MD 3REHC 5E5AC 3AZKC 5AVCB 1P3AA 4YS3B 3A6NC 1P3MB 4H9PA 3AYWD 5B1LB 3LJAC 3WA9C 4H9RB 3AZEB 3C1CA 2YFWB 3AV2B 3EPJA 1HQ3A 5CPIC 5KDMA 5AVCC 2JCHA 1U35D 5B2JB 4XZQD 1P3FC 3VH5T 2ZM5A 2DF4C 1P3MC 4J8XA 1P3IA 3MGQB 3UTBB 3REJB 3REIA 3AZEC 4DRAA 2LY8A 3W98C 5CPKD 4XUJC 4LD9D 3MGSA 3AZIB 5BT1C 5B32C 1KX3A 3MGQC 3LZ0D 4QLCB 5B0YD 1T3UA 3X1VA 1S32A 5GSUA 5B24A 4ZBJC 5GT3C 5GXQA 3O62C 4ZUXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O B;  3NQJ A;  4QLC C;  1BH9 A;  5AV6 B;  2HIO B;  5CPJ C;  3UTA C;  4J8U B;  4G92 B;  3B0D B;  5DNN A;  3REL A;  3UTB D;  3AZH B;  3REJ D;  4DRB A;  3REH A;  5E5A A;  2CWE A;  3AZK A;  2CV5 B;  4WU9 C;  1P3K D;  5CHL B;  3LZ1 C;  3AZI D;  1R4V A;  3AZH C;  3LJA A;  3WA9 A;  3AFA B;  5GT0 C;  3W97 D;  3AZN D;  3X1U C;  5AVC A;  4J8W B;  4YS3 A;  1P3O B;  3AN2 B;  1P3M A;  1BFM A;  4ZUX D;  5B1L A;  2FJ7 C;  4CSR A;  3AFA C;  4H9R A;  5B40 D;  3AZE A;  5FUG A;  5AV6 D;  2YFW A;  3MGP B;  3AV2 A;  3W98 A;  4NFT A;  4J8U D;  3W96 B;  4KUD B;  5B2J A;  3AZG C;  3B6F B;  5B32 A;  4YM6 B;  3MGQ A;  5AV8 D;  1P3G C;  2HUE B;  2CV5 D;  4KGC B;  1KX4 B;  3B6G B;  5GT3 A;  5AV5 D;  4QLC A;  3KXB B;  2HUE C;  2NZD D;  4J8W D;  4KGC C;  1P3B B;  3C1C B;  2NQB C;  4H9S C;  4H9O A;  4R8P C;  5KDM B;  3KWQ B;  3KXB C;  2HIO A;  1P3L B;  3W96 D;  4KUD D;  4WU9 A;  5B2I B;  4Z66 B;  3AZH A;  1EQZ C;  5GT0 A;  4J8V D;  1KX5 D;  4HGA B;  3MGS B;  3AZM B;  3X1U A;  1KX4 D;  1KX3 B;  4WU8 C;  5BO0 B;  3MNN C;  4Z66 C;  3AZJ B;  2FJ7 A;  2JSS A;  3AFA A;  3AZL B;  1P3A D;  5AV9 C;  4WNN B;  3AZM C;  3WAA B;  3VH5 W;  5GXQ B;  1P3O A;  1M1A B;  3AN2 A;  3C1C D;  3AZJ C;  1HTA A;  1HQ3 D;  3AZL C;  5AY8 C;  1P3G A;  3MGP A;  4J8X D;  1P3I D;  3B6F A;  3W99 C;  4CAY B;  4Z2M H;  3REI D;  5B0Z B;  3MGR C;  3REH B;  4YM6 A;  3AZK B;  3MGS D;  3A6N B;  1KX3 D;  4KGC A;  3B6G A;  5B0Z C;  3X1V D;  1M18 D;  4H9S A;  1S32 D;  5GSU D;  4R8P A;  5CPI B;  5B24 D;  1P3F B;  3KXB A;  5B1M C;  1N1J A;  5GXQ D;  4Z5T B;  3KSY A;  4CSR B;  1P3B A;  1F66 C;  5FUG B;  1EQZ A;  3W98 B;  1Q9C A;  3V9R B;  3KWQ A;  4XUJ B;  5DNN D;  3REL D;  1P3L A;  4Z5T C;  5B32 B;  4WU8 A;  1U35 C;  3MNN A;  5B2I A;  3REH D;  5E5A D;  4Z66 A;  3MVD C;  4UUZ A;  5B33 B;  3AZK D;  5AV9 A;  3AZM A;  1TZY B;  1P3P B;  4ZBJ B;  5GT3 B;  3LJA D;  3WA9 D;  3O62 B;  5BO0 A;  5CPK C;  2F8N H;  3AZJ A;  2F8N K;  5JA4 B;  5B33 C;  3AZF C;  5AVC D;  3AZL A;  5CPJ B;  4YS3 D;  3LZ0 C;  3UTA B;  3KUY B;  1P3M D;  4WNN A;  2IO5 B;  3WAA A;  1TZY C;  5B1L D;  4G91 B;  5BNX A;  5B0Y C;  1P3P C;  3W99 A;  3AZE D;  1M1A A;  5B31 C;  3AV2 D;  3W98 D;  3LEL C;  4WV4 B;  5B2J D;  3KUY C;  4WU9 B;  2IO5 C;  3LZ1 B;  4G91 C;  5B32 D;  3MGQ D;  4CAY A;  1B67 A;  5GT0 B;  5B0Z A;  1P34 B;  3X1U B;  3A6N A;  5GT3 D;  2FJ7 B;  4KHA A;  5B32 G;  4QLC D;  1F66 A;  5F99 B;  1P34 C;  5CPI A;  1P3F A;  3AZG B;  3W97 C;  3AZN C;  4Z5T A;  1ZLA B;  3REK B;  3MVD A;  1P3G B;  2HIO D;  5F99 C;  5AVB C;  3V9R A;  4WU9 D;  4XUJ A;  3LZ1 D;  5B40 C;  1A7W A;  4NE3 A;  1H3O B;  3AZH D;  1ZLA C;  3REK C;  5GT0 D;  3X1T C;  5B33 A;  1M19 B;  3X1U D;  3AZF A;  1JFI B;  3LEL D;  3VH6 A;  1TZY A;  1P3P A;  2FJ7 D;  4X23 C;  2NQB B;  5DNM C;  3O62 A;  3AFA D;  4R8P B;  5B31 A;  5JA4 A;  1N1J B;  1M19 C;  5CPJ A;  3B0B A;  3UTA A;  1P3O D;  3AN2 D;  3KUY A;  1EQZ B;  3B0C W;  1P3G D;  3MGP D;  3B6F D;  4WU8 B;  3MNN B;  3LZ1 A;  4YM6 D;  4UUZ B;  2ARO B;  5AV9 B;  1P34 A;  4KGC D;  5BS7 C;  3WTP B;  5CP6 B;  3B6G D;  1KX5 C;  4J8V C;  3X1S B;  5JRG C;  5C3I C;  4R8P D;  2BYM A;  5BNV A;  2ARO C;  3KXB D;  1AOI B;  5AY8 B;  5F99 A;  5CP6 C;  3WTP C;  5AVB A;  5BNX B;  4AWL C;  3AZG A;  3X1S C;  1P3B D;  3TU4 C;  1P3A C;  3W99 B;  3MGR B;  1ZLA A;  3REK A;  1EQZ D;  3X1T A;  3KWQ D;  1AOI C;  4Z2M G;  2F8N B;  4JJN C;  1P3L D;  2L5A A;  4WU8 D;  3MNN D;  4M6B A;  5B2I D;  2RVQ D;  1H3O A;  4Z66 D;  1ID3 C;  4X23 A;  4J8X C;  5DNM A;  3WKJ C;  3B0C T;  3AV1 C;  2PYO C;  3REI C;  5AV9 D;  3AZM D;  5B1M B;  1M19 A;  1JFI A;  4KHA B;  3C1B C;  1F66 B;  3UT9 C;  3AZJ D;  2NQB A;  3AYW B;  3AZL D;  3VH6 W;  1KU5 A;  3WAA D;  3X1V C;  1S32 C;  3W99 D;  5GSU C;  1M1A D;  1U35 B;  3MVD B;  3AYW C;  5BS7 A;  5B0Z D;  5CPK B;  4XZQ C;  5JRG A;  4LD9 B;  5DNN C;  3REL C;  3AZF B;  4NE5 A;  4H9Q B;  2ARO A;  3LZ0 B;  3A6N D;  2F8N G;  1F1E A;  5CP6 A;  5B0Y B;  3WTP A;  3X1S A;  1F66 D;  3TU4 A;  5B31 B;  4LD9 C;  5CPI D;  3LEL B;  1M18 B;  1P3F D;  1AOI A;  5AY8 A;  1WWS A;  4JJN A;  4Z5T D;  4YS3 C;  3MVD D;  3MGR A;  1ID3 A;  3WKJ A;  5B1L C;  3VH6 T;  3WTP E;  3AV1 A;  2PYO A;  1M18 C;  4XUJ D;  2F8N A;  2YFV A;  3AV2 C;  2BYK B;  5BT1 D;  3C1B A;  5B2J C;  3UT9 A;  1P3K B;  5B33 D;  3AZF D;  3UTB C;  3REJ C;  3W97 B;  5B1M A;  1TZY D;  1P3P D;  3AZN B;  3O62 D;  1ULY A;  2BYM B;  5B31 D;  5BNV B;  1P3K C;  3NQU B;  4E44 A;  3AZI C;  3AYW A;  5CPJ D;  3UTA D;  5AVB B;  3KUY D;  5B40 B;  4H9N A;  3R45 B;  1U35 A;  5G49 A;  3X1T B;  4XZQ A;  5B31 G;  4ZUX C;  4WZS B;  5AV8 B;  5AV6 C;  2HIO C;  1BH8 A;  4X23 B;  5DNM B;  4J8U C;  5CPK A;  4G92 C;  4LD9 A;  3B0D C;  1P34 D;  4H9Q A;  3VH5 A;  5AV5 B;  3LZ0 A;  5AV8 C;  5B0Y A;  2CV5 C;  2NZD B;  5F99 D;  1TAF B;  5AVB D;  3LEL A;  4NE6 A;  1M18 A;  3AZG D;  5AV5 C;  1ZLA D;  3REK D;  3X1T D;  2NZD C;  4J8W C;  1P3O C;  3AN2 C;  3UTB A;  3REJ A;  1KX5 B;  4J8V B;  3MGP C;  2BYK A;  5JRG B;  4X23 D;  5DNM D;  3W96 C;  5C3I B;  4KUD C;  3B6F C;  1P3K A;  1M19 D;  3AZI A;  4YM6 C;  4AWL B;  3W97 A;  3TU4 B;  1P3A B;  3AZN A;  2NQB D;  4EO5 B;  4H9P B;  1KX4 C;  3B6G C;  3NQU A;  4JJN B;  4ZUX A;  1B6W A;  1HQ3 B;  5B40 A;  3R45 A;  5AV6 A;  4EO5 C;  1ID3 B;  3WKJ B;  4J8X B;  1P3I B;  4J8U A;  3AV1 B;  2PYO B;  1P3B C;  3REI B;  2YFV B;  3C1C C;  1HQ3 C;  3KWQ C;  3C1B B;  5JRG D;  5AV8 A;  3UT9 B;  1P3L C;  2CV5 A;  1P3I C;  2ARO D;  5B2I C;  2RVQ C;  5CP6 D;  3WTP D;  3X1V B;  3X1S D;  5AV5 A;  3TU4 D;  5GSU B;  4HGA C;  1S32 B;  5B24 B;  3MGS C;  2NZD A;  4J8W A;  1KX3 C;  1AOI D;  5AY8 D;  4JJN D;  3NQJ B;  1BH9 B;  1TAF A;  4H9N B;  1WWI A;  5G49 B;  4E45 A;  5B24 C;  3MGR D;  3WAA C;  4XZQ B;  1ID3 D;  3WKJ D;  5DNN B;  3REL B;  3W96 A;  5GXQ C;  3AV1 D;  2PYO D;  4KUD A;  1M1A C;  2F8N D;  5E5A B;  3C1B D;  1BH8 B;  1KX5 A;  4J8V A;  3UT9 D;  3LJA B;  3WA9 B;  1KX4 A;  5B1M D;  3REH C;  5E5A C;  3AZK C;  5AVC B;  1P3A A;  4YS3 B;  3A6N C;  1P3M B;  4H9P A;  3AYW D;  5B1L B;  3LJA C;  3WA9 C;  4H9R B;  3AZE B;  3C1C A;  2YFW B;  3AV2 B;  1HQ3 A;  5CPI C;  5KDM A;  5AVC C;  1U35 D;  5B2J B;  4XZQ D;  1P3F C;  3VH5 T;  1P3M C;  4J8X A;  1P3I A;  3MGQ B;  3UTB B;  3REJ B;  3REI A;  3AZE C;  4DRA A;  2LY8 A;  3W98 C;  5CPK D;  4XUJ C;  4LD9 D;  3MGS A;  3AZI B;  5BT1 C;  5B32 C;  1KX3 A;  3MGQ C;  3LZ0 D;  4QLC B;  5B0Y D;  3X1V A;  1S32 A;  5GSU A;  5B24 A;  4ZBJ C;  5GT3 C;  5GXQ A;  3O62 C;  4ZUX B; 
#chains in the Genus database with same CATH topology
 4H9O B;  3NQJ A;  4QLC C;  1BH9 A;  5AV6 B;  2HIO B;  5CPJ C;  3UTA C;  4J8U B;  4G92 B;  3B0D B;  5DNN A;  3REL A;  3UTB D;  3AZH B;  3REJ D;  4DRB A;  3REH A;  5E5A A;  2CWE A;  3AZK A;  2CV5 B;  3KFU G;  4WU9 C;  1P3K D;  5CHL B;  3LZ1 C;  3AZI D;  1R4V A;  3AZH C;  3LJA A;  3WA9 A;  3A1K A;  3AFA B;  5GT0 C;  3W97 D;  3AZN D;  3X1U C;  5AVC A;  4J8W B;  4YS3 A;  1P3O B;  3AN2 B;  1P3M A;  1BFM A;  4ZUX D;  5B1L A;  2FJ7 C;  4CSR A;  3AFA C;  4H9R A;  5B40 D;  3AZE A;  5FUG A;  5AV6 D;  2YFW A;  3MGP B;  3AV2 A;  3W98 A;  2Y2Q A;  4NFT A;  4J8U D;  3W96 B;  4KUD B;  5B2J A;  3AZG C;  3B6F B;  5B32 A;  4YM6 B;  3MGQ A;  5AV8 D;  1P3G C;  2HUE B;  2CV5 D;  3IP4 C;  4KGC B;  1KX4 B;  3B6G B;  2F2A C;  5GT3 A;  5AV5 D;  4QLC A;  3KXB B;  2HUE C;  2NZD D;  4J8W D;  4KGC C;  1P3B B;  2Y2K A;  3C1C B;  2NQB C;  4H9S C;  4H9O A;  4R8P C;  5KDM B;  3KWQ B;  3KXB C;  2HIO A;  1P3L B;  3W96 D;  4KUD D;  4WU9 A;  2G5I C;  5B2I B;  4Z66 B;  3AZH A;  1EQZ C;  5GT0 A;  4J8V D;  1KX5 D;  4HGA B;  2ZY3 A;  3MGS B;  3AZM B;  3X1U A;  1KX4 D;  1KX3 B;  4WU8 C;  5BO0 B;  3MNN C;  3P5J B;  2Y2O A;  4Z66 C;  3AZJ B;  2FJ7 A;  2JSS A;  3AFA A;  3AZL B;  1P3A D;  5AV9 C;  4WNN B;  3AZM C;  3WAA B;  3VH5 W;  5GXQ B;  1P3O A;  1M1A B;  3AN2 A;  3C1C D;  3AZJ C;  1HTA A;  1HQ3 D;  3AZL C;  3EPK A;  5AY8 C;  1P3G A;  3MGP A;  4J8X D;  1P3I D;  3B6F A;  3W99 C;  4CAY B;  4Z2M H;  3REI D;  5B0Z B;  3MGR C;  3REH B;  4YM6 A;  3AZK B;  3MGS D;  3A6N B;  1KX3 D;  2W8S A;  4KGC A;  3B6G A;  5B0Z C;  3X1V D;  1M18 D;  4H9S A;  1S32 D;  5GSU D;  4R8P A;  5CPI B;  5B24 D;  1P3F B;  3KXB A;  5B1M C;  1N1J A;  5GXQ D;  4Z5T B;  4UPK A;  3KSY A;  4CSR B;  1P3B A;  1F66 C;  5FUG B;  1EQZ A;  3W98 B;  1Q9C A;  3V9R B;  3KWQ A;  4XUJ B;  2Y2H A;  5DNN D;  3REL D;  4Z5T C;  1P3L A;  5B32 B;  4WU8 A;  1U35 C;  3MNN A;  5B2I A;  3REH D;  5E5A D;  4Z66 A;  3MVD C;  4UUZ A;  5B33 B;  3AZK D;  3EPH A;  5AV9 A;  3AZM A;  1TZY B;  1P3P B;  4ZBJ B;  5GT3 B;  3LJA D;  3WA9 D;  3O62 B;  5BO0 A;  5CPK C;  2F8N H;  3AZJ A;  2F8N K;  5JA4 B;  5B33 C;  3AZF C;  5AVC D;  3AZL A;  5CPJ B;  4YS3 D;  3LZ0 C;  3UTA B;  3KUY B;  1P3M D;  4WNN A;  2IO5 B;  3WAA A;  1TZY C;  5B1L D;  4G91 B;  5BNX A;  5B0Y C;  1P3P C;  3W99 A;  3AZE D;  1M1A A;  5B31 C;  3AV2 D;  3W98 D;  3LEL C;  4WV4 B;  5B2J D;  3KUY C;  4WU9 B;  2IO5 C;  3LZ1 B;  4G91 C;  5B32 D;  3MGQ D;  4CAY A;  1B67 A;  5GT0 B;  5B0Z A;  1P34 B;  3X1U B;  3A6N A;  5GT3 D;  3A1I A;  2FJ7 B;  4KHA A;  5B32 G;  4QLC D;  1F66 A;  5F99 B;  1P34 C;  5CPI A;  1P3F A;  3AZG B;  3W97 C;  3AL0 C;  3AZN C;  4Z5T A;  1ZLA B;  3REK B;  3MVD A;  1P3G B;  2HIO D;  5F99 C;  2RIQ A;  5AVB C;  3V9R A;  4WU9 D;  4XUJ A;  3LZ1 D;  5B40 C;  1A7W A;  4NE3 A;  1H3O B;  3AZH D;  2ZY4 A;  1ZLA C;  3REK C;  5GT0 D;  3X1T C;  5B33 A;  1M19 B;  3X1U D;  3AZF A;  1JFI B;  3LEL D;  3VH6 A;  3EPL A;  1TZY A;  1P3P A;  2FJ7 D;  4X23 C;  2NQB B;  5DNM C;  3O62 A;  3AFA D;  4R8P B;  5B31 A;  5JA4 A;  1N1J B;  1M19 C;  5CPJ A;  3B0B A;  3UTA A;  1P3O D;  3AN2 D;  3KUY A;  1EQZ B;  3B0C W;  1P3G D;  3MGP D;  1Z2C B;  3B6F D;  4WU8 B;  3MNN B;  3LZ1 A;  4YM6 D;  4UUZ B;  2ARO B;  5AV9 B;  1P34 A;  4KGC D;  2XD1 A;  3WTP B;  5BS7 C;  5CP6 B;  3B6G D;  1KX5 C;  4J8V C;  3X1S B;  5JRG C;  5C3I C;  4R8P D;  2BYM A;  5BNV A;  2ARO C;  3KXB D;  1AOI B;  5AY8 B;  5F99 A;  5CP6 C;  5AVB A;  5BNX B;  3WTP C;  4AWL C;  3AZG A;  3X1S C;  1P3B D;  3TU4 C;  1P3A C;  3W99 B;  3MGR B;  1ZLA A;  3REK A;  1EQZ D;  3X1T A;  3KWQ D;  1AOI C;  4Z2M G;  2F8N B;  4JJN C;  1P3L D;  2L5A A;  4WU8 D;  3MNN D;  5B2I D;  4M6B A;  3EG5 B;  2RVQ D;  1H3O A;  4Z66 D;  1ID3 C;  4X23 A;  4J8X C;  5DNM A;  3WKJ C;  3B0C T;  3AV1 C;  2PYO C;  2ZY2 A;  3REI C;  5AV9 D;  3AZM D;  4WJ3 C;  5B1M B;  1M19 A;  1JFI A;  4KHA B;  3C1B C;  1F66 B;  3UT9 C;  3AZJ D;  2NQB A;  3AYW B;  3AZL D;  3VH6 W;  1KU5 A;  3WAA D;  2Y2P A;  3X1V C;  1S32 C;  3W99 D;  5GSU C;  1M1A D;  1U35 B;  3MVD B;  2VQR A;  3AYW C;  2ZY5 A;  5BS7 A;  5B0Z D;  5CPK B;  4XZQ C;  5JRG A;  4LD9 B;  5DNN C;  3REL C;  3AZF B;  4NE5 A;  4H9Q B;  2ARO A;  3LZ0 B;  3A6N D;  2FFF B;  2F8N G;  1F1E A;  5CP6 A;  5B0Y B;  3WTP A;  3X1S A;  1F66 D;  3TU4 A;  3H0M C;  5B31 B;  4LD9 C;  5CPI D;  3LEL B;  1M18 B;  1P3F D;  1AOI A;  5AY8 A;  1WWS A;  4JJN A;  4Z5T D;  4YS3 C;  3MVD D;  3MGR A;  1ID3 A;  3WKJ A;  5B1L C;  3VH6 T;  3WTP E;  3AV1 A;  2PYO A;  1M18 C;  1PZR A;  4XUJ D;  2F8N A;  2YFV A;  3AV2 C;  2BYK B;  5BT1 D;  3C1B A;  5B2J C;  3F6T A;  3UT9 A;  1P3K B;  5B33 D;  3AZF D;  2Y2I A;  2J8P A;  3UTB C;  3REJ C;  3W97 B;  5B1M A;  1TZY D;  1P3P D;  3AZN B;  3O62 D;  1ULY A;  2BYM B;  5B31 D;  5BNV B;  2JE5 A;  1P3K C;  3NQU B;  4E44 A;  3AZI C;  3AYW A;  5CPJ D;  3UTA D;  5AVB B;  2G5H C;  3KUY D;  5B40 B;  4H9N A;  3R45 B;  2Y2M A;  1U35 A;  5G49 A;  3X1T B;  4XZQ A;  5B31 G;  4ZUX C;  4WZS B;  5AV8 B;  5AV6 C;  2HIO C;  1BH8 A;  4X23 B;  5DNM B;  4J8U C;  5CPK A;  4G92 C;  4LD9 A;  3B0D C;  3H0L C;  1P34 D;  1W2E A;  4H9Q A;  3VH5 A;  5AV5 B;  3LZ0 A;  5AV8 C;  5B0Y A;  2CV5 C;  2NZD B;  5F99 D;  1TAF B;  2XD5 A;  5AVB D;  3LEL A;  4NE6 A;  1M18 A;  3AZG D;  2Y2G A;  5AV5 C;  1ZLA D;  3REK D;  3X1T D;  2NZD C;  4J8W C;  1P3O C;  3AN2 C;  3UTB A;  3REJ A;  1KX5 B;  4J8V B;  3MGP C;  2BYK A;  5JRG B;  4X23 D;  5DNM D;  2Y2L A;  3W96 C;  5C3I B;  4KUD C;  3B6F C;  1P3K A;  1M19 D;  3AZI A;  4YM6 C;  4AWL B;  3W97 A;  3TU4 B;  3H0R C;  1P3A B;  3AZN A;  2NQB D;  4EO5 B;  4H9P B;  1KX4 C;  3B6G C;  3NQU A;  4JJN B;  2DQN C;  4ZUX A;  1B6W A;  1HQ3 B;  5B40 A;  2UWX A;  3R45 A;  5AV6 A;  4EO5 C;  1ID3 B;  3WKJ B;  4J8X B;  1P3I B;  4J8U A;  3AV1 B;  2PYO B;  1P3B C;  3REI B;  2YFV B;  3C1C C;  1HQ3 C;  3KWQ C;  3C1B B;  5JRG D;  5AV8 A;  3UT9 B;  1P3L C;  2CV5 A;  1P3I C;  2Y2J A;  2ARO D;  5B2I C;  2RVQ C;  5CP6 D;  3WTP D;  3X1V B;  3X1S D;  5AV5 A;  3TU4 D;  5GSU B;  4HGA C;  1S32 B;  5B24 B;  3MGS C;  2NZD A;  2Y2N A;  4J8W A;  1KX3 C;  1AOI D;  5AY8 D;  4DQY B;  4JJN D;  3NQJ B;  1BH9 B;  1TAF A;  4H9N B;  1WWI A;  2BG1 A;  5G49 B;  4E45 A;  5B24 C;  3MGR D;  3WAA C;  4XZQ B;  1ID3 D;  3WKJ D;  5DNN B;  3REL B;  3W96 A;  5GXQ C;  3AV1 D;  2PYO D;  4KUD A;  1M1A C;  2F8N D;  5E5A B;  3FDD A;  1BH8 B;  3C1B D;  1KX5 A;  4J8V A;  3UT9 D;  3LJA B;  3WA9 B;  1KX4 A;  5B1M D;  3REH C;  5E5A C;  3AZK C;  5AVC B;  1P3A A;  4YS3 B;  3A6N C;  1P3M B;  4H9P A;  3AYW D;  5B1L B;  3LJA C;  3WA9 C;  4H9R B;  3AZE B;  3C1C A;  2YFW B;  3AV2 B;  3EPJ A;  1HQ3 A;  5CPI C;  5KDM A;  5AVC C;  2JCH A;  1U35 D;  5B2J B;  4XZQ D;  1P3F C;  3VH5 T;  2ZM5 A;  2DF4 C;  1P3M C;  4J8X A;  1P3I A;  3MGQ B;  3UTB B;  3REJ B;  3REI A;  3AZE C;  4DRA A;  2LY8 A;  3W98 C;  5CPK D;  4XUJ C;  4LD9 D;  3MGS A;  3AZI B;  5BT1 C;  5B32 C;  1KX3 A;  3MGQ C;  3LZ0 D;  4QLC B;  5B0Y D;  1T3U A;  3X1V A;  1S32 A;  5GSU A;  5B24 A;  4ZBJ C;  5GT3 C;  5GXQ A;  3O62 C;  4ZUX B; 
#chains in the Genus database with same CATH homology
 4H9O B;  3NQJ A;  4QLC C;  1BH9 A;  5AV6 B;  2HIO B;  5CPJ C;  3UTA C;  4J8U B;  4G92 B;  3B0D B;  5DNN A;  3REL A;  3UTB D;  3AZH B;  3REJ D;  4DRB A;  3REH A;  5E5A A;  2CWE A;  3AZK A;  2CV5 B;  3KFU G;  4WU9 C;  1P3K D;  5CHL B;  3LZ1 C;  3AZI D;  1R4V A;  3AZH C;  3LJA A;  3WA9 A;  3A1K A;  3AFA B;  5GT0 C;  3W97 D;  3AZN D;  3X1U C;  5AVC A;  4J8W B;  4YS3 A;  1P3O B;  3AN2 B;  1P3M A;  1BFM A;  4ZUX D;  5B1L A;  2FJ7 C;  4CSR A;  3AFA C;  4H9R A;  5B40 D;  3AZE A;  5FUG A;  5AV6 D;  2YFW A;  3MGP B;  3AV2 A;  3W98 A;  2Y2Q A;  4NFT A;  4J8U D;  3W96 B;  4KUD B;  5B2J A;  3AZG C;  3B6F B;  5B32 A;  4YM6 B;  3MGQ A;  5AV8 D;  1P3G C;  2HUE B;  2CV5 D;  3IP4 C;  4KGC B;  1KX4 B;  3B6G B;  2F2A C;  5GT3 A;  5AV5 D;  4QLC A;  3KXB B;  2HUE C;  2NZD D;  4J8W D;  4KGC C;  1P3B B;  2Y2K A;  3C1C B;  2NQB C;  4H9S C;  4H9O A;  4R8P C;  5KDM B;  3KWQ B;  3KXB C;  2HIO A;  1P3L B;  3W96 D;  4KUD D;  4WU9 A;  2G5I C;  5B2I B;  4Z66 B;  3AZH A;  1EQZ C;  5GT0 A;  4J8V D;  1KX5 D;  4HGA B;  2ZY3 A;  3MGS B;  3AZM B;  3X1U A;  1KX4 D;  1KX3 B;  4WU8 C;  5BO0 B;  3MNN C;  3P5J B;  2Y2O A;  4Z66 C;  3AZJ B;  2FJ7 A;  2JSS A;  3AFA A;  3AZL B;  1P3A D;  5AV9 C;  4WNN B;  3AZM C;  3WAA B;  3VH5 W;  5GXQ B;  1P3O A;  1M1A B;  3AN2 A;  3C1C D;  3AZJ C;  1HTA A;  1HQ3 D;  3AZL C;  3EPK A;  5AY8 C;  1P3G A;  3MGP A;  4J8X D;  1P3I D;  3B6F A;  3W99 C;  4CAY B;  4Z2M H;  3REI D;  5B0Z B;  3MGR C;  3REH B;  4YM6 A;  3AZK B;  3MGS D;  3A6N B;  1KX3 D;  2W8S A;  4KGC A;  3B6G A;  5B0Z C;  3X1V D;  1M18 D;  4H9S A;  1S32 D;  5GSU D;  4R8P A;  5CPI B;  5B24 D;  1P3F B;  3KXB A;  5B1M C;  1N1J A;  5GXQ D;  4Z5T B;  4UPK A;  3KSY A;  4CSR B;  1P3B A;  1F66 C;  5FUG B;  1EQZ A;  3W98 B;  1Q9C A;  3V9R B;  3KWQ A;  4XUJ B;  2Y2H A;  5DNN D;  3REL D;  4Z5T C;  1P3L A;  5B32 B;  4WU8 A;  1U35 C;  3MNN A;  5B2I A;  3REH D;  5E5A D;  4Z66 A;  3MVD C;  4UUZ A;  5B33 B;  3AZK D;  3EPH A;  5AV9 A;  3AZM A;  1TZY B;  1P3P B;  4ZBJ B;  5GT3 B;  3LJA D;  3WA9 D;  3O62 B;  5BO0 A;  5CPK C;  2F8N H;  3AZJ A;  2F8N K;  5JA4 B;  5B33 C;  3AZF C;  5AVC D;  3AZL A;  5CPJ B;  4YS3 D;  3LZ0 C;  3UTA B;  3KUY B;  1P3M D;  4WNN A;  2IO5 B;  3WAA A;  1TZY C;  5B1L D;  4G91 B;  5BNX A;  5B0Y C;  1P3P C;  3W99 A;  3AZE D;  1M1A A;  5B31 C;  3AV2 D;  3W98 D;  3LEL C;  4WV4 B;  5B2J D;  3KUY C;  4WU9 B;  2IO5 C;  3LZ1 B;  4G91 C;  5B32 D;  3MGQ D;  4CAY A;  1B67 A;  5GT0 B;  5B0Z A;  1P34 B;  3X1U B;  3A6N A;  5GT3 D;  3A1I A;  2FJ7 B;  4KHA A;  5B32 G;  4QLC D;  1F66 A;  5F99 B;  1P34 C;  5CPI A;  1P3F A;  3AZG B;  3W97 C;  3AL0 C;  3AZN C;  4Z5T A;  1ZLA B;  3REK B;  3MVD A;  1P3G B;  2HIO D;  5F99 C;  2RIQ A;  5AVB C;  3V9R A;  4WU9 D;  4XUJ A;  3LZ1 D;  5B40 C;  1A7W A;  4NE3 A;  1H3O B;  3AZH D;  2ZY4 A;  1ZLA C;  3REK C;  5GT0 D;  3X1T C;  5B33 A;  1M19 B;  3X1U D;  3AZF A;  1JFI B;  3LEL D;  3VH6 A;  3EPL A;  1TZY A;  1P3P A;  2FJ7 D;  4X23 C;  2NQB B;  5DNM C;  3O62 A;  3AFA D;  4R8P B;  5B31 A;  5JA4 A;  1N1J B;  1M19 C;  5CPJ A;  3B0B A;  3UTA A;  1P3O D;  3AN2 D;  3KUY A;  1EQZ B;  3B0C W;  1P3G D;  3MGP D;  1Z2C B;  3B6F D;  4WU8 B;  3MNN B;  3LZ1 A;  4YM6 D;  4UUZ B;  2ARO B;  5AV9 B;  1P34 A;  4KGC D;  2XD1 A;  3WTP B;  5BS7 C;  5CP6 B;  3B6G D;  1KX5 C;  4J8V C;  3X1S B;  5JRG C;  5C3I C;  4R8P D;  2BYM A;  5BNV A;  2ARO C;  3KXB D;  1AOI B;  5AY8 B;  5F99 A;  5CP6 C;  5AVB A;  5BNX B;  3WTP C;  4AWL C;  3AZG A;  3X1S C;  1P3B D;  3TU4 C;  1P3A C;  3W99 B;  3MGR B;  1ZLA A;  3REK A;  1EQZ D;  3X1T A;  3KWQ D;  1AOI C;  4Z2M G;  2F8N B;  4JJN C;  1P3L D;  2L5A A;  4WU8 D;  3MNN D;  5B2I D;  4M6B A;  3EG5 B;  2RVQ D;  1H3O A;  4Z66 D;  1ID3 C;  4X23 A;  4J8X C;  5DNM A;  3WKJ C;  3B0C T;  3AV1 C;  2PYO C;  2ZY2 A;  3REI C;  5AV9 D;  3AZM D;  4WJ3 C;  5B1M B;  1M19 A;  1JFI A;  4KHA B;  3C1B C;  1F66 B;  3UT9 C;  3AZJ D;  2NQB A;  3AYW B;  3AZL D;  3VH6 W;  1KU5 A;  3WAA D;  2Y2P A;  3X1V C;  1S32 C;  3W99 D;  5GSU C;  1M1A D;  1U35 B;  3MVD B;  2VQR A;  3AYW C;  2ZY5 A;  5BS7 A;  5B0Z D;  5CPK B;  4XZQ C;  5JRG A;  4LD9 B;  5DNN C;  3REL C;  3AZF B;  4NE5 A;  4H9Q B;  2ARO A;  3LZ0 B;  3A6N D;  2FFF B;  2F8N G;  1F1E A;  5CP6 A;  5B0Y B;  3WTP A;  3X1S A;  1F66 D;  3TU4 A;  3H0M C;  5B31 B;  4LD9 C;  5CPI D;  3LEL B;  1M18 B;  1P3F D;  1AOI A;  5AY8 A;  1WWS A;  4JJN A;  4Z5T D;  4YS3 C;  3MVD D;  3MGR A;  1ID3 A;  3WKJ A;  5B1L C;  3VH6 T;  3WTP E;  3AV1 A;  2PYO A;  1M18 C;  1PZR A;  4XUJ D;  2F8N A;  2YFV A;  3AV2 C;  2BYK B;  5BT1 D;  3C1B A;  5B2J C;  3F6T A;  3UT9 A;  1P3K B;  5B33 D;  3AZF D;  2Y2I A;  2J8P A;  3UTB C;  3REJ C;  3W97 B;  5B1M A;  1TZY D;  1P3P D;  3AZN B;  3O62 D;  1ULY A;  2BYM B;  5B31 D;  5BNV B;  2JE5 A;  1P3K C;  3NQU B;  4E44 A;  3AZI C;  3AYW A;  5CPJ D;  3UTA D;  5AVB B;  2G5H C;  3KUY D;  5B40 B;  4H9N A;  3R45 B;  2Y2M A;  1U35 A;  5G49 A;  3X1T B;  4XZQ A;  5B31 G;  4ZUX C;  4WZS B;  5AV8 B;  5AV6 C;  2HIO C;  1BH8 A;  4X23 B;  5DNM B;  4J8U C;  5CPK A;  4G92 C;  4LD9 A;  3B0D C;  3H0L C;  1P34 D;  1W2E A;  4H9Q A;  3VH5 A;  5AV5 B;  3LZ0 A;  5AV8 C;  5B0Y A;  2CV5 C;  2NZD B;  5F99 D;  1TAF B;  2XD5 A;  5AVB D;  3LEL A;  4NE6 A;  1M18 A;  3AZG D;  2Y2G A;  5AV5 C;  1ZLA D;  3REK D;  3X1T D;  2NZD C;  4J8W C;  1P3O C;  3AN2 C;  3UTB A;  3REJ A;  1KX5 B;  4J8V B;  3MGP C;  2BYK A;  5JRG B;  4X23 D;  5DNM D;  2Y2L A;  3W96 C;  5C3I B;  4KUD C;  3B6F C;  1P3K A;  1M19 D;  3AZI A;  4YM6 C;  4AWL B;  3W97 A;  3TU4 B;  3H0R C;  1P3A B;  3AZN A;  2NQB D;  4EO5 B;  4H9P B;  1KX4 C;  3B6G C;  3NQU A;  4JJN B;  2DQN C;  4ZUX A;  1B6W A;  1HQ3 B;  5B40 A;  2UWX A;  3R45 A;  5AV6 A;  4EO5 C;  1ID3 B;  3WKJ B;  4J8X B;  1P3I B;  4J8U A;  3AV1 B;  2PYO B;  1P3B C;  3REI B;  2YFV B;  3C1C C;  1HQ3 C;  3KWQ C;  3C1B B;  5JRG D;  5AV8 A;  3UT9 B;  1P3L C;  2CV5 A;  1P3I C;  2Y2J A;  2ARO D;  5B2I C;  2RVQ C;  5CP6 D;  3WTP D;  3X1V B;  3X1S D;  5AV5 A;  3TU4 D;  5GSU B;  4HGA C;  1S32 B;  5B24 B;  3MGS C;  2NZD A;  2Y2N A;  4J8W A;  1KX3 C;  1AOI D;  5AY8 D;  4DQY B;  4JJN D;  3NQJ B;  1BH9 B;  1TAF A;  4H9N B;  1WWI A;  2BG1 A;  5G49 B;  4E45 A;  5B24 C;  3MGR D;  3WAA C;  4XZQ B;  1ID3 D;  3WKJ D;  5DNN B;  3REL B;  3W96 A;  5GXQ C;  3AV1 D;  2PYO D;  4KUD A;  1M1A C;  2F8N D;  5E5A B;  3FDD A;  1BH8 B;  3C1B D;  1KX5 A;  4J8V A;  3UT9 D;  3LJA B;  3WA9 B;  1KX4 A;  5B1M D;  3REH C;  5E5A C;  3AZK C;  5AVC B;  1P3A A;  4YS3 B;  3A6N C;  1P3M B;  4H9P A;  3AYW D;  5B1L B;  3LJA C;  3WA9 C;  4H9R B;  3AZE B;  3C1C A;  2YFW B;  3AV2 B;  3EPJ A;  1HQ3 A;  5CPI C;  5KDM A;  5AVC C;  2JCH A;  1U35 D;  5B2J B;  4XZQ D;  1P3F C;  3VH5 T;  2ZM5 A;  2DF4 C;  1P3M C;  4J8X A;  1P3I A;  3MGQ B;  3UTB B;  3REJ B;  3REI A;  3AZE C;  4DRA A;  2LY8 A;  3W98 C;  5CPK D;  4XUJ C;  4LD9 D;  3MGS A;  3AZI B;  5BT1 C;  5B32 C;  1KX3 A;  3MGQ C;  3LZ0 D;  4QLC B;  5B0Y D;  1T3U A;  3X1V A;  1S32 A;  5GSU A;  5B24 A;  4ZBJ C;  5GT3 C;  5GXQ A;  3O62 C;  4ZUX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...