3REJD

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejD00
4EO5B 3X1VB 5GT0D 3RELB 1EQZA 5G49B 1P3KB 1P3OB 1P3BB 5GXQC 3LZ1B 3AN2D 5AY8C 2RVQC 3C1BD 3MGPA 1U35A 1P3AB 3WA9B 3W99D 3AZFB 2BYKA 1BFMA 1P3MC 5FUGA 3VH6T 5BS7C 3NQJB 2AROD 3A6ND 1TAFA 4KGCC 5GT3C 3AZJB 1P3FC 3VH5W 5DNMC 1TZYB 3KWQA 5GSUC 3X1VD 4Z5TB 3VH5A 3X1TD 2NQBD 3O62B 3WAAA 1P3KD 3LZ1D 1M18B 3AV1B 2FJ7A 5B24C 3AZHC 3AZFD 3AZIA 4J8XA 3WKJC 4R8PC 5JRGA 3LZ0B 4E44A 3KXBB 3W97B 4WV4B 5B2JD 3B6FB 5C3IB 4LD9C 5AV5C 5B1LA 5AVCB 4XZQB 4Z66C 4NE5A 3AZJD 3WTPA 4J8WA 1S32B 1M19D 2PYOA 1P3PB 5CPKD 5AV8D 4YM6D 3W98A 5GXQB 5AY8B 1P3LC 3UT9D 5B40C 1AOIA 5GT0C 5KDMB 4JJNA 4WU8A 3AN2C 3MGPD 1U35D 2HUEC 3C1BC 2JSSA 4X23C 1KX5A 3AV2A 2F8NB 3W99C 3NQUB 4KGCB 1P3FB 5DNMB 3MGSD 1S32D 5GSUB 3C1CC 3REIB 3AZKA 3W96C 3A6NC 5GXQD 4H9RA 1ZLAC 4J8UA 3AZEC 5B24B 3AZLA 3AZHB 5CP6C 5B33A 4QLCA 3WAAD 3X1TC 3WKJB 4R8PB 1P3MD 4CSRB 1BH9B 3REJA 3REKA 2YFWB 4DRAA 4LD9B 5CPJD 2F8ND 3AZID 5AV5B 5F99B 4Z66B 1JFIA 5GT3D 1P34C 5DNMD 1F66D 5B2JC 3KUYC 1BH8B 3UTBC 5B1LD 5B31A 3MGQC 5AV9D 5B31G 1P3LB 3KSYA 4XUJA 5B40B 5E5AC 3X1SD 3AZND 1M19C 1HTAA 5GT0B 5CPKC 1P3GC 5AV8C 2NZDA 3B6GA 3AN2B 2HUEB 3C1BB 3B0CW 5BT1C 2BYMB 4ZUXC 3UT9C 3AFAA 3AZMC 1KX3C 1WWIA 4M6BA 3W99B 5AV5D 4CAYB 4H9QB 4KUDD 4J8VD 3MGPC 1U35C 3C1CB 3X1UA 1P3OA 1P3BA 3A6NB 1ZLAB 3W96B 3LJAA 5CPID 3AZEB 3MGRA 3MGSC 5CP6B 5B0YD 4E45A 4H9PB 3X1TB 2NQBB 3MNNA 1B67A 4J8UD 1H3OB 4X23D 4H9OB 5B33D 4G92C 3WAAC 4G91C 1P34B 3AZGD 4NE3A 5B2JB 2FJ7C 4Z5TA 3UTBB 3O62A 3C1CD 5CPJC 1M1AA 3AYWD 3AZIC 3MGQB 4J8XC 1KX4D 1ZLAD 3V9RB 5DNNA 2YFVA 3W96D 3AZED 5AV6A 4WNNA 5CP6D 1F66C 5B1MA 1M19B 5CPKB 1P3GB 5AV8B 4YM6B 5B1LC 3KXBA 3W97A 5AV9C 3UT9B 3WTPC 4ZUXB 3B6FA 3LELA 5B32A 4H9SA 3X1SC 3AZNC 5B32G 3W98C 5B2IA 1P34D 3MGPB 1U35B 1P3ID 3KUYD 1N1JB 1P3PA 3UTBD 3MGQD 5FUGB 4JJNC 4KUDC 4WU8C 3UTAD 3MGSB 4J8VC 5E5AD 5AVBA 3AV2C 1P3GD 5KDMA 1TAFB 3LJAD 3TU4A 3MGRD 4DRBA 5BNXA 5CPIC 5BT1D 3AZMD 4ZUXD 1KX3D 4G92B 5B0YC 1EQZD 3WAAB 4KGCA 1P3MB 4G91B 4J8UC 4UUZB 3AZLC 5GSUA 5B33C 5CPJB 3REIA 4QLCC 1HQ3A 3AZIB 4J8XB 5GT3B 3AZGC 3AZHA 4H9NB 1F66B 1M1AD 3WKJA 4R8PA 5DNND 5B1LB 3AYWC 5AV9B 1KX4C 3R45B 4LD9A 3WTPE 3KWQD 5JA4B 3X1SB 3AZNB 3MVDA 4YS3A 5F99A 4KHAA 5B31C 2CV5A 4XUJC 2FJ7D 5B32D 4HGAC 1F1EA 2HIOA 4WU9A 4J8XD 5B0ZA 5JRGD 4JJNB 4KUDB 2NZDC 1P3LA 3B6GC 4J8VB 1B6WA 1P3IC 3AV2B 5CPIB 2BYMA 5AVBD 3WTPD 3UTAC 4J8WD 3W99A 5B0YB 2PYOD 3REHA 4H9QA 3X1UC 3W98D 4H9RB 3LJAC 4J8UB 5BNVA 1R4VA 3MGRC 4X23B 5B33B 1AOID 2AROA 1ID3A 1EQZC 4JJND 3MNNC 4AWLC 4WU8D 3AZGB 1KX5D 3X1VA 3AV2D 1HQ3D 3RELA 2NQBA 5G49A 3AYWB 1P3KA 1KX4B 3LZ1A 1H3OA 1P3AA 3WA9A 3AZFA 1M1AC 3AZKD 5DNNC 5B2JA 5AV6C 4XUJB 3AZLD 3NQJA 4HGAB 5B1MC 4YS3D 3KWQC 4QLCD 3V9RA 2NZDB 3B6GB 3REJD 3AZJA 1Q9CA 3B6FC 5C3IC 3REKD 3LELC 1P3IB 5BO0B 1TZYA 3KUYB 2HIOD 4H9SC 5B32C 4WU9D 5CPKA 4YM6A 5B0ZD 5B2IC 5JRGC 1M18A 3UT9A 3AV1A 3UTAB 5E5AB 1P3PC 3X1UB 5B31D 3LZ0A 3LJAB 3MGRB 1N1JA 4XUJD 5AVBC 3AZMB 1KX3B 4J8WC 3REHD 2PYOC 1EQZB 5AVCA 4XZQA 3MNNB 4AWLB 3TU4C 3B6GD 2NZDD 3MGSA 3AFAD 1S32A 1ID3D 1AOIC 2BYKB 5GXQA 5AY8A 3RELD 1M1AB 1KX5C 3REIC 3X1UD 1HQ3C 1P3OD 1P3BD 1P3MA 5DNNB 2YFVB 4UUZA 5AV6B 5BS7A 4WNNB 1P3AD 3WA9D 5B1MB 3KWQB 5CPJA 2F8NA 4Z2MG 3NQUA 2F8NG 3MNND 5GT3A 3AZKC 3VH5T 1P3FA 5DNMA 4H9NA 3LELB 1F66A 2FJ7B 5B32B 3MVDC 4YS3C 5F99C 5B2IB 5AV9A 2CV5C 5JRGB 3R45A 3REJC 2IO5C 1TZYD 5B24A 5JA4A 3REKC 3X1SA 3AZNA 4Z5TD 3O62D 2HIOC 4WU9C 5B0ZC 4CSRA 1M18D 1BH9A 3AV1D 5AV6D 3WTPB 5AVBB 2YFWA 4NFTA 4J8WB 5B1MD 2PYOB 5AV5A 2F8NK 3LZ0D 3W98B 4KUDA 3TU4B 4Z66A 3KXBD 1A7WA 3W97D 5BNXB 4J8VA 3B6FD 3LELD 1BH8A 3REHC 1AOIB 5AVCD 4XZQD 5B2ID 5CPIA 4WU8B 5B40A 3B0DC 5B0YA 3AFAC 1P3PD 1KX5B 1HQ3B 5GT0A 2AROC 1ID3C 5AY8D 4ZBJC 2RVQD 3AN2A 3C1BA 4NE6A 4X23A 4EO5C 3X1VC 3RELC 2NQBC 4CAYA 1P3KC 1P3OC 3TU4D 3AZKB 1P3BC 3LZ1C 3AZGA 2LY8A 1P3AC 3AZLB 1KU5A 3WA9C 3B0BA 3C1CA 3MVDB 3AZFC 4Z2MH 4YS3B 4QLCB 3AYWA 4KGCD 4KHAB 3W96A 3A6NA 2CV5B 1KX4A 1ZLAA 2F8NH 1P3FD 4WZSB 3REJB 3AZEA 2IO5B 5CHLB 3REKB 2CWEA 5GSUD 5CP6A 2HIOB 3REID 4H9PA 4WU9B 3X1TA 5B0ZB 1JFIB 3AZJC 5B24D 3AZHD 1TZYC 4H9OA 2L5AA 1WWSA 4Z5TC 3WKJD 4YM6C 4R8PD 3O62C 5B31B 1P34A 1M18C 3AV1C 1P3IA 4LD9D 5BO0A 3KUYA 3UTBA 3REHB 3MVDD 5F99D 4Z66D 3MGQA 2CV5D 3LZ0C 5BNVB 3KXBC 3W97C 3UTAA 5E5AA 3B0DB 3AFAB 1M19A 2AROB 1ID3B 1P3GA 5AV8A 4ZBJB 3VH6W 4XZQC 5AVCC 1P3LD 1ULYA 3B0CT 5B40D 3AZMA 4ZUXA 1KX3A 3VH6A 1S32C
chains in the Genus database with same CATH superfamily
4EO5B 3X1VB 5GT0D 3RELB 3H0MC 1EQZA 5G49B 1P3KB 1P3OB 1P3BB 5GXQC 3LZ1B 3AN2D 5AY8C 2RVQC 3C1BD 2JE5A 3MGPA 1U35A 1P3AB 2Y2IA 3WA9B 2W8SA 3W99D 3AZFB 2BYKA 1BFMA 1P3MC 5FUGA 3VH6T 5BS7C 3NQJB 2AROD 3A6ND 1TAFA 4KGCC 5GT3C 3AZJB 1P3FC 3VH5W 5DNMC 1TZYB 3KWQA 5GSUC 3X1VD 4Z5TB 3VH5A 3X1TD 2NQBD 3O62B 3WAAA 1P3KD 3LZ1D 1M18B 3AV1B 2FJ7A 5B24C 3AZHC 3AZFD 3AZIA 4J8XA 3WKJC 4R8PC 5JRGA 3LZ0B 4E44A 3KXBB 3W97B 4WV4B 5B2JD 3B6FB 5C3IB 4LD9C 5AV5C 5B1LA 5AVCB 4XZQB 4Z66C 4NE5A 3AZJD 3WTPA 4J8WA 1S32B 1M19D 3EG5B 2PYOA 1P3PB 5CPKD 5AV8D 4YM6D 3W98A 5GXQB 5AY8B 1P3LC 3UT9D 5B40C 1AOIA 5GT0C 5KDMB 4JJNA 4WU8A 3AN2C 3MGPD 1U35D 2HUEC 3C1BC 2JSSA 4X23C 1KX5A 3AV2A 2F8NB 3W99C 3A1IA 3NQUB 4KGCB 1P3FB 5DNMB 3MGSD 1S32D 5GSUB 3C1CC 3REIB 3AZKA 3W96C 3A6NC 5GXQD 4H9RA 1ZLAC 4J8UA 3AZEC 5B24B 2Y2QA 3AZHB 3AZLA 5CP6C 5B33A 4QLCA 3WAAD 3X1TC 3WKJB 4R8PB 1P3MD 4CSRB 1BH9B 3REJA 3REKA 2YFWB 4DRAA 4LD9B 5CPJD 2F8ND 3AZID 5AV5B 3EPLA 5F99B 4Z66B 1JFIA 5GT3D 1P34C 5DNMD 1F66D 5B2JC 3KUYC 1BH8B 3UTBC 5B1LD 5B31A 3MGQC 5AV9D 5B31G 1P3LB 3KSYA 4XUJA 5B40B 5E5AC 3X1SD 3AZND 2J8PA 1HTAA 1M19C 5GT0B 5CPKC 1P3GC 5AV8C 2NZDA 3B6GA 3AN2B 2HUEB 3C1BB 3B0CW 5BT1C 2BYMB 4ZUXC 3UT9C 3AFAA 3AZMC 1KX3C 1WWIA 2DQNC 4M6BA 3W99B 5AV5D 4CAYB 4H9QB 4KUDD 4J8VD 3MGPC 1U35C 3C1CB 3X1UA 1P3OA 1P3BA 3A6NB 1ZLAB 3W96B 3LJAA 5CPID 3AZEB 3MGRA 3MGSC 5CP6B 5B0YD 4E45A 4H9PB 3X1TB 2Y2LA 2NQBB 3MNNA 1B67A 4J8UD 1H3OB 4X23D 4H9OB 5B33D 4WJ3C 4G92C 3WAAC 4G91C 1P34B 2XD5A 3AZGD 4NE3A 5B2JB 2FJ7C 4Z5TA 3UTBB 3O62A 3C1CD 5CPJC 1M1AA 3AYWD 3AZIC 3MGQB 4J8XC 1KX4D 1ZLAD 3V9RB 5DNNA 2YFVA 3W96D 3AZED 2VQRA 5AV6A 4WNNA 5CP6D 1F66C 5B1MA 1M19B 5CPKB 1P3GB 5AV8B 4YM6B 5B1LC 3KXBA 3W97A 5AV9C 3UT9B 3WTPC 4ZUXB 3B6FA 3LELA 5B32A 4H9SA 3EPKA 3AZNC 3X1SC 2ZY4A 5B32G 3W98C 5B2IA 2ZM5A 1P34D 3MGPB 1U35B 1P3ID 3KUYD 1N1JB 1P3PA 3UTBD 1Z2CB 3MGQD 5FUGB 4JJNC 2Y2OA 4KUDC 4WU8C 3UTAD 3MGSB 4J8VC 5E5AD 5AVBA 3AV2C 2ZY3A 1P3GD 5KDMA 1TAFB 3LJAD 3TU4A 2UWXA 3MGRD 4DRBA 5BNXA 5CPIC 5BT1D 3AZMD 4ZUXD 1KX3D 2Y2PA 4G92B 5B0YC 1EQZD 3WAAB 4KGCA 1P3MB 4G91B 4J8UC 4UUZB 3AZLC 5GSUA 5B33C 5CPJB 3REIA 4QLCC 1HQ3A 3AZIB 4J8XB 5GT3B 3AZGC 3AZHA 4H9NB 1F66B 1M1AD 3WKJA 4R8PA 5DNND 5B1LB 3AYWC 5AV9B 1KX4C 3R45B 4LD9A 3WTPE 3KWQD 5JA4B 3X1SB 3AZNB 3MVDA 4YS3A 5F99A 4KHAA 5B31C 2CV5A 4XUJC 2FJ7D 5B32D 4HGAC 1F1EA 3FDDA 2HIOA 4WU9A 2G5HC 4J8XD 5B0ZA 5JRGD 4JJNB 4KUDB 2NZDC 1P3LA 3B6GC 4J8VB 1B6WA 1P3IC 3AV2B 5CPIB 2BYMA 5AVBD 3WTPD 3UTAC 4J8WD 3W99A 5B0YB 2Y2MA 3REHA 2PYOD 4H9QA 3X1UC 3W98D 4H9RB 3LJAC 4J8UB 5BNVA 2DF4C 1R4VA 3MGRC 4X23B 5B33B 1AOID 2AROA 1ID3A 1EQZC 4JJND 3MNNC 4AWLC 4WU8D 3AZGB 2Y2NA 2ZY2A 1KX5D 3X1VA 3AV2D 1HQ3D 3RELA 2NQBA 3EPHA 5G49A 3AYWB 1P3KA 1KX4B 3LZ1A 1H3OA 4DQYB 1P3AA 3WA9A 3AZFA 1M1AC 3AZKD 5DNNC 3F6TA 5B2JA 5AV6C 4XUJB 3EPJA 3AZLD 3NQJA 4HGAB 3AL0C 5B1MC 4YS3D 3KWQC 4QLCD 3V9RA 2NZDB 3B6GB 3REJD 3AZJA 2ZY5A 1Q9CA 3B6FC 5C3IC 3REKD 3LELC 1P3IB 5BO0B 1TZYA 2Y2JA 3KUYB 2HIOD 4H9SC 5B32C 4WU9D 5CPKA 2RIQA 5B0ZD 4YM6A 5B2IC 5JRGC 1M18A 3UT9A 3AV1A 3UTAB 3IP4C 4UPKA 5E5AB 2Y2KA 2Y2HA 1P3PC 3X1UB 5B31D 3LZ0A 3LJAB 3MGRB 3A1KA 1N1JA 4XUJD 2Y2GA 5AVBC 3AZMB 1KX3B 4J8WC 3REHD 2PYOC 1EQZB 5AVCA 4XZQA 3MNNB 4AWLB 3TU4C 3B6GD 2NZDD 3MGSA 2JCHA 3AFAD 1S32A 1ID3D 1AOIC 2BYKB 5GXQA 5AY8A 3RELD 1M1AB 1KX5C 3REIC 1T3UA 1HQ3C 3X1UD 1P3OD 1P3BD 1P3MA 5DNNB 2YFVB 4UUZA 5AV6B 5BS7A 4WNNB 1P3AD 3WA9D 5B1MB 3KWQB 5CPJA 2F8NA 4Z2MG 3NQUA 2F8NG 3MNND 5GT3A 3AZKC 3VH5T 1P3FA 5DNMA 4H9NA 3LELB 1F66A 2FJ7B 3H0LC 5B32B 3MVDC 4YS3C 3KFUG 5F99C 5B2IB 5AV9A 2CV5C 5JRGB 3R45A 3REJC 2IO5C 3H0RC 1TZYD 5B24A 5JA4A 3REKC 3X1SA 3AZNA 4Z5TD 3O62D 2HIOC 4WU9C 5B0ZC 4CSRA 1M18D 1BH9A 3AV1D 5AV6D 3WTPB 5AVBB 2YFWA 4NFTA 4J8WB 5B1MD 2PYOB 5AV5A 2F8NK 3LZ0D 3W98B 4KUDA 3TU4B 4Z66A 3KXBD 1A7WA 3W97D 5BNXB 4J8VA 3B6FD 3P5JB 3LELD 1BH8A 2F2AC 3REHC 1AOIB 5AVCD 4XZQD 2G5IC 5B2ID 5CPIA 4WU8B 5B40A 3B0DC 5B0YA 3AFAC 1P3PD 1KX5B 1HQ3B 5GT0A 2AROC 1ID3C 5AY8D 4ZBJC 2RVQD 3AN2A 3C1BA 4NE6A 4X23A 4EO5C 3X1VC 3RELC 2NQBC 4CAYA 1P3KC 1P3OC 3TU4D 3AZKB 1P3BC 3LZ1C 3AZGA 2XD1A 1PZRA 2LY8A 1P3AC 3AZLB 1KU5A 3WA9C 3B0BA 3C1CA 3MVDB 3AZFC 4Z2MH 4YS3B 4QLCB 3AYWA 4KGCD 4KHAB 2FFFB 3W96A 3A6NA 2CV5B 1KX4A 1ZLAA 1P3FD 2F8NH 4WZSB 3REJB 3AZEA 2IO5B 5CHLB 3REKB 2CWEA 5GSUD 5CP6A 2HIOB 3REID 4H9PA 4WU9B 3X1TA 5B0ZB 1JFIB 3AZJC 5B24D 3AZHD 1TZYC 4H9OA 2L5AA 1WWSA 4Z5TC 3WKJD 4YM6C 4R8PD 3O62C 5B31B 1P34A 1M18C 3AV1C 1P3IA 4LD9D 5BO0A 3KUYA 1W2EA 3UTBA 3REHB 3MVDD 5F99D 4Z66D 3MGQA 2CV5D 3LZ0C 5BNVB 3KXBC 3W97C 3UTAA 5E5AA 3B0DB 3AFAB 1M19A 2AROB 1ID3B 1P3GA 5AV8A 2BG1A 4ZBJB 3VH6W 4XZQC 5AVCC 1P3LD 1ULYA 3B0CT 5B40D 3AZMA 4ZUXA 1KX3A 3VH6A 1S32C
chains in the Genus database with same CATH topology
4EO5B 3X1VB 5GT0D 3RELB 3H0MC 1EQZA 5G49B 1P3KB 1P3OB 1P3BB 5GXQC 3LZ1B 3AN2D 5AY8C 2RVQC 3C1BD 2JE5A 3MGPA 1U35A 1P3AB 2Y2IA 3WA9B 2W8SA 3W99D 3AZFB 2BYKA 1BFMA 1P3MC 5FUGA 3VH6T 5BS7C 3NQJB 2AROD 3A6ND 1TAFA 4KGCC 5GT3C 3AZJB 1P3FC 3VH5W 5DNMC 1TZYB 3KWQA 5GSUC 3X1VD 4Z5TB 3VH5A 3X1TD 2NQBD 3O62B 3WAAA 1P3KD 3LZ1D 1M18B 3AV1B 2FJ7A 5B24C 3AZHC 3AZFD 3AZIA 4J8XA 3WKJC 4R8PC 5JRGA 3LZ0B 4E44A 3KXBB 3W97B 4WV4B 5B2JD 3B6FB 5C3IB 4LD9C 5AV5C 5B1LA 5AVCB 4XZQB 4Z66C 4NE5A 3AZJD 3WTPA 4J8WA 1S32B 1M19D 3EG5B 2PYOA 1P3PB 5CPKD 5AV8D 4YM6D 3W98A 5GXQB 5AY8B 1P3LC 3UT9D 5B40C 1AOIA 5GT0C 5KDMB 4JJNA 4WU8A 3AN2C 3MGPD 1U35D 2HUEC 3C1BC 2JSSA 4X23C 1KX5A 3AV2A 2F8NB 3W99C 3A1IA 3NQUB 4KGCB 1P3FB 5DNMB 3MGSD 1S32D 5GSUB 3C1CC 3REIB 3AZKA 3W96C 3A6NC 5GXQD 4H9RA 1ZLAC 4J8UA 3AZEC 5B24B 2Y2QA 3AZHB 3AZLA 5CP6C 5B33A 4QLCA 3WAAD 3X1TC 3WKJB 4R8PB 1P3MD 4CSRB 1BH9B 3REJA 3REKA 2YFWB 4DRAA 4LD9B 5CPJD 2F8ND 3AZID 5AV5B 3EPLA 5F99B 4Z66B 1JFIA 5GT3D 1P34C 5DNMD 1F66D 5B2JC 3KUYC 1BH8B 3UTBC 5B1LD 5B31A 3MGQC 5AV9D 5B31G 1P3LB 3KSYA 4XUJA 5B40B 5E5AC 3X1SD 3AZND 2J8PA 1HTAA 1M19C 5GT0B 5CPKC 1P3GC 5AV8C 2NZDA 3B6GA 3AN2B 2HUEB 3C1BB 3B0CW 5BT1C 2BYMB 4ZUXC 3UT9C 3AFAA 3AZMC 1KX3C 1WWIA 2DQNC 4M6BA 3W99B 5AV5D 4CAYB 4H9QB 4KUDD 4J8VD 3MGPC 1U35C 3C1CB 3X1UA 1P3OA 1P3BA 3A6NB 1ZLAB 3W96B 3LJAA 5CPID 3AZEB 3MGRA 3MGSC 5CP6B 5B0YD 4E45A 4H9PB 3X1TB 2Y2LA 2NQBB 3MNNA 1B67A 4J8UD 1H3OB 4X23D 4H9OB 5B33D 4WJ3C 4G92C 3WAAC 4G91C 1P34B 2XD5A 3AZGD 4NE3A 5B2JB 2FJ7C 4Z5TA 3UTBB 3O62A 3C1CD 5CPJC 1M1AA 3AYWD 3AZIC 3MGQB 4J8XC 1KX4D 1ZLAD 3V9RB 5DNNA 2YFVA 3W96D 3AZED 2VQRA 5AV6A 4WNNA 5CP6D 1F66C 5B1MA 1M19B 5CPKB 1P3GB 5AV8B 4YM6B 5B1LC 3KXBA 3W97A 5AV9C 3UT9B 3WTPC 4ZUXB 3B6FA 3LELA 5B32A 4H9SA 3EPKA 3AZNC 3X1SC 2ZY4A 5B32G 3W98C 5B2IA 2ZM5A 1P34D 3MGPB 1U35B 1P3ID 3KUYD 1N1JB 1P3PA 3UTBD 1Z2CB 3MGQD 5FUGB 4JJNC 2Y2OA 4KUDC 4WU8C 3UTAD 3MGSB 4J8VC 5E5AD 5AVBA 3AV2C 2ZY3A 1P3GD 5KDMA 1TAFB 3LJAD 3TU4A 2UWXA 3MGRD 4DRBA 5BNXA 5CPIC 5BT1D 3AZMD 4ZUXD 1KX3D 2Y2PA 4G92B 5B0YC 1EQZD 3WAAB 4KGCA 1P3MB 4G91B 4J8UC 4UUZB 3AZLC 5GSUA 5B33C 5CPJB 3REIA 4QLCC 1HQ3A 3AZIB 4J8XB 5GT3B 3AZGC 3AZHA 4H9NB 1F66B 1M1AD 3WKJA 4R8PA 5DNND 5B1LB 3AYWC 5AV9B 1KX4C 3R45B 4LD9A 3WTPE 3KWQD 5JA4B 3X1SB 3AZNB 3MVDA 4YS3A 5F99A 4KHAA 5B31C 2CV5A 4XUJC 2FJ7D 5B32D 4HGAC 1F1EA 3FDDA 2HIOA 4WU9A 2G5HC 4J8XD 5B0ZA 5JRGD 4JJNB 4KUDB 2NZDC 1P3LA 3B6GC 4J8VB 1B6WA 1P3IC 3AV2B 5CPIB 2BYMA 5AVBD 3WTPD 3UTAC 4J8WD 3W99A 5B0YB 2Y2MA 3REHA 2PYOD 4H9QA 3X1UC 3W98D 4H9RB 3LJAC 4J8UB 5BNVA 2DF4C 1R4VA 3MGRC 4X23B 5B33B 1AOID 2AROA 1ID3A 1EQZC 4JJND 3MNNC 4AWLC 4WU8D 3AZGB 2Y2NA 2ZY2A 1KX5D 3X1VA 3AV2D 1HQ3D 3RELA 2NQBA 3EPHA 5G49A 3AYWB 1P3KA 1KX4B 3LZ1A 1H3OA 4DQYB 1P3AA 3WA9A 3AZFA 1M1AC 3AZKD 5DNNC 3F6TA 5B2JA 5AV6C 4XUJB 3EPJA 3AZLD 3NQJA 4HGAB 3AL0C 5B1MC 4YS3D 3KWQC 4QLCD 3V9RA 2NZDB 3B6GB 3REJD 3AZJA 2ZY5A 1Q9CA 3B6FC 5C3IC 3REKD 3LELC 1P3IB 5BO0B 1TZYA 2Y2JA 3KUYB 2HIOD 4H9SC 5B32C 4WU9D 5CPKA 2RIQA 5B0ZD 4YM6A 5B2IC 5JRGC 1M18A 3UT9A 3AV1A 3UTAB 3IP4C 4UPKA 5E5AB 2Y2KA 2Y2HA 1P3PC 3X1UB 5B31D 3LZ0A 3LJAB 3MGRB 3A1KA 1N1JA 4XUJD 2Y2GA 5AVBC 3AZMB 1KX3B 4J8WC 3REHD 2PYOC 1EQZB 5AVCA 4XZQA 3MNNB 4AWLB 3TU4C 3B6GD 2NZDD 3MGSA 2JCHA 3AFAD 1S32A 1ID3D 1AOIC 2BYKB 5GXQA 5AY8A 3RELD 1M1AB 1KX5C 3REIC 1T3UA 1HQ3C 3X1UD 1P3OD 1P3BD 1P3MA 5DNNB 2YFVB 4UUZA 5AV6B 5BS7A 4WNNB 1P3AD 3WA9D 5B1MB 3KWQB 5CPJA 2F8NA 4Z2MG 3NQUA 2F8NG 3MNND 5GT3A 3AZKC 3VH5T 1P3FA 5DNMA 4H9NA 3LELB 1F66A 2FJ7B 3H0LC 5B32B 3MVDC 4YS3C 3KFUG 5F99C 5B2IB 5AV9A 2CV5C 5JRGB 3R45A 3REJC 2IO5C 3H0RC 1TZYD 5B24A 5JA4A 3REKC 3X1SA 3AZNA 4Z5TD 3O62D 2HIOC 4WU9C 5B0ZC 4CSRA 1M18D 1BH9A 3AV1D 5AV6D 3WTPB 5AVBB 2YFWA 4NFTA 4J8WB 5B1MD 2PYOB 5AV5A 2F8NK 3LZ0D 3W98B 4KUDA 3TU4B 4Z66A 3KXBD 1A7WA 3W97D 5BNXB 4J8VA 3B6FD 3P5JB 3LELD 1BH8A 2F2AC 3REHC 1AOIB 5AVCD 4XZQD 2G5IC 5B2ID 5CPIA 4WU8B 5B40A 3B0DC 5B0YA 3AFAC 1P3PD 1KX5B 1HQ3B 5GT0A 2AROC 1ID3C 5AY8D 4ZBJC 2RVQD 3AN2A 3C1BA 4NE6A 4X23A 4EO5C 3X1VC 3RELC 2NQBC 4CAYA 1P3KC 1P3OC 3TU4D 3AZKB 1P3BC 3LZ1C 3AZGA 2XD1A 1PZRA 2LY8A 1P3AC 3AZLB 1KU5A 3WA9C 3B0BA 3C1CA 3MVDB 3AZFC 4Z2MH 4YS3B 4QLCB 3AYWA 4KGCD 4KHAB 2FFFB 3W96A 3A6NA 2CV5B 1KX4A 1ZLAA 1P3FD 2F8NH 4WZSB 3REJB 3AZEA 2IO5B 5CHLB 3REKB 2CWEA 5GSUD 5CP6A 2HIOB 3REID 4H9PA 4WU9B 3X1TA 5B0ZB 1JFIB 3AZJC 5B24D 3AZHD 1TZYC 4H9OA 2L5AA 1WWSA 4Z5TC 3WKJD 4YM6C 4R8PD 3O62C 5B31B 1P34A 1M18C 3AV1C 1P3IA 4LD9D 5BO0A 3KUYA 1W2EA 3UTBA 3REHB 3MVDD 5F99D 4Z66D 3MGQA 2CV5D 3LZ0C 5BNVB 3KXBC 3W97C 3UTAA 5E5AA 3B0DB 3AFAB 1M19A 2AROB 1ID3B 1P3GA 5AV8A 2BG1A 4ZBJB 3VH6W 4XZQC 5AVCC 1P3LD 1ULYA 3B0CT 5B40D 3AZMA 4ZUXA 1KX3A 3VH6A 1S32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO5 B;  3X1V B;  5GT0 D;  3REL B;  1EQZ A;  5G49 B;  1P3K B;  1P3O B;  1P3B B;  5GXQ C;  3LZ1 B;  3AN2 D;  5AY8 C;  2RVQ C;  3C1B D;  3MGP A;  1U35 A;  1P3A B;  3WA9 B;  3W99 D;  3AZF B;  2BYK A;  1BFM A;  1P3M C;  5FUG A;  3VH6 T;  5BS7 C;  3NQJ B;  2ARO D;  3A6N D;  1TAF A;  4KGC C;  5GT3 C;  3AZJ B;  1P3F C;  3VH5 W;  5DNM C;  1TZY B;  3KWQ A;  5GSU C;  3X1V D;  4Z5T B;  3VH5 A;  3X1T D;  2NQB D;  3O62 B;  3WAA A;  1P3K D;  3LZ1 D;  1M18 B;  3AV1 B;  2FJ7 A;  5B24 C;  3AZH C;  3AZF D;  3AZI A;  4J8X A;  3WKJ C;  4R8P C;  5JRG A;  3LZ0 B;  4E44 A;  3KXB B;  3W97 B;  4WV4 B;  5B2J D;  3B6F B;  5C3I B;  4LD9 C;  5AV5 C;  5B1L A;  5AVC B;  4XZQ B;  4Z66 C;  4NE5 A;  3AZJ D;  3WTP A;  4J8W A;  1S32 B;  1M19 D;  2PYO A;  1P3P B;  5CPK D;  5AV8 D;  4YM6 D;  3W98 A;  5GXQ B;  5AY8 B;  1P3L C;  3UT9 D;  5B40 C;  1AOI A;  5GT0 C;  5KDM B;  4JJN A;  4WU8 A;  3AN2 C;  3MGP D;  1U35 D;  2HUE C;  3C1B C;  2JSS A;  4X23 C;  1KX5 A;  3AV2 A;  2F8N B;  3W99 C;  3NQU B;  4KGC B;  1P3F B;  5DNM B;  3MGS D;  1S32 D;  5GSU B;  3C1C C;  3REI B;  3AZK A;  3W96 C;  3A6N C;  5GXQ D;  4H9R A;  1ZLA C;  4J8U A;  3AZE C;  5B24 B;  3AZL A;  3AZH B;  5CP6 C;  5B33 A;  4QLC A;  3WAA D;  3X1T C;  3WKJ B;  4R8P B;  1P3M D;  4CSR B;  1BH9 B;  3REJ A;  3REK A;  2YFW B;  4DRA A;  4LD9 B;  5CPJ D;  2F8N D;  3AZI D;  5AV5 B;  5F99 B;  4Z66 B;  1JFI A;  5GT3 D;  1P34 C;  5DNM D;  1F66 D;  5B2J C;  3KUY C;  1BH8 B;  3UTB C;  5B1L D;  5B31 A;  3MGQ C;  5AV9 D;  5B31 G;  1P3L B;  3KSY A;  4XUJ A;  5B40 B;  5E5A C;  3X1S D;  3AZN D;  1M19 C;  1HTA A;  5GT0 B;  5CPK C;  1P3G C;  5AV8 C;  2NZD A;  3B6G A;  3AN2 B;  2HUE B;  3C1B B;  3B0C W;  5BT1 C;  2BYM B;  4ZUX C;  3UT9 C;  3AFA A;  3AZM C;  1KX3 C;  1WWI A;  4M6B A;  3W99 B;  5AV5 D;  4CAY B;  4H9Q B;  4KUD D;  4J8V D;  3MGP C;  1U35 C;  3C1C B;  3X1U A;  1P3O A;  1P3B A;  3A6N B;  1ZLA B;  3W96 B;  3LJA A;  5CPI D;  3AZE B;  3MGR A;  3MGS C;  5CP6 B;  5B0Y D;  4E45 A;  4H9P B;  3X1T B;  2NQB B;  3MNN A;  1B67 A;  4J8U D;  1H3O B;  4X23 D;  4H9O B;  5B33 D;  4G92 C;  3WAA C;  4G91 C;  1P34 B;  3AZG D;  4NE3 A;  5B2J B;  2FJ7 C;  4Z5T A;  3UTB B;  3O62 A;  3C1C D;  5CPJ C;  1M1A A;  3AYW D;  3AZI C;  3MGQ B;  4J8X C;  1KX4 D;  1ZLA D;  3V9R B;  5DNN A;  2YFV A;  3W96 D;  3AZE D;  5AV6 A;  4WNN A;  5CP6 D;  1F66 C;  5B1M A;  1M19 B;  5CPK B;  1P3G B;  5AV8 B;  4YM6 B;  5B1L C;  3KXB A;  3W97 A;  5AV9 C;  3UT9 B;  3WTP C;  4ZUX B;  3B6F A;  3LEL A;  5B32 A;  4H9S A;  3X1S C;  3AZN C;  5B32 G;  3W98 C;  5B2I A;  1P34 D;  3MGP B;  1U35 B;  1P3I D;  3KUY D;  1N1J B;  1P3P A;  3UTB D;  3MGQ D;  5FUG B;  4JJN C;  4KUD C;  4WU8 C;  3UTA D;  3MGS B;  4J8V C;  5E5A D;  5AVB A;  3AV2 C;  1P3G D;  5KDM A;  1TAF B;  3LJA D;  3TU4 A;  3MGR D;  4DRB A;  5BNX A;  5CPI C;  5BT1 D;  3AZM D;  4ZUX D;  1KX3 D;  4G92 B;  5B0Y C;  1EQZ D;  3WAA B;  4KGC A;  1P3M B;  4G91 B;  4J8U C;  4UUZ B;  3AZL C;  5GSU A;  5B33 C;  5CPJ B;  3REI A;  4QLC C;  1HQ3 A;  3AZI B;  4J8X B;  5GT3 B;  3AZG C;  3AZH A;  4H9N B;  1F66 B;  1M1A D;  3WKJ A;  4R8P A;  5DNN D;  5B1L B;  3AYW C;  5AV9 B;  1KX4 C;  3R45 B;  4LD9 A;  3WTP E;  3KWQ D;  5JA4 B;  3X1S B;  3AZN B;  3MVD A;  4YS3 A;  5F99 A;  4KHA A;  5B31 C;  2CV5 A;  4XUJ C;  2FJ7 D;  5B32 D;  4HGA C;  1F1E A;  2HIO A;  4WU9 A;  4J8X D;  5B0Z A;  5JRG D;  4JJN B;  4KUD B;  2NZD C;  1P3L A;  3B6G C;  4J8V B;  1B6W A;  1P3I C;  3AV2 B;  5CPI B;  2BYM A;  5AVB D;  3WTP D;  3UTA C;  4J8W D;  3W99 A;  5B0Y B;  2PYO D;  3REH A;  4H9Q A;  3X1U C;  3W98 D;  4H9R B;  3LJA C;  4J8U B;  5BNV A;  1R4V A;  3MGR C;  4X23 B;  5B33 B;  1AOI D;  2ARO A;  1ID3 A;  1EQZ C;  4JJN D;  3MNN C;  4AWL C;  4WU8 D;  3AZG B;  1KX5 D;  3X1V A;  3AV2 D;  1HQ3 D;  3REL A;  2NQB A;  5G49 A;  3AYW B;  1P3K A;  1KX4 B;  3LZ1 A;  1H3O A;  1P3A A;  3WA9 A;  3AZF A;  1M1A C;  3AZK D;  5DNN C;  5B2J A;  5AV6 C;  4XUJ B;  3AZL D;  3NQJ A;  4HGA B;  5B1M C;  4YS3 D;  3KWQ C;  4QLC D;  3V9R A;  2NZD B;  3B6G B;  3REJ D;  3AZJ A;  1Q9C A;  3B6F C;  5C3I C;  3REK D;  3LEL C;  1P3I B;  5BO0 B;  1TZY A;  3KUY B;  2HIO D;  4H9S C;  5B32 C;  4WU9 D;  5CPK A;  4YM6 A;  5B0Z D;  5B2I C;  5JRG C;  1M18 A;  3UT9 A;  3AV1 A;  3UTA B;  5E5A B;  1P3P C;  3X1U B;  5B31 D;  3LZ0 A;  3LJA B;  3MGR B;  1N1J A;  4XUJ D;  5AVB C;  3AZM B;  1KX3 B;  4J8W C;  3REH D;  2PYO C;  1EQZ B;  5AVC A;  4XZQ A;  3MNN B;  4AWL B;  3TU4 C;  3B6G D;  2NZD D;  3MGS A;  3AFA D;  1S32 A;  1ID3 D;  1AOI C;  2BYK B;  5GXQ A;  5AY8 A;  3REL D;  1M1A B;  1KX5 C;  3REI C;  3X1U D;  1HQ3 C;  1P3O D;  1P3B D;  1P3M A;  5DNN B;  2YFV B;  4UUZ A;  5AV6 B;  5BS7 A;  4WNN B;  1P3A D;  3WA9 D;  5B1M B;  3KWQ B;  5CPJ A;  2F8N A;  4Z2M G;  3NQU A;  2F8N G;  3MNN D;  5GT3 A;  3AZK C;  3VH5 T;  1P3F A;  5DNM A;  4H9N A;  3LEL B;  1F66 A;  2FJ7 B;  5B32 B;  3MVD C;  4YS3 C;  5F99 C;  5B2I B;  5AV9 A;  2CV5 C;  5JRG B;  3R45 A;  3REJ C;  2IO5 C;  1TZY D;  5B24 A;  5JA4 A;  3REK C;  3X1S A;  3AZN A;  4Z5T D;  3O62 D;  2HIO C;  4WU9 C;  5B0Z C;  4CSR A;  1M18 D;  1BH9 A;  3AV1 D;  5AV6 D;  3WTP B;  5AVB B;  2YFW A;  4NFT A;  4J8W B;  5B1M D;  2PYO B;  5AV5 A;  2F8N K;  3LZ0 D;  3W98 B;  4KUD A;  3TU4 B;  4Z66 A;  3KXB D;  1A7W A;  3W97 D;  5BNX B;  4J8V A;  3B6F D;  3LEL D;  1BH8 A;  3REH C;  1AOI B;  5AVC D;  4XZQ D;  5B2I D;  5CPI A;  4WU8 B;  5B40 A;  3B0D C;  5B0Y A;  3AFA C;  1P3P D;  1KX5 B;  1HQ3 B;  5GT0 A;  2ARO C;  1ID3 C;  5AY8 D;  4ZBJ C;  2RVQ D;  3AN2 A;  3C1B A;  4NE6 A;  4X23 A;  4EO5 C;  3X1V C;  3REL C;  2NQB C;  4CAY A;  1P3K C;  1P3O C;  3TU4 D;  3AZK B;  1P3B C;  3LZ1 C;  3AZG A;  2LY8 A;  1P3A C;  3AZL B;  1KU5 A;  3WA9 C;  3B0B A;  3C1C A;  3MVD B;  3AZF C;  4Z2M H;  4YS3 B;  4QLC B;  3AYW A;  4KGC D;  4KHA B;  3W96 A;  3A6N A;  2CV5 B;  1KX4 A;  1ZLA A;  2F8N H;  1P3F D;  4WZS B;  3REJ B;  3AZE A;  2IO5 B;  5CHL B;  3REK B;  2CWE A;  5GSU D;  5CP6 A;  2HIO B;  3REI D;  4H9P A;  4WU9 B;  3X1T A;  5B0Z B;  1JFI B;  3AZJ C;  5B24 D;  3AZH D;  1TZY C;  4H9O A;  2L5A A;  1WWS A;  4Z5T C;  3WKJ D;  4YM6 C;  4R8P D;  3O62 C;  5B31 B;  1P34 A;  1M18 C;  3AV1 C;  1P3I A;  4LD9 D;  5BO0 A;  3KUY A;  3UTB A;  3REH B;  3MVD D;  5F99 D;  4Z66 D;  3MGQ A;  2CV5 D;  3LZ0 C;  5BNV B;  3KXB C;  3W97 C;  3UTA A;  5E5A A;  3B0D B;  3AFA B;  1M19 A;  2ARO B;  1ID3 B;  1P3G A;  5AV8 A;  4ZBJ B;  3VH6 W;  4XZQ C;  5AVC C;  1P3L D;  1ULY A;  3B0C T;  5B40 D;  3AZM A;  4ZUX A;  1KX3 A;  3VH6 A;  1S32 C; 
#chains in the Genus database with same CATH topology
 4EO5 B;  3X1V B;  5GT0 D;  3REL B;  3H0M C;  1EQZ A;  5G49 B;  1P3K B;  1P3O B;  1P3B B;  5GXQ C;  3LZ1 B;  3AN2 D;  5AY8 C;  2RVQ C;  3C1B D;  2JE5 A;  3MGP A;  1U35 A;  1P3A B;  2Y2I A;  3WA9 B;  2W8S A;  3W99 D;  3AZF B;  2BYK A;  1BFM A;  1P3M C;  5FUG A;  3VH6 T;  5BS7 C;  3NQJ B;  2ARO D;  3A6N D;  1TAF A;  4KGC C;  5GT3 C;  3AZJ B;  1P3F C;  3VH5 W;  5DNM C;  1TZY B;  3KWQ A;  5GSU C;  3X1V D;  4Z5T B;  3VH5 A;  3X1T D;  2NQB D;  3O62 B;  3WAA A;  1P3K D;  3LZ1 D;  1M18 B;  3AV1 B;  2FJ7 A;  5B24 C;  3AZH C;  3AZF D;  3AZI A;  4J8X A;  3WKJ C;  4R8P C;  5JRG A;  3LZ0 B;  4E44 A;  3KXB B;  3W97 B;  4WV4 B;  5B2J D;  3B6F B;  5C3I B;  4LD9 C;  5AV5 C;  5B1L A;  5AVC B;  4XZQ B;  4Z66 C;  4NE5 A;  3AZJ D;  3WTP A;  4J8W A;  1S32 B;  1M19 D;  3EG5 B;  2PYO A;  1P3P B;  5CPK D;  5AV8 D;  4YM6 D;  3W98 A;  5GXQ B;  5AY8 B;  1P3L C;  3UT9 D;  5B40 C;  1AOI A;  5GT0 C;  5KDM B;  4JJN A;  4WU8 A;  3AN2 C;  3MGP D;  1U35 D;  2HUE C;  3C1B C;  2JSS A;  4X23 C;  1KX5 A;  3AV2 A;  2F8N B;  3W99 C;  3A1I A;  3NQU B;  4KGC B;  1P3F B;  5DNM B;  3MGS D;  1S32 D;  5GSU B;  3C1C C;  3REI B;  3AZK A;  3W96 C;  3A6N C;  5GXQ D;  4H9R A;  1ZLA C;  4J8U A;  3AZE C;  5B24 B;  2Y2Q A;  3AZH B;  3AZL A;  5CP6 C;  5B33 A;  4QLC A;  3WAA D;  3X1T C;  3WKJ B;  4R8P B;  1P3M D;  4CSR B;  1BH9 B;  3REJ A;  3REK A;  2YFW B;  4DRA A;  4LD9 B;  5CPJ D;  2F8N D;  3AZI D;  5AV5 B;  3EPL A;  5F99 B;  4Z66 B;  1JFI A;  5GT3 D;  1P34 C;  5DNM D;  1F66 D;  5B2J C;  3KUY C;  1BH8 B;  3UTB C;  5B1L D;  5B31 A;  3MGQ C;  5AV9 D;  5B31 G;  1P3L B;  3KSY A;  4XUJ A;  5B40 B;  5E5A C;  3X1S D;  3AZN D;  2J8P A;  1HTA A;  1M19 C;  5GT0 B;  5CPK C;  1P3G C;  5AV8 C;  2NZD A;  3B6G A;  3AN2 B;  2HUE B;  3C1B B;  3B0C W;  5BT1 C;  2BYM B;  4ZUX C;  3UT9 C;  3AFA A;  3AZM C;  1KX3 C;  1WWI A;  2DQN C;  4M6B A;  3W99 B;  5AV5 D;  4CAY B;  4H9Q B;  4KUD D;  4J8V D;  3MGP C;  1U35 C;  3C1C B;  3X1U A;  1P3O A;  1P3B A;  3A6N B;  1ZLA B;  3W96 B;  3LJA A;  5CPI D;  3AZE B;  3MGR A;  3MGS C;  5CP6 B;  5B0Y D;  4E45 A;  4H9P B;  3X1T B;  2Y2L A;  2NQB B;  3MNN A;  1B67 A;  4J8U D;  1H3O B;  4X23 D;  4H9O B;  5B33 D;  4WJ3 C;  4G92 C;  3WAA C;  4G91 C;  1P34 B;  2XD5 A;  3AZG D;  4NE3 A;  5B2J B;  2FJ7 C;  4Z5T A;  3UTB B;  3O62 A;  3C1C D;  5CPJ C;  1M1A A;  3AYW D;  3AZI C;  3MGQ B;  4J8X C;  1KX4 D;  1ZLA D;  3V9R B;  5DNN A;  2YFV A;  3W96 D;  3AZE D;  2VQR A;  5AV6 A;  4WNN A;  5CP6 D;  1F66 C;  5B1M A;  1M19 B;  5CPK B;  1P3G B;  5AV8 B;  4YM6 B;  5B1L C;  3KXB A;  3W97 A;  5AV9 C;  3UT9 B;  3WTP C;  4ZUX B;  3B6F A;  3LEL A;  5B32 A;  4H9S A;  3EPK A;  3AZN C;  3X1S C;  2ZY4 A;  5B32 G;  3W98 C;  5B2I A;  2ZM5 A;  1P34 D;  3MGP B;  1U35 B;  1P3I D;  3KUY D;  1N1J B;  1P3P A;  3UTB D;  1Z2C B;  3MGQ D;  5FUG B;  4JJN C;  2Y2O A;  4KUD C;  4WU8 C;  3UTA D;  3MGS B;  4J8V C;  5E5A D;  5AVB A;  3AV2 C;  2ZY3 A;  1P3G D;  5KDM A;  1TAF B;  3LJA D;  3TU4 A;  2UWX A;  3MGR D;  4DRB A;  5BNX A;  5CPI C;  5BT1 D;  3AZM D;  4ZUX D;  1KX3 D;  2Y2P A;  4G92 B;  5B0Y C;  1EQZ D;  3WAA B;  4KGC A;  1P3M B;  4G91 B;  4J8U C;  4UUZ B;  3AZL C;  5GSU A;  5B33 C;  5CPJ B;  3REI A;  4QLC C;  1HQ3 A;  3AZI B;  4J8X B;  5GT3 B;  3AZG C;  3AZH A;  4H9N B;  1F66 B;  1M1A D;  3WKJ A;  4R8P A;  5DNN D;  5B1L B;  3AYW C;  5AV9 B;  1KX4 C;  3R45 B;  4LD9 A;  3WTP E;  3KWQ D;  5JA4 B;  3X1S B;  3AZN B;  3MVD A;  4YS3 A;  5F99 A;  4KHA A;  5B31 C;  2CV5 A;  4XUJ C;  2FJ7 D;  5B32 D;  4HGA C;  1F1E A;  3FDD A;  2HIO A;  4WU9 A;  2G5H C;  4J8X D;  5B0Z A;  5JRG D;  4JJN B;  4KUD B;  2NZD C;  1P3L A;  3B6G C;  4J8V B;  1B6W A;  1P3I C;  3AV2 B;  5CPI B;  2BYM A;  5AVB D;  3WTP D;  3UTA C;  4J8W D;  3W99 A;  5B0Y B;  2Y2M A;  3REH A;  2PYO D;  4H9Q A;  3X1U C;  3W98 D;  4H9R B;  3LJA C;  4J8U B;  5BNV A;  2DF4 C;  1R4V A;  3MGR C;  4X23 B;  5B33 B;  1AOI D;  2ARO A;  1ID3 A;  1EQZ C;  4JJN D;  3MNN C;  4AWL C;  4WU8 D;  3AZG B;  2Y2N A;  2ZY2 A;  1KX5 D;  3X1V A;  3AV2 D;  1HQ3 D;  3REL A;  2NQB A;  3EPH A;  5G49 A;  3AYW B;  1P3K A;  1KX4 B;  3LZ1 A;  1H3O A;  4DQY B;  1P3A A;  3WA9 A;  3AZF A;  1M1A C;  3AZK D;  5DNN C;  3F6T A;  5B2J A;  5AV6 C;  4XUJ B;  3EPJ A;  3AZL D;  3NQJ A;  4HGA B;  3AL0 C;  5B1M C;  4YS3 D;  3KWQ C;  4QLC D;  3V9R A;  2NZD B;  3B6G B;  3REJ D;  3AZJ A;  2ZY5 A;  1Q9C A;  3B6F C;  5C3I C;  3REK D;  3LEL C;  1P3I B;  5BO0 B;  1TZY A;  2Y2J A;  3KUY B;  2HIO D;  4H9S C;  5B32 C;  4WU9 D;  5CPK A;  2RIQ A;  5B0Z D;  4YM6 A;  5B2I C;  5JRG C;  1M18 A;  3UT9 A;  3AV1 A;  3UTA B;  3IP4 C;  4UPK A;  5E5A B;  2Y2K A;  2Y2H A;  1P3P C;  3X1U B;  5B31 D;  3LZ0 A;  3LJA B;  3MGR B;  3A1K A;  1N1J A;  4XUJ D;  2Y2G A;  5AVB C;  3AZM B;  1KX3 B;  4J8W C;  3REH D;  2PYO C;  1EQZ B;  5AVC A;  4XZQ A;  3MNN B;  4AWL B;  3TU4 C;  3B6G D;  2NZD D;  3MGS A;  2JCH A;  3AFA D;  1S32 A;  1ID3 D;  1AOI C;  2BYK B;  5GXQ A;  5AY8 A;  3REL D;  1M1A B;  1KX5 C;  3REI C;  1T3U A;  1HQ3 C;  3X1U D;  1P3O D;  1P3B D;  1P3M A;  5DNN B;  2YFV B;  4UUZ A;  5AV6 B;  5BS7 A;  4WNN B;  1P3A D;  3WA9 D;  5B1M B;  3KWQ B;  5CPJ A;  2F8N A;  4Z2M G;  3NQU A;  2F8N G;  3MNN D;  5GT3 A;  3AZK C;  3VH5 T;  1P3F A;  5DNM A;  4H9N A;  3LEL B;  1F66 A;  2FJ7 B;  3H0L C;  5B32 B;  3MVD C;  4YS3 C;  3KFU G;  5F99 C;  5B2I B;  5AV9 A;  2CV5 C;  5JRG B;  3R45 A;  3REJ C;  2IO5 C;  3H0R C;  1TZY D;  5B24 A;  5JA4 A;  3REK C;  3X1S A;  3AZN A;  4Z5T D;  3O62 D;  2HIO C;  4WU9 C;  5B0Z C;  4CSR A;  1M18 D;  1BH9 A;  3AV1 D;  5AV6 D;  3WTP B;  5AVB B;  2YFW A;  4NFT A;  4J8W B;  5B1M D;  2PYO B;  5AV5 A;  2F8N K;  3LZ0 D;  3W98 B;  4KUD A;  3TU4 B;  4Z66 A;  3KXB D;  1A7W A;  3W97 D;  5BNX B;  4J8V A;  3B6F D;  3P5J B;  3LEL D;  1BH8 A;  2F2A C;  3REH C;  1AOI B;  5AVC D;  4XZQ D;  2G5I C;  5B2I D;  5CPI A;  4WU8 B;  5B40 A;  3B0D C;  5B0Y A;  3AFA C;  1P3P D;  1KX5 B;  1HQ3 B;  5GT0 A;  2ARO C;  1ID3 C;  5AY8 D;  4ZBJ C;  2RVQ D;  3AN2 A;  3C1B A;  4NE6 A;  4X23 A;  4EO5 C;  3X1V C;  3REL C;  2NQB C;  4CAY A;  1P3K C;  1P3O C;  3TU4 D;  3AZK B;  1P3B C;  3LZ1 C;  3AZG A;  2XD1 A;  1PZR A;  2LY8 A;  1P3A C;  3AZL B;  1KU5 A;  3WA9 C;  3B0B A;  3C1C A;  3MVD B;  3AZF C;  4Z2M H;  4YS3 B;  4QLC B;  3AYW A;  4KGC D;  4KHA B;  2FFF B;  3W96 A;  3A6N A;  2CV5 B;  1KX4 A;  1ZLA A;  1P3F D;  2F8N H;  4WZS B;  3REJ B;  3AZE A;  2IO5 B;  5CHL B;  3REK B;  2CWE A;  5GSU D;  5CP6 A;  2HIO B;  3REI D;  4H9P A;  4WU9 B;  3X1T A;  5B0Z B;  1JFI B;  3AZJ C;  5B24 D;  3AZH D;  1TZY C;  4H9O A;  2L5A A;  1WWS A;  4Z5T C;  3WKJ D;  4YM6 C;  4R8P D;  3O62 C;  5B31 B;  1P34 A;  1M18 C;  3AV1 C;  1P3I A;  4LD9 D;  5BO0 A;  3KUY A;  1W2E A;  3UTB A;  3REH B;  3MVD D;  5F99 D;  4Z66 D;  3MGQ A;  2CV5 D;  3LZ0 C;  5BNV B;  3KXB C;  3W97 C;  3UTA A;  5E5A A;  3B0D B;  3AFA B;  1M19 A;  2ARO B;  1ID3 B;  1P3G A;  5AV8 A;  2BG1 A;  4ZBJ B;  3VH6 W;  4XZQ C;  5AVC C;  1P3L D;  1ULY A;  3B0C T;  5B40 D;  3AZM A;  4ZUX A;  1KX3 A;  3VH6 A;  1S32 C; 
#chains in the Genus database with same CATH homology
 4EO5 B;  3X1V B;  5GT0 D;  3REL B;  3H0M C;  1EQZ A;  5G49 B;  1P3K B;  1P3O B;  1P3B B;  5GXQ C;  3LZ1 B;  3AN2 D;  5AY8 C;  2RVQ C;  3C1B D;  2JE5 A;  3MGP A;  1U35 A;  1P3A B;  2Y2I A;  3WA9 B;  2W8S A;  3W99 D;  3AZF B;  2BYK A;  1BFM A;  1P3M C;  5FUG A;  3VH6 T;  5BS7 C;  3NQJ B;  2ARO D;  3A6N D;  1TAF A;  4KGC C;  5GT3 C;  3AZJ B;  1P3F C;  3VH5 W;  5DNM C;  1TZY B;  3KWQ A;  5GSU C;  3X1V D;  4Z5T B;  3VH5 A;  3X1T D;  2NQB D;  3O62 B;  3WAA A;  1P3K D;  3LZ1 D;  1M18 B;  3AV1 B;  2FJ7 A;  5B24 C;  3AZH C;  3AZF D;  3AZI A;  4J8X A;  3WKJ C;  4R8P C;  5JRG A;  3LZ0 B;  4E44 A;  3KXB B;  3W97 B;  4WV4 B;  5B2J D;  3B6F B;  5C3I B;  4LD9 C;  5AV5 C;  5B1L A;  5AVC B;  4XZQ B;  4Z66 C;  4NE5 A;  3AZJ D;  3WTP A;  4J8W A;  1S32 B;  1M19 D;  3EG5 B;  2PYO A;  1P3P B;  5CPK D;  5AV8 D;  4YM6 D;  3W98 A;  5GXQ B;  5AY8 B;  1P3L C;  3UT9 D;  5B40 C;  1AOI A;  5GT0 C;  5KDM B;  4JJN A;  4WU8 A;  3AN2 C;  3MGP D;  1U35 D;  2HUE C;  3C1B C;  2JSS A;  4X23 C;  1KX5 A;  3AV2 A;  2F8N B;  3W99 C;  3A1I A;  3NQU B;  4KGC B;  1P3F B;  5DNM B;  3MGS D;  1S32 D;  5GSU B;  3C1C C;  3REI B;  3AZK A;  3W96 C;  3A6N C;  5GXQ D;  4H9R A;  1ZLA C;  4J8U A;  3AZE C;  5B24 B;  2Y2Q A;  3AZH B;  3AZL A;  5CP6 C;  5B33 A;  4QLC A;  3WAA D;  3X1T C;  3WKJ B;  4R8P B;  1P3M D;  4CSR B;  1BH9 B;  3REJ A;  3REK A;  2YFW B;  4DRA A;  4LD9 B;  5CPJ D;  2F8N D;  3AZI D;  5AV5 B;  3EPL A;  5F99 B;  4Z66 B;  1JFI A;  5GT3 D;  1P34 C;  5DNM D;  1F66 D;  5B2J C;  3KUY C;  1BH8 B;  3UTB C;  5B1L D;  5B31 A;  3MGQ C;  5AV9 D;  5B31 G;  1P3L B;  3KSY A;  4XUJ A;  5B40 B;  5E5A C;  3X1S D;  3AZN D;  2J8P A;  1HTA A;  1M19 C;  5GT0 B;  5CPK C;  1P3G C;  5AV8 C;  2NZD A;  3B6G A;  3AN2 B;  2HUE B;  3C1B B;  3B0C W;  5BT1 C;  2BYM B;  4ZUX C;  3UT9 C;  3AFA A;  3AZM C;  1KX3 C;  1WWI A;  2DQN C;  4M6B A;  3W99 B;  5AV5 D;  4CAY B;  4H9Q B;  4KUD D;  4J8V D;  3MGP C;  1U35 C;  3C1C B;  3X1U A;  1P3O A;  1P3B A;  3A6N B;  1ZLA B;  3W96 B;  3LJA A;  5CPI D;  3AZE B;  3MGR A;  3MGS C;  5CP6 B;  5B0Y D;  4E45 A;  4H9P B;  3X1T B;  2Y2L A;  2NQB B;  3MNN A;  1B67 A;  4J8U D;  1H3O B;  4X23 D;  4H9O B;  5B33 D;  4WJ3 C;  4G92 C;  3WAA C;  4G91 C;  1P34 B;  2XD5 A;  3AZG D;  4NE3 A;  5B2J B;  2FJ7 C;  4Z5T A;  3UTB B;  3O62 A;  3C1C D;  5CPJ C;  1M1A A;  3AYW D;  3AZI C;  3MGQ B;  4J8X C;  1KX4 D;  1ZLA D;  3V9R B;  5DNN A;  2YFV A;  3W96 D;  3AZE D;  2VQR A;  5AV6 A;  4WNN A;  5CP6 D;  1F66 C;  5B1M A;  1M19 B;  5CPK B;  1P3G B;  5AV8 B;  4YM6 B;  5B1L C;  3KXB A;  3W97 A;  5AV9 C;  3UT9 B;  3WTP C;  4ZUX B;  3B6F A;  3LEL A;  5B32 A;  4H9S A;  3EPK A;  3AZN C;  3X1S C;  2ZY4 A;  5B32 G;  3W98 C;  5B2I A;  2ZM5 A;  1P34 D;  3MGP B;  1U35 B;  1P3I D;  3KUY D;  1N1J B;  1P3P A;  3UTB D;  1Z2C B;  3MGQ D;  5FUG B;  4JJN C;  2Y2O A;  4KUD C;  4WU8 C;  3UTA D;  3MGS B;  4J8V C;  5E5A D;  5AVB A;  3AV2 C;  2ZY3 A;  1P3G D;  5KDM A;  1TAF B;  3LJA D;  3TU4 A;  2UWX A;  3MGR D;  4DRB A;  5BNX A;  5CPI C;  5BT1 D;  3AZM D;  4ZUX D;  1KX3 D;  2Y2P A;  4G92 B;  5B0Y C;  1EQZ D;  3WAA B;  4KGC A;  1P3M B;  4G91 B;  4J8U C;  4UUZ B;  3AZL C;  5GSU A;  5B33 C;  5CPJ B;  3REI A;  4QLC C;  1HQ3 A;  3AZI B;  4J8X B;  5GT3 B;  3AZG C;  3AZH A;  4H9N B;  1F66 B;  1M1A D;  3WKJ A;  4R8P A;  5DNN D;  5B1L B;  3AYW C;  5AV9 B;  1KX4 C;  3R45 B;  4LD9 A;  3WTP E;  3KWQ D;  5JA4 B;  3X1S B;  3AZN B;  3MVD A;  4YS3 A;  5F99 A;  4KHA A;  5B31 C;  2CV5 A;  4XUJ C;  2FJ7 D;  5B32 D;  4HGA C;  1F1E A;  3FDD A;  2HIO A;  4WU9 A;  2G5H C;  4J8X D;  5B0Z A;  5JRG D;  4JJN B;  4KUD B;  2NZD C;  1P3L A;  3B6G C;  4J8V B;  1B6W A;  1P3I C;  3AV2 B;  5CPI B;  2BYM A;  5AVB D;  3WTP D;  3UTA C;  4J8W D;  3W99 A;  5B0Y B;  2Y2M A;  3REH A;  2PYO D;  4H9Q A;  3X1U C;  3W98 D;  4H9R B;  3LJA C;  4J8U B;  5BNV A;  2DF4 C;  1R4V A;  3MGR C;  4X23 B;  5B33 B;  1AOI D;  2ARO A;  1ID3 A;  1EQZ C;  4JJN D;  3MNN C;  4AWL C;  4WU8 D;  3AZG B;  2Y2N A;  2ZY2 A;  1KX5 D;  3X1V A;  3AV2 D;  1HQ3 D;  3REL A;  2NQB A;  3EPH A;  5G49 A;  3AYW B;  1P3K A;  1KX4 B;  3LZ1 A;  1H3O A;  4DQY B;  1P3A A;  3WA9 A;  3AZF A;  1M1A C;  3AZK D;  5DNN C;  3F6T A;  5B2J A;  5AV6 C;  4XUJ B;  3EPJ A;  3AZL D;  3NQJ A;  4HGA B;  3AL0 C;  5B1M C;  4YS3 D;  3KWQ C;  4QLC D;  3V9R A;  2NZD B;  3B6G B;  3REJ D;  3AZJ A;  2ZY5 A;  1Q9C A;  3B6F C;  5C3I C;  3REK D;  3LEL C;  1P3I B;  5BO0 B;  1TZY A;  2Y2J A;  3KUY B;  2HIO D;  4H9S C;  5B32 C;  4WU9 D;  5CPK A;  2RIQ A;  5B0Z D;  4YM6 A;  5B2I C;  5JRG C;  1M18 A;  3UT9 A;  3AV1 A;  3UTA B;  3IP4 C;  4UPK A;  5E5A B;  2Y2K A;  2Y2H A;  1P3P C;  3X1U B;  5B31 D;  3LZ0 A;  3LJA B;  3MGR B;  3A1K A;  1N1J A;  4XUJ D;  2Y2G A;  5AVB C;  3AZM B;  1KX3 B;  4J8W C;  3REH D;  2PYO C;  1EQZ B;  5AVC A;  4XZQ A;  3MNN B;  4AWL B;  3TU4 C;  3B6G D;  2NZD D;  3MGS A;  2JCH A;  3AFA D;  1S32 A;  1ID3 D;  1AOI C;  2BYK B;  5GXQ A;  5AY8 A;  3REL D;  1M1A B;  1KX5 C;  3REI C;  1T3U A;  1HQ3 C;  3X1U D;  1P3O D;  1P3B D;  1P3M A;  5DNN B;  2YFV B;  4UUZ A;  5AV6 B;  5BS7 A;  4WNN B;  1P3A D;  3WA9 D;  5B1M B;  3KWQ B;  5CPJ A;  2F8N A;  4Z2M G;  3NQU A;  2F8N G;  3MNN D;  5GT3 A;  3AZK C;  3VH5 T;  1P3F A;  5DNM A;  4H9N A;  3LEL B;  1F66 A;  2FJ7 B;  3H0L C;  5B32 B;  3MVD C;  4YS3 C;  3KFU G;  5F99 C;  5B2I B;  5AV9 A;  2CV5 C;  5JRG B;  3R45 A;  3REJ C;  2IO5 C;  3H0R C;  1TZY D;  5B24 A;  5JA4 A;  3REK C;  3X1S A;  3AZN A;  4Z5T D;  3O62 D;  2HIO C;  4WU9 C;  5B0Z C;  4CSR A;  1M18 D;  1BH9 A;  3AV1 D;  5AV6 D;  3WTP B;  5AVB B;  2YFW A;  4NFT A;  4J8W B;  5B1M D;  2PYO B;  5AV5 A;  2F8N K;  3LZ0 D;  3W98 B;  4KUD A;  3TU4 B;  4Z66 A;  3KXB D;  1A7W A;  3W97 D;  5BNX B;  4J8V A;  3B6F D;  3P5J B;  3LEL D;  1BH8 A;  2F2A C;  3REH C;  1AOI B;  5AVC D;  4XZQ D;  2G5I C;  5B2I D;  5CPI A;  4WU8 B;  5B40 A;  3B0D C;  5B0Y A;  3AFA C;  1P3P D;  1KX5 B;  1HQ3 B;  5GT0 A;  2ARO C;  1ID3 C;  5AY8 D;  4ZBJ C;  2RVQ D;  3AN2 A;  3C1B A;  4NE6 A;  4X23 A;  4EO5 C;  3X1V C;  3REL C;  2NQB C;  4CAY A;  1P3K C;  1P3O C;  3TU4 D;  3AZK B;  1P3B C;  3LZ1 C;  3AZG A;  2XD1 A;  1PZR A;  2LY8 A;  1P3A C;  3AZL B;  1KU5 A;  3WA9 C;  3B0B A;  3C1C A;  3MVD B;  3AZF C;  4Z2M H;  4YS3 B;  4QLC B;  3AYW A;  4KGC D;  4KHA B;  2FFF B;  3W96 A;  3A6N A;  2CV5 B;  1KX4 A;  1ZLA A;  1P3F D;  2F8N H;  4WZS B;  3REJ B;  3AZE A;  2IO5 B;  5CHL B;  3REK B;  2CWE A;  5GSU D;  5CP6 A;  2HIO B;  3REI D;  4H9P A;  4WU9 B;  3X1T A;  5B0Z B;  1JFI B;  3AZJ C;  5B24 D;  3AZH D;  1TZY C;  4H9O A;  2L5A A;  1WWS A;  4Z5T C;  3WKJ D;  4YM6 C;  4R8P D;  3O62 C;  5B31 B;  1P34 A;  1M18 C;  3AV1 C;  1P3I A;  4LD9 D;  5BO0 A;  3KUY A;  1W2E A;  3UTB A;  3REH B;  3MVD D;  5F99 D;  4Z66 D;  3MGQ A;  2CV5 D;  3LZ0 C;  5BNV B;  3KXB C;  3W97 C;  3UTA A;  5E5A A;  3B0D B;  3AFA B;  1M19 A;  2ARO B;  1ID3 B;  1P3G A;  5AV8 A;  2BG1 A;  4ZBJ B;  3VH6 W;  4XZQ C;  5AVC C;  1P3L D;  1ULY A;  3B0C T;  5B40 D;  3AZM A;  4ZUX A;  1KX3 A;  3VH6 A;  1S32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...