4WU9B

Structure of cisptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9B00
1M19C 3AZNB 1WWSA 5AV8C 5AVCD 3B0CW 5B31A 3LJAC 1P3KC 5B0ZD 3WTPD 3RELB 1P3AB 5B2JC 3AZGB 3WKJA 5B1MA 5BNXB 3R45B 2YFVA 3AZED 1KX3B 3UT9B 3AV2D 4J8XB 4J8WA 3AZMA 3C1CD 3V9RB 5CPJD 3REHA 2AROD 3AN2A 5B40D 1ID3D 5E5AA 4ZUXD 5B31G 1S32C 4KGCB 1WWIA 5B32C 5CPID 5B0YB 3X1TB 1U35B 1EQZB 4Z5TB 4XZQC 5BNVA 5AV6D 5AV8B 4J8VC 3AZLA 1KX5A 3MVDA 1P3KB 5B2JB 3AZND 1P34C 5AV5A 3KXBA 3B6GC 1HQ3C 3RELD 4YM6C 3B6FB 4LD9C 4YS3B 5AY8C 3MGPC 5CPIA 4G91B 3AYWA 1P3PC 5JRGA 3VH5T 5AV9C 1S32B 5G49A 1P3OB 2NQBB 1BFMA 1P3GC 2CV5C 1BH8B 3MGQA 1P3AA 4WU8A 5B0YD 3X1TD 3AZGA 5BS7C 1U35D 1EQZD 4Z5TD 3MNNB 3R45A 1TZYC 5AV8D 4H9QA 1P34B 3UT9A 1KX3A 3AZHC 4J8XA 3B6GB 4ZBJC 1HQ3B 1P3IC 2JSSA 1ZLAD 4LD9B 3W98A 5AY8B 3O62C 3AZFC 3B6FD 2RVQC 1P3PB 2L5AA 4KGCA 4YS3D 5AV9B 5CPKC 4Z66D 3REKA 5AVCC 3W96C 3X1SA 3TU4D 1P3GB 3VH5A 1M19A 2BYKA 1S32D 5B0ZC 3WAAB 2CV5B 1P3OD 3LJAA 3MGSC 4J8UB 1P3KA 2NQBD 5B2JA 3AV2C 2F8NH 1TZYB 3WTPE 3UTBA 3C1CC 3AZHB 5CPJC 5C3IB 1P3IB 3MNND 3AZIB 2AROC 1ID3C 2YFWB 4NFTA 4ZUXC 3B6GD 3MGRA 3O62B 3AZFB 2CWEA 1S32A 4LD9D 2HIOC 5B32A 5CPKB 4E45A 2NZDB 5AV6C 4XZQA 3B0DC 3W96B 5AV9D 4J8VA 3MGSB 3AZNC 3W99C 1P3GD 3NQJA 4M6BA 5GXQB 1P34A 3WAAD 5JA4A 4J8UD 1HQ3A 3X1VD 4YM6A 3WA9C 5GT3B 3C1CB 4CAYB 5CPJB 3REIA 3REJD 5AY8A 3MGPA 2AROB 1P3PA 4ZUXB 5B33C 5AV9A 3AZID 1P3BB 2HIOB 5B24A 3AZFD 3C1BD 3AZJA 3B0BA 2CV5A 5GSUA 5AV6B 5B0YC 4H9OB 3B0DB 5BO0B 1U35C 5CPKD 1EQZC 1P3LA 3B0CT 5B1LB 5BS7A 5DNMD 2NZDD 3W99B 3W96D 1TZYA 3AZKC 3AZHA 3MGSD 5DNND 3AV1A 1P3IA 1ZLAC 5CP6C 3WA9B 5GXQD 2YFWA 4X23C 3B6FC 3O62A 3AZFA 4YS3C 5GT3D 1M1AD 4Z66C 4G91C 5B33B 3LZ1C 5CPKA 3TU4C 3KUYB 1BH9B 4Z2MG 5AVBD 5AVCA 3W96A 1P3OC 2NQBC 5B0ZA 3WTPA 1P3BD 2HIOD 3VH6A 3LZ0B 1N1JB 1F1EA 2FJ7B 1B67A 3AZEA 5FUGA 3AV2A 3AZKB 3MNNC 3C1CA 5B1LD 4H9SC 5CPJA 3W99D 1ZLAB 5CP6B 2AROA 5B40A 1ID3A 4X23B 4ZUXA 4QLCB 3LELD 3WA9D 4Z66B 3LZ1B 3TU4B 3W97C 5AV6A 4H9OA 5B33D 5BO0A 1P3FB 4XUJC 3KUYD 3AZNA 4H9NB 3WAAC 5B2ID 3AFAD 3X1VC 4J8UC 1M18D 3RELA 1R4VA 3LZ0D 2FJ7D 5BNXA 3REJC 4WU9D 4HGAB 5C3IC 3AZKD 3AZIC 3V9RA 3UTAC 4WNNB 5CP6D 4H9RB 3C1BC 3VH5W 1KX4D 4X23D 4QLCD 3W97B 4JJND 5B0YA 2F8NK 3LZ1D 3X1TA 2NZDC 1N1JA 5DNMC 4Z5TA 1U35A 4XUJB 4H9PB 1EQZA 5AV8A 5DNNC 3X1VB 1P3FD 1F66A 4G92C 5GXQC 1ZLAA 1AOID 3REJB 4NE3A 1P3MD 3WKJC 2BYMB 1H3OB 3B6FA 5GT3C 1M1AC 1TAFB 3AZMC 4YS3A 4Z66A 3UTAB 5F99B 5AVBC 2F8NB 2PYOB 3TU4A 3C1BB 4E44A 1P3BC 1P3OA 3A6NB 2NQBA 5GT0B 4R8PB 5DNMB 1BH8A 1F66B 3W97D 3X1UB 5B1LC 5DNNB 4XUJD 5B31B 3MNNA 4H9SA 4G92B 3B6GA 3WKJB 5B1MB 3LELC 4LD9A 1M1AB 4WNNA 3AZMB 3KWQD 5AVBB 3AYWC 3REHB 3W97A 4AWLB 3UTAD 3KUYC 2HUEB 5F99D 2F8ND 4XUJA 4H9PA 2PYOD 1P3GA 5B2IC 3AFAC 1M18C 3WAAA 3A6ND 4J8UA 3X1VA 3LZ0C 4DRAA 2FJ7C 5GT0D 4WU8C 4R8PD 1JFIB 1F66D 3REJA 3X1UD 4WU9C 1HTAA 1H3OA 3KSYA 1TAFA 5AV5B 5B31D 3KXBB 3AZIA 3LELB 1KX4C 3WKJD 5B1MD 4QLCC 3C1BA 1A7WA 4JJNC 3AYWB 3VH6W 5JRGB 4J8WD 3AZMD 4DRBA 2NZDA 5DNMA 5G49B 3REHD 5B2IB 3AFAB 3AN2D 1P3FC 1M18B 5E5AD 3MGSA 2IO5C 5DNNA 4KUDC 3MGQB 4WZSB 1AOIC 5GXQA 4WU8B 1P3MC 2F8NG 4WU9B 4EO5B 5GT3A 1M1AA 4H9QB 4CAYA 3AZLD 3UTBC 1KX5D 3MVDD 4HGAC 1KX4B 5AVBA 5AV5D 3KXBD 4NE5A 5KDMB 3MGRC 3W98B 1Q9CA 4JJNB 2HIOA 1P3BA 4UUZB 3AYWD 5JRGD 3REKB 3X1SB 1M19B 2BYKB 5B1LA 2IO5B 4KUDB 3W99A 3LJAB 5BT1C 1JFIA 1AOIB 1P3MB 3MGQD 3WA9A 3LELA 1P3AD 4WU8D 4NE6A 3KWQC 3UTBB 3AZGD 3REIC 1KX3D 3UT9D 5B33A 4J8XD 5F99C 3MGRB 2PYOC 1B6WA 3KUYA 1BH9A 3NQUB 5B24C 3W98D 5B2IA 5B32B 3A6NC 3AFAA 1M18A 3AZJC 5GSUC 5GT0C 3LZ0A 4XZQB 4R8PC 4KGCD 2FJ7A 1F66C 3X1UC 4J8VB 1P3LC 3REKD 4WU9A 3X1SD 3NQJB 5B31C 3AZKA 1M19D 4KUDD 5JA4B 1KU5A 3LJAD 3AV1C 1P3KD 5CP6A 4CSRB 4YM6B 3KWQB 5B1MC 5B2JD 1KX4A 4X23A 5KDMA 4QLCA 3REIB 3MGPB 4J8WC 4JJNA 3UTBD 4UUZA 3LZ1A 3REHC 3AN2C 4AWLC 2HUEC 5E5AC 5B24B 3MGRD 1P3FA 4Z2MH 3AZJB 5CHLB 3WTPC 4KUDA 5GSUB 4H9NA 5B32D 4KHAB 1AOIA 1P3MA 1P3LB 4XZQD 3AZEC 3AZLC 1KX5C 3MVDC 4WV4B 4J8VD 1ULYA 3AV1B 5BT1D 4ZBJB 5AV5C 3KXBC 1P34D 5B40C 2YFVB 1HQ3D 4H9RA 4J8WB 4YM6D 5CPIC 3NQUA 3REID 5AY8D 5JRGC 3MGPD 3AN2B 1P3PD 5E5AB 2LY8A 5AVCB 3WTPB 5B0ZB 5B24D 3AZJD 3MGQC 3RELC 5BNVB 2CV5D 5GSUD 1P3AC 3AZEB 3AZLB 5FUGB 3AZGC 4CSRA 3AV2B 3MVDB 1KX5B 3KWQA 1P3LD 2BYMA 4EO5C 5B32G 1KX3C 3UT9C 4J8XC 1TZYD 5B40B 3UTAA 3AZHD 3AV1D 1ID3B 5F99A 1P3ID 2F8NA 2PYOA 3W98C 3VH6T 5CPIB 3A6NA 3O62D 4KGCC 2RVQD 5GT0A 4R8PA 3X1TC 4KHAA 3REKC 4Z5TC 3X1UA 3X1SC
chains in the Genus database with same CATH superfamily
3KFUG 1M19C 3AZNB 1WWSA 5AV8C 5AVCD 3B0CW 5B31A 3LJAC 1P3KC 5B0ZD 3WTPD 3RELB 1P3AB 5B2JC 3AZGB 3WKJA 2XD1A 5B1MA 5BNXB 3R45B 2YFVA 3AZED 1KX3B 3UT9B 3AV2D 4J8XB 4J8WA 3AZMA 2G5HC 3C1CD 3V9RB 5CPJD 3REHA 2AROD 3AN2A 5B40D 1ID3D 5E5AA 4ZUXD 2G5IC 5B31G 2UWXA 1S32C 4KGCB 1WWIA 5B32C 5CPID 5B0YB 3H0LC 2Y2GA 3X1TB 1U35B 1EQZB 4Z5TB 4XZQC 5BNVA 5AV6D 5AV8B 2DF4C 4J8VC 3AZLA 1KX5A 3MVDA 1P3KB 5B2JB 3AZND 1P34C 5AV5A 3KXBA 3B6GC 1HQ3C 3RELD 4YM6C 3B6FB 4WJ3C 4LD9C 4YS3B 5AY8C 3MGPC 5CPIA 4G91B 3AYWA 1P3PC 5JRGA 3VH5T 3EPKA 5AV9C 1S32B 5G49A 1P3OB 2NQBB 1BFMA 1P3GC 2CV5C 1BH8B 3MGQA 1P3AA 4WU8A 5B0YD 3X1TD 3AZGA 5BS7C 1U35D 1EQZD 4Z5TD 3MNNB 3R45A 1TZYC 5AV8D 4H9QA 1P34B 3UT9A 1KX3A 3AZHC 4J8XA 3B6GB 4ZBJC 1HQ3B 1P3IC 2JSSA 1ZLAD 4LD9B 3W98A 5AY8B 3O62C 3AZFC 3B6FD 2RVQC 1P3PB 2Y2HA 1PZRA 2L5AA 4KGCA 4YS3D 5AV9B 5CPKC 4Z66D 3REKA 5AVCC 3W96C 3X1SA 3TU4D 1P3GB 3VH5A 1M19A 2BYKA 1S32D 5B0ZC 3WAAB 3EG5B 2CV5B 1P3OD 3LJAA 3MGSC 4J8UB 1P3KA 2NQBD 5B2JA 3F6TA 3AV2C 2F8NH 1TZYB 3WTPE 3UTBA 3C1CC 3AZHB 5CPJC 5C3IB 4DQYB 1P3IB 3MNND 3AZIB 3IP4C 2AROC 1ID3C 2YFWB 2Y2OA 4NFTA 4ZUXC 3MGRA 3B6GD 3O62B 3AZFB 2CWEA 1S32A 4LD9D 2HIOC 5B32A 5CPKB 4E45A 2NZDB 5AV6C 4XZQA 3B0DC 2JCHA 3W96B 5AV9D 4J8VA 3MGSB 3AZNC 3W99C 1P3GD 3NQJA 4M6BA 5GXQB 1P34A 3WAAD 5JA4A 4J8UD 1HQ3A 3X1VD 4YM6A 3WA9C 5GT3B 3C1CB 4CAYB 5CPJB 3REIA 3REJD 5AY8A 3MGPA 2AROB 1P3PA 4ZUXB 3FDDA 5B33C 5AV9A 3AZID 1P3BB 2HIOB 2J8PA 5B24A 3AZFD 3C1BD 3AZJA 3B0BA 2CV5A 5GSUA 5AV6B 5B0YC 4H9OB 3B0DB 5BO0B 1U35C 5CPKD 1EQZC 1P3LA 3B0CT 5B1LB 5BS7A 5DNMD 2NZDD 3W99B 3W96D 1TZYA 3AZKC 3AZHA 3MGSD 5DNND 3AV1A 2W8SA 1P3IA 1ZLAC 3AL0C 5CP6C 3WA9B 2ZY4A 5GXQD 2YFWA 4X23C 3B6FC 3O62A 3AZFA 4YS3C 5GT3D 1M1AD 4Z66C 4G91C 5B33B 3LZ1C 5CPKA 3TU4C 3KUYB 1BH9B 4Z2MG 5AVBD 5AVCA 3W96A 1P3OC 2NQBC 5B0ZA 3WTPA 1P3BD 2HIOD 3VH6A 3LZ0B 1N1JB 1F1EA 2FJ7B 1B67A 3AZEA 5FUGA 3AV2A 3AZKB 3MNNC 3C1CA 5B1LD 4H9SC 5CPJA 3W99D 1ZLAB 5CP6B 2AROA 5B40A 1ID3A 4X23B 4ZUXA 4QLCB 3LELD 3WA9D 4Z66B 3LZ1B 3TU4B 3W97C 5AV6A 2ZM5A 5B33D 4H9OA 1Z2CB 5BO0A 1P3FB 4XUJC 3KUYD 3AZNA 4H9NB 3WAAC 5B2ID 2Y2QA 3AFAD 3X1VC 4J8UC 1M18D 3RELA 1R4VA 3LZ0D 2Y2KA 2FJ7D 5BNXA 3REJC 4WU9D 4HGAB 5C3IC 3AZKD 3AZIC 3V9RA 3UTAC 4WNNB 5CP6D 4H9RB 3C1BC 3VH5W 1KX4D 4X23D 4QLCD 3W97B 4JJND 2DQNC 5B0YA 2F8NK 4UPKA 3LZ1D 3X1TA 2NZDC 1N1JA 5DNMC 4Z5TA 1U35A 4XUJB 4H9PB 1EQZA 2RIQA 5AV8A 1W2EA 5DNNC 3X1VB 1P3FD 2JE5A 2Y2IA 1F66A 4G92C 5GXQC 1ZLAA 1AOID 3REJB 2Y2JA 4NE3A 1P3MD 3WKJC 2BYMB 1H3OB 3B6FA 5GT3C 1M1AC 1TAFB 3AZMC 4YS3A 4Z66A 3UTAB 5F99B 5AVBC 2F8NB 2PYOB 3TU4A 3C1BB 4E44A 1P3BC 1P3OA 3A6NB 2NQBA 5GT0B 4R8PB 5DNMB 1BH8A 1F66B 3W97D 3X1UB 5B1LC 5DNNB 4XUJD 5B31B 3MNNA 4H9SA 4G92B 3B6GA 3WKJB 5B1MB 3LELC 3H0MC 4LD9A 1M1AB 4WNNA 3AZMB 3KWQD 5AVBB 3AYWC 3REHB 3W97A 2ZY5A 4AWLB 3UTAD 3KUYC 2HUEB 5F99D 2F8ND 4XUJA 4H9PA 2PYOD 1P3GA 5B2IC 3AFAC 1M18C 3WAAA 3EPLA 3A6ND 4J8UA 3X1VA 3LZ0C 4DRAA 2FJ7C 5GT0D 4WU8C 4R8PD 2Y2MA 1JFIB 1F66D 3REJA 3X1UD 4WU9C 1HTAA 1H3OA 2Y2NA 3KSYA 1TAFA 5AV5B 5B31D 3KXBB 3AZIA 3LELB 1KX4C 3WKJD 5B1MD 4QLCC 3C1BA 1A7WA 2Y2PA 4JJNC 3AYWB 3VH6W 5JRGB 4J8WD 3AZMD 4DRBA 2NZDA 5DNMA 3H0RC 5G49B 3REHD 5B2IB 3AFAB 3AN2D 1P3FC 1M18B 5E5AD 3MGSA 2IO5C 5DNNA 4KUDC 2FFFB 3MGQB 4WZSB 1AOIC 5GXQA 3A1KA 4WU8B 1P3MC 2F8NG 4WU9B 4EO5B 5GT3A 1M1AA 4H9QB 4CAYA 3P5JB 3UTBC 3AZLD 1KX5D 3MVDD 2VQRA 2ZY2A 4HGAC 1KX4B 5AVBA 5AV5D 3KXBD 4NE5A 5KDMB 3MGRC 3W98B 1Q9CA 4JJNB 2HIOA 1P3BA 4UUZB 3AYWD 5JRGD 3REKB 3X1SB 1M19B 2BYKB 5B1LA 2IO5B 4KUDB 3W99A 3LJAB 5BT1C 1JFIA 1AOIB 1P3MB 3MGQD 3WA9A 3LELA 1P3AD 4WU8D 4NE6A 3KWQC 3UTBB 3AZGD 3REIC 3A1IA 1KX3D 3UT9D 5B33A 4J8XD 5F99C 3MGRB 2PYOC 1B6WA 3KUYA 1BH9A 3NQUB 5B24C 3W98D 5B2IA 5B32B 3A6NC 3AFAA 1M18A 3AZJC 5GSUC 5GT0C 3LZ0A 4XZQB 4R8PC 2XD5A 4KGCD 2FJ7A 1F66C 3X1UC 4J8VB 1P3LC 3REKD 4WU9A 3X1SD 3NQJB 5B31C 3AZKA 1M19D 4KUDD 5JA4B 1KU5A 3LJAD 3AV1C 1P3KD 5CP6A 4CSRB 4YM6B 3KWQB 5B1MC 5B2JD 1KX4A 4X23A 5KDMA 4QLCA 3REIB 3MGPB 4J8WC 2Y2LA 4JJNA 3UTBD 4UUZA 3LZ1A 3REHC 3AN2C 4AWLC 2HUEC 5E5AC 2F2AC 5B24B 3MGRD 1P3FA 4Z2MH 3AZJB 5CHLB 3WTPC 4KUDA 5GSUB 4H9NA 5B32D 4KHAB 1AOIA 1P3MA 1P3LB 4XZQD 3AZEC 3AZLC 3EPHA 1KX5C 3MVDC 4WV4B 4J8VD 1ULYA 3AV1B 5BT1D 4ZBJB 5AV5C 3KXBC 1P34D 5B40C 2YFVB 1HQ3D 4H9RA 4J8WB 4YM6D 5CPIC 3NQUA 3REID 5AY8D 5JRGC 3MGPD 3AN2B 1P3PD 5E5AB 2LY8A 5AVCB 2BG1A 2ZY3A 3WTPB 5B0ZB 5B24D 3EPJA 3AZJD 3MGQC 3RELC 5BNVB 2CV5D 5GSUD 1P3AC 3AZEB 3AZLB 5FUGB 3AZGC 4CSRA 3AV2B 3MVDB 1KX5B 3KWQA 1P3LD 2BYMA 4EO5C 5B32G 1KX3C 3UT9C 4J8XC 1TZYD 5B40B 3UTAA 3AZHD 3AV1D 1ID3B 5F99A 1P3ID 2F8NA 2PYOA 3W98C 3VH6T 5CPIB 3A6NA 3O62D 1T3UA 4KGCC 2RVQD 5GT0A 4R8PA 3X1TC 4KHAA 3REKC 4Z5TC 3X1UA 3X1SC
chains in the Genus database with same CATH topology
3KFUG 1M19C 3AZNB 1WWSA 5AV8C 5AVCD 3B0CW 5B31A 3LJAC 1P3KC 5B0ZD 3WTPD 3RELB 1P3AB 5B2JC 3AZGB 3WKJA 2XD1A 5B1MA 5BNXB 3R45B 2YFVA 3AZED 1KX3B 3UT9B 3AV2D 4J8XB 4J8WA 3AZMA 2G5HC 3C1CD 3V9RB 5CPJD 3REHA 2AROD 3AN2A 5B40D 1ID3D 5E5AA 4ZUXD 2G5IC 5B31G 2UWXA 1S32C 4KGCB 1WWIA 5B32C 5CPID 5B0YB 3H0LC 2Y2GA 3X1TB 1U35B 1EQZB 4Z5TB 4XZQC 5BNVA 5AV6D 5AV8B 2DF4C 4J8VC 3AZLA 1KX5A 3MVDA 1P3KB 5B2JB 3AZND 1P34C 5AV5A 3KXBA 3B6GC 1HQ3C 3RELD 4YM6C 3B6FB 4WJ3C 4LD9C 4YS3B 5AY8C 3MGPC 5CPIA 4G91B 3AYWA 1P3PC 5JRGA 3VH5T 3EPKA 5AV9C 1S32B 5G49A 1P3OB 2NQBB 1BFMA 1P3GC 2CV5C 1BH8B 3MGQA 1P3AA 4WU8A 5B0YD 3X1TD 3AZGA 5BS7C 1U35D 1EQZD 4Z5TD 3MNNB 3R45A 1TZYC 5AV8D 4H9QA 1P34B 3UT9A 1KX3A 3AZHC 4J8XA 3B6GB 4ZBJC 1HQ3B 1P3IC 2JSSA 1ZLAD 4LD9B 3W98A 5AY8B 3O62C 3AZFC 3B6FD 2RVQC 1P3PB 2Y2HA 1PZRA 2L5AA 4KGCA 4YS3D 5AV9B 5CPKC 4Z66D 3REKA 5AVCC 3W96C 3X1SA 3TU4D 1P3GB 3VH5A 1M19A 2BYKA 1S32D 5B0ZC 3WAAB 3EG5B 2CV5B 1P3OD 3LJAA 3MGSC 4J8UB 1P3KA 2NQBD 5B2JA 3F6TA 3AV2C 2F8NH 1TZYB 3WTPE 3UTBA 3C1CC 3AZHB 5CPJC 5C3IB 4DQYB 1P3IB 3MNND 3AZIB 3IP4C 2AROC 1ID3C 2YFWB 2Y2OA 4NFTA 4ZUXC 3MGRA 3B6GD 3O62B 3AZFB 2CWEA 1S32A 4LD9D 2HIOC 5B32A 5CPKB 4E45A 2NZDB 5AV6C 4XZQA 3B0DC 2JCHA 3W96B 5AV9D 4J8VA 3MGSB 3AZNC 3W99C 1P3GD 3NQJA 4M6BA 5GXQB 1P34A 3WAAD 5JA4A 4J8UD 1HQ3A 3X1VD 4YM6A 3WA9C 5GT3B 3C1CB 4CAYB 5CPJB 3REIA 3REJD 5AY8A 3MGPA 2AROB 1P3PA 4ZUXB 3FDDA 5B33C 5AV9A 3AZID 1P3BB 2HIOB 2J8PA 5B24A 3AZFD 3C1BD 3AZJA 3B0BA 2CV5A 5GSUA 5AV6B 5B0YC 4H9OB 3B0DB 5BO0B 1U35C 5CPKD 1EQZC 1P3LA 3B0CT 5B1LB 5BS7A 5DNMD 2NZDD 3W99B 3W96D 1TZYA 3AZKC 3AZHA 3MGSD 5DNND 3AV1A 2W8SA 1P3IA 1ZLAC 3AL0C 5CP6C 3WA9B 2ZY4A 5GXQD 2YFWA 4X23C 3B6FC 3O62A 3AZFA 4YS3C 5GT3D 1M1AD 4Z66C 4G91C 5B33B 3LZ1C 5CPKA 3TU4C 3KUYB 1BH9B 4Z2MG 5AVBD 5AVCA 3W96A 1P3OC 2NQBC 5B0ZA 3WTPA 1P3BD 2HIOD 3VH6A 3LZ0B 1N1JB 1F1EA 2FJ7B 1B67A 3AZEA 5FUGA 3AV2A 3AZKB 3MNNC 3C1CA 5B1LD 4H9SC 5CPJA 3W99D 1ZLAB 5CP6B 2AROA 5B40A 1ID3A 4X23B 4ZUXA 4QLCB 3LELD 3WA9D 4Z66B 3LZ1B 3TU4B 3W97C 5AV6A 2ZM5A 5B33D 4H9OA 1Z2CB 5BO0A 1P3FB 4XUJC 3KUYD 3AZNA 4H9NB 3WAAC 5B2ID 2Y2QA 3AFAD 3X1VC 4J8UC 1M18D 3RELA 1R4VA 3LZ0D 2Y2KA 2FJ7D 5BNXA 3REJC 4WU9D 4HGAB 5C3IC 3AZKD 3AZIC 3V9RA 3UTAC 4WNNB 5CP6D 4H9RB 3C1BC 3VH5W 1KX4D 4X23D 4QLCD 3W97B 4JJND 2DQNC 5B0YA 2F8NK 4UPKA 3LZ1D 3X1TA 2NZDC 1N1JA 5DNMC 4Z5TA 1U35A 4XUJB 4H9PB 1EQZA 2RIQA 5AV8A 1W2EA 5DNNC 3X1VB 1P3FD 2JE5A 2Y2IA 1F66A 4G92C 5GXQC 1ZLAA 1AOID 3REJB 2Y2JA 4NE3A 1P3MD 3WKJC 2BYMB 1H3OB 3B6FA 5GT3C 1M1AC 1TAFB 3AZMC 4YS3A 4Z66A 3UTAB 5F99B 5AVBC 2F8NB 2PYOB 3TU4A 3C1BB 4E44A 1P3BC 1P3OA 3A6NB 2NQBA 5GT0B 4R8PB 5DNMB 1BH8A 1F66B 3W97D 3X1UB 5B1LC 5DNNB 4XUJD 5B31B 3MNNA 4H9SA 4G92B 3B6GA 3WKJB 5B1MB 3LELC 3H0MC 4LD9A 1M1AB 4WNNA 3AZMB 3KWQD 5AVBB 3AYWC 3REHB 3W97A 2ZY5A 4AWLB 3UTAD 3KUYC 2HUEB 5F99D 2F8ND 4XUJA 4H9PA 2PYOD 1P3GA 5B2IC 3AFAC 1M18C 3WAAA 3EPLA 3A6ND 4J8UA 3X1VA 3LZ0C 4DRAA 2FJ7C 5GT0D 4WU8C 4R8PD 2Y2MA 1JFIB 1F66D 3REJA 3X1UD 4WU9C 1HTAA 1H3OA 2Y2NA 3KSYA 1TAFA 5AV5B 5B31D 3KXBB 3AZIA 3LELB 1KX4C 3WKJD 5B1MD 4QLCC 3C1BA 1A7WA 2Y2PA 4JJNC 3AYWB 3VH6W 5JRGB 4J8WD 3AZMD 4DRBA 2NZDA 5DNMA 3H0RC 5G49B 3REHD 5B2IB 3AFAB 3AN2D 1P3FC 1M18B 5E5AD 3MGSA 2IO5C 5DNNA 4KUDC 2FFFB 3MGQB 4WZSB 1AOIC 5GXQA 3A1KA 4WU8B 1P3MC 2F8NG 4WU9B 4EO5B 5GT3A 1M1AA 4H9QB 4CAYA 3P5JB 3UTBC 3AZLD 1KX5D 3MVDD 2VQRA 2ZY2A 4HGAC 1KX4B 5AVBA 5AV5D 3KXBD 4NE5A 5KDMB 3MGRC 3W98B 1Q9CA 4JJNB 2HIOA 1P3BA 4UUZB 3AYWD 5JRGD 3REKB 3X1SB 1M19B 2BYKB 5B1LA 2IO5B 4KUDB 3W99A 3LJAB 5BT1C 1JFIA 1AOIB 1P3MB 3MGQD 3WA9A 3LELA 1P3AD 4WU8D 4NE6A 3KWQC 3UTBB 3AZGD 3REIC 3A1IA 1KX3D 3UT9D 5B33A 4J8XD 5F99C 3MGRB 2PYOC 1B6WA 3KUYA 1BH9A 3NQUB 5B24C 3W98D 5B2IA 5B32B 3A6NC 3AFAA 1M18A 3AZJC 5GSUC 5GT0C 3LZ0A 4XZQB 4R8PC 2XD5A 4KGCD 2FJ7A 1F66C 3X1UC 4J8VB 1P3LC 3REKD 4WU9A 3X1SD 3NQJB 5B31C 3AZKA 1M19D 4KUDD 5JA4B 1KU5A 3LJAD 3AV1C 1P3KD 5CP6A 4CSRB 4YM6B 3KWQB 5B1MC 5B2JD 1KX4A 4X23A 5KDMA 4QLCA 3REIB 3MGPB 4J8WC 2Y2LA 4JJNA 3UTBD 4UUZA 3LZ1A 3REHC 3AN2C 4AWLC 2HUEC 5E5AC 2F2AC 5B24B 3MGRD 1P3FA 4Z2MH 3AZJB 5CHLB 3WTPC 4KUDA 5GSUB 4H9NA 5B32D 4KHAB 1AOIA 1P3MA 1P3LB 4XZQD 3AZEC 3AZLC 3EPHA 1KX5C 3MVDC 4WV4B 4J8VD 1ULYA 3AV1B 5BT1D 4ZBJB 5AV5C 3KXBC 1P34D 5B40C 2YFVB 1HQ3D 4H9RA 4J8WB 4YM6D 5CPIC 3NQUA 3REID 5AY8D 5JRGC 3MGPD 3AN2B 1P3PD 5E5AB 2LY8A 5AVCB 2BG1A 2ZY3A 3WTPB 5B0ZB 5B24D 3EPJA 3AZJD 3MGQC 3RELC 5BNVB 2CV5D 5GSUD 1P3AC 3AZEB 3AZLB 5FUGB 3AZGC 4CSRA 3AV2B 3MVDB 1KX5B 3KWQA 1P3LD 2BYMA 4EO5C 5B32G 1KX3C 3UT9C 4J8XC 1TZYD 5B40B 3UTAA 3AZHD 3AV1D 1ID3B 5F99A 1P3ID 2F8NA 2PYOA 3W98C 3VH6T 5CPIB 3A6NA 3O62D 1T3UA 4KGCC 2RVQD 5GT0A 4R8PA 3X1TC 4KHAA 3REKC 4Z5TC 3X1UA 3X1SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 C;  3AZN B;  1WWS A;  5AV8 C;  5AVC D;  3B0C W;  5B31 A;  3LJA C;  1P3K C;  5B0Z D;  3WTP D;  3REL B;  1P3A B;  5B2J C;  3AZG B;  3WKJ A;  5B1M A;  5BNX B;  3R45 B;  2YFV A;  3AZE D;  1KX3 B;  3UT9 B;  3AV2 D;  4J8X B;  4J8W A;  3AZM A;  3C1C D;  3V9R B;  5CPJ D;  3REH A;  2ARO D;  3AN2 A;  5B40 D;  1ID3 D;  5E5A A;  4ZUX D;  5B31 G;  1S32 C;  4KGC B;  1WWI A;  5B32 C;  5CPI D;  5B0Y B;  3X1T B;  1U35 B;  1EQZ B;  4Z5T B;  4XZQ C;  5BNV A;  5AV6 D;  5AV8 B;  4J8V C;  3AZL A;  1KX5 A;  3MVD A;  1P3K B;  5B2J B;  3AZN D;  1P34 C;  5AV5 A;  3KXB A;  3B6G C;  1HQ3 C;  3REL D;  4YM6 C;  3B6F B;  4LD9 C;  4YS3 B;  5AY8 C;  3MGP C;  5CPI A;  4G91 B;  3AYW A;  1P3P C;  5JRG A;  3VH5 T;  5AV9 C;  1S32 B;  5G49 A;  1P3O B;  2NQB B;  1BFM A;  1P3G C;  2CV5 C;  1BH8 B;  3MGQ A;  1P3A A;  4WU8 A;  5B0Y D;  3X1T D;  3AZG A;  5BS7 C;  1U35 D;  1EQZ D;  4Z5T D;  3MNN B;  3R45 A;  1TZY C;  5AV8 D;  4H9Q A;  1P34 B;  3UT9 A;  1KX3 A;  3AZH C;  4J8X A;  3B6G B;  4ZBJ C;  1HQ3 B;  1P3I C;  2JSS A;  1ZLA D;  4LD9 B;  3W98 A;  5AY8 B;  3O62 C;  3AZF C;  3B6F D;  2RVQ C;  1P3P B;  2L5A A;  4KGC A;  4YS3 D;  5AV9 B;  5CPK C;  4Z66 D;  3REK A;  5AVC C;  3W96 C;  3X1S A;  3TU4 D;  1P3G B;  3VH5 A;  1M19 A;  2BYK A;  1S32 D;  5B0Z C;  3WAA B;  2CV5 B;  1P3O D;  3LJA A;  3MGS C;  4J8U B;  1P3K A;  2NQB D;  5B2J A;  3AV2 C;  2F8N H;  1TZY B;  3WTP E;  3UTB A;  3C1C C;  3AZH B;  5CPJ C;  5C3I B;  1P3I B;  3MNN D;  3AZI B;  2ARO C;  1ID3 C;  2YFW B;  4NFT A;  4ZUX C;  3B6G D;  3MGR A;  3O62 B;  3AZF B;  2CWE A;  1S32 A;  4LD9 D;  2HIO C;  5B32 A;  5CPK B;  4E45 A;  2NZD B;  5AV6 C;  4XZQ A;  3B0D C;  3W96 B;  5AV9 D;  4J8V A;  3MGS B;  3AZN C;  3W99 C;  1P3G D;  3NQJ A;  4M6B A;  5GXQ B;  1P34 A;  3WAA D;  5JA4 A;  4J8U D;  1HQ3 A;  3X1V D;  4YM6 A;  3WA9 C;  5GT3 B;  3C1C B;  4CAY B;  5CPJ B;  3REI A;  3REJ D;  5AY8 A;  3MGP A;  2ARO B;  1P3P A;  4ZUX B;  5B33 C;  5AV9 A;  3AZI D;  1P3B B;  2HIO B;  5B24 A;  3AZF D;  3C1B D;  3AZJ A;  3B0B A;  2CV5 A;  5GSU A;  5AV6 B;  5B0Y C;  4H9O B;  3B0D B;  5BO0 B;  1U35 C;  5CPK D;  1EQZ C;  1P3L A;  3B0C T;  5B1L B;  5BS7 A;  5DNM D;  2NZD D;  3W99 B;  3W96 D;  1TZY A;  3AZK C;  3AZH A;  3MGS D;  5DNN D;  3AV1 A;  1P3I A;  1ZLA C;  5CP6 C;  3WA9 B;  5GXQ D;  2YFW A;  4X23 C;  3B6F C;  3O62 A;  3AZF A;  4YS3 C;  5GT3 D;  1M1A D;  4Z66 C;  4G91 C;  5B33 B;  3LZ1 C;  5CPK A;  3TU4 C;  3KUY B;  1BH9 B;  4Z2M G;  5AVB D;  5AVC A;  3W96 A;  1P3O C;  2NQB C;  5B0Z A;  3WTP A;  1P3B D;  2HIO D;  3VH6 A;  3LZ0 B;  1N1J B;  1F1E A;  2FJ7 B;  1B67 A;  3AZE A;  5FUG A;  3AV2 A;  3AZK B;  3MNN C;  3C1C A;  5B1L D;  4H9S C;  5CPJ A;  3W99 D;  1ZLA B;  5CP6 B;  2ARO A;  5B40 A;  1ID3 A;  4X23 B;  4ZUX A;  4QLC B;  3LEL D;  3WA9 D;  4Z66 B;  3LZ1 B;  3TU4 B;  3W97 C;  5AV6 A;  4H9O A;  5B33 D;  5BO0 A;  1P3F B;  4XUJ C;  3KUY D;  3AZN A;  4H9N B;  3WAA C;  5B2I D;  3AFA D;  3X1V C;  4J8U C;  1M18 D;  3REL A;  1R4V A;  3LZ0 D;  2FJ7 D;  5BNX A;  3REJ C;  4WU9 D;  4HGA B;  5C3I C;  3AZK D;  3AZI C;  3V9R A;  3UTA C;  4WNN B;  5CP6 D;  4H9R B;  3C1B C;  3VH5 W;  1KX4 D;  4X23 D;  4QLC D;  3W97 B;  4JJN D;  5B0Y A;  2F8N K;  3LZ1 D;  3X1T A;  2NZD C;  1N1J A;  5DNM C;  4Z5T A;  1U35 A;  4XUJ B;  4H9P B;  1EQZ A;  5AV8 A;  5DNN C;  3X1V B;  1P3F D;  1F66 A;  4G92 C;  5GXQ C;  1ZLA A;  1AOI D;  3REJ B;  4NE3 A;  1P3M D;  3WKJ C;  2BYM B;  1H3O B;  3B6F A;  5GT3 C;  1M1A C;  1TAF B;  3AZM C;  4YS3 A;  4Z66 A;  3UTA B;  5F99 B;  5AVB C;  2F8N B;  2PYO B;  3TU4 A;  3C1B B;  4E44 A;  1P3B C;  1P3O A;  3A6N B;  2NQB A;  5GT0 B;  4R8P B;  5DNM B;  1BH8 A;  1F66 B;  3W97 D;  3X1U B;  5B1L C;  5DNN B;  4XUJ D;  5B31 B;  3MNN A;  4H9S A;  4G92 B;  3B6G A;  3WKJ B;  5B1M B;  3LEL C;  4LD9 A;  1M1A B;  4WNN A;  3AZM B;  3KWQ D;  5AVB B;  3AYW C;  3REH B;  3W97 A;  4AWL B;  3UTA D;  3KUY C;  2HUE B;  5F99 D;  2F8N D;  4XUJ A;  4H9P A;  2PYO D;  1P3G A;  5B2I C;  3AFA C;  1M18 C;  3WAA A;  3A6N D;  4J8U A;  3X1V A;  3LZ0 C;  4DRA A;  2FJ7 C;  5GT0 D;  4WU8 C;  4R8P D;  1JFI B;  1F66 D;  3REJ A;  3X1U D;  4WU9 C;  1HTA A;  1H3O A;  3KSY A;  1TAF A;  5AV5 B;  5B31 D;  3KXB B;  3AZI A;  3LEL B;  1KX4 C;  3WKJ D;  5B1M D;  4QLC C;  3C1B A;  1A7W A;  4JJN C;  3AYW B;  3VH6 W;  5JRG B;  4J8W D;  3AZM D;  4DRB A;  2NZD A;  5DNM A;  5G49 B;  3REH D;  5B2I B;  3AFA B;  3AN2 D;  1P3F C;  1M18 B;  5E5A D;  3MGS A;  2IO5 C;  5DNN A;  4KUD C;  3MGQ B;  4WZS B;  1AOI C;  5GXQ A;  4WU8 B;  1P3M C;  2F8N G;  4WU9 B;  4EO5 B;  5GT3 A;  1M1A A;  4H9Q B;  4CAY A;  3AZL D;  3UTB C;  1KX5 D;  3MVD D;  4HGA C;  1KX4 B;  5AVB A;  5AV5 D;  3KXB D;  4NE5 A;  5KDM B;  3MGR C;  3W98 B;  1Q9C A;  4JJN B;  2HIO A;  1P3B A;  4UUZ B;  3AYW D;  5JRG D;  3REK B;  3X1S B;  1M19 B;  2BYK B;  5B1L A;  2IO5 B;  4KUD B;  3W99 A;  3LJA B;  5BT1 C;  1JFI A;  1AOI B;  1P3M B;  3MGQ D;  3WA9 A;  3LEL A;  1P3A D;  4WU8 D;  4NE6 A;  3KWQ C;  3UTB B;  3AZG D;  3REI C;  1KX3 D;  3UT9 D;  5B33 A;  4J8X D;  5F99 C;  3MGR B;  2PYO C;  1B6W A;  3KUY A;  1BH9 A;  3NQU B;  5B24 C;  3W98 D;  5B2I A;  5B32 B;  3A6N C;  3AFA A;  1M18 A;  3AZJ C;  5GSU C;  5GT0 C;  3LZ0 A;  4XZQ B;  4R8P C;  4KGC D;  2FJ7 A;  1F66 C;  3X1U C;  4J8V B;  1P3L C;  3REK D;  4WU9 A;  3X1S D;  3NQJ B;  5B31 C;  3AZK A;  1M19 D;  4KUD D;  5JA4 B;  1KU5 A;  3LJA D;  3AV1 C;  1P3K D;  5CP6 A;  4CSR B;  4YM6 B;  3KWQ B;  5B1M C;  5B2J D;  1KX4 A;  4X23 A;  5KDM A;  4QLC A;  3REI B;  3MGP B;  4J8W C;  4JJN A;  3UTB D;  4UUZ A;  3LZ1 A;  3REH C;  3AN2 C;  4AWL C;  2HUE C;  5E5A C;  5B24 B;  3MGR D;  1P3F A;  4Z2M H;  3AZJ B;  5CHL B;  3WTP C;  4KUD A;  5GSU B;  4H9N A;  5B32 D;  4KHA B;  1AOI A;  1P3M A;  1P3L B;  4XZQ D;  3AZE C;  3AZL C;  1KX5 C;  3MVD C;  4WV4 B;  4J8V D;  1ULY A;  3AV1 B;  5BT1 D;  4ZBJ B;  5AV5 C;  3KXB C;  1P34 D;  5B40 C;  2YFV B;  1HQ3 D;  4H9R A;  4J8W B;  4YM6 D;  5CPI C;  3NQU A;  3REI D;  5AY8 D;  5JRG C;  3MGP D;  3AN2 B;  1P3P D;  5E5A B;  2LY8 A;  5AVC B;  3WTP B;  5B0Z B;  5B24 D;  3AZJ D;  3MGQ C;  3REL C;  5BNV B;  2CV5 D;  5GSU D;  1P3A C;  3AZE B;  3AZL B;  5FUG B;  3AZG C;  4CSR A;  3AV2 B;  3MVD B;  1KX5 B;  3KWQ A;  1P3L D;  2BYM A;  4EO5 C;  5B32 G;  1KX3 C;  3UT9 C;  4J8X C;  1TZY D;  5B40 B;  3UTA A;  3AZH D;  3AV1 D;  1ID3 B;  5F99 A;  1P3I D;  2F8N A;  2PYO A;  3W98 C;  3VH6 T;  5CPI B;  3A6N A;  3O62 D;  4KGC C;  2RVQ D;  5GT0 A;  4R8P A;  3X1T C;  4KHA A;  3REK C;  4Z5T C;  3X1U A;  3X1S C; 
#chains in the Genus database with same CATH topology
 3KFU G;  1M19 C;  3AZN B;  1WWS A;  5AV8 C;  5AVC D;  3B0C W;  5B31 A;  3LJA C;  1P3K C;  5B0Z D;  3WTP D;  3REL B;  1P3A B;  5B2J C;  3AZG B;  3WKJ A;  2XD1 A;  5B1M A;  5BNX B;  3R45 B;  2YFV A;  3AZE D;  1KX3 B;  3UT9 B;  3AV2 D;  4J8X B;  4J8W A;  3AZM A;  2G5H C;  3C1C D;  3V9R B;  5CPJ D;  3REH A;  2ARO D;  3AN2 A;  5B40 D;  1ID3 D;  5E5A A;  4ZUX D;  2G5I C;  5B31 G;  2UWX A;  1S32 C;  4KGC B;  1WWI A;  5B32 C;  5CPI D;  5B0Y B;  3H0L C;  2Y2G A;  3X1T B;  1U35 B;  1EQZ B;  4Z5T B;  4XZQ C;  5BNV A;  5AV6 D;  5AV8 B;  2DF4 C;  4J8V C;  3AZL A;  1KX5 A;  3MVD A;  1P3K B;  5B2J B;  3AZN D;  1P34 C;  5AV5 A;  3KXB A;  3B6G C;  1HQ3 C;  3REL D;  4YM6 C;  3B6F B;  4WJ3 C;  4LD9 C;  4YS3 B;  5AY8 C;  3MGP C;  5CPI A;  4G91 B;  3AYW A;  1P3P C;  5JRG A;  3VH5 T;  3EPK A;  5AV9 C;  1S32 B;  5G49 A;  1P3O B;  2NQB B;  1BFM A;  1P3G C;  2CV5 C;  1BH8 B;  3MGQ A;  1P3A A;  4WU8 A;  5B0Y D;  3X1T D;  3AZG A;  5BS7 C;  1U35 D;  1EQZ D;  4Z5T D;  3MNN B;  3R45 A;  1TZY C;  5AV8 D;  4H9Q A;  1P34 B;  3UT9 A;  1KX3 A;  3AZH C;  4J8X A;  3B6G B;  4ZBJ C;  1HQ3 B;  1P3I C;  2JSS A;  1ZLA D;  4LD9 B;  3W98 A;  5AY8 B;  3O62 C;  3AZF C;  3B6F D;  2RVQ C;  1P3P B;  2Y2H A;  1PZR A;  2L5A A;  4KGC A;  4YS3 D;  5AV9 B;  5CPK C;  4Z66 D;  3REK A;  5AVC C;  3W96 C;  3X1S A;  3TU4 D;  1P3G B;  3VH5 A;  1M19 A;  2BYK A;  1S32 D;  5B0Z C;  3WAA B;  3EG5 B;  2CV5 B;  1P3O D;  3LJA A;  3MGS C;  4J8U B;  1P3K A;  2NQB D;  5B2J A;  3F6T A;  3AV2 C;  2F8N H;  1TZY B;  3WTP E;  3UTB A;  3C1C C;  3AZH B;  5CPJ C;  5C3I B;  4DQY B;  1P3I B;  3MNN D;  3AZI B;  3IP4 C;  2ARO C;  1ID3 C;  2YFW B;  2Y2O A;  4NFT A;  4ZUX C;  3MGR A;  3B6G D;  3O62 B;  3AZF B;  2CWE A;  1S32 A;  4LD9 D;  2HIO C;  5B32 A;  5CPK B;  4E45 A;  2NZD B;  5AV6 C;  4XZQ A;  3B0D C;  2JCH A;  3W96 B;  5AV9 D;  4J8V A;  3MGS B;  3AZN C;  3W99 C;  1P3G D;  3NQJ A;  4M6B A;  5GXQ B;  1P34 A;  3WAA D;  5JA4 A;  4J8U D;  1HQ3 A;  3X1V D;  4YM6 A;  3WA9 C;  5GT3 B;  3C1C B;  4CAY B;  5CPJ B;  3REI A;  3REJ D;  5AY8 A;  3MGP A;  2ARO B;  1P3P A;  4ZUX B;  3FDD A;  5B33 C;  5AV9 A;  3AZI D;  1P3B B;  2HIO B;  2J8P A;  5B24 A;  3AZF D;  3C1B D;  3AZJ A;  3B0B A;  2CV5 A;  5GSU A;  5AV6 B;  5B0Y C;  4H9O B;  3B0D B;  5BO0 B;  1U35 C;  5CPK D;  1EQZ C;  1P3L A;  3B0C T;  5B1L B;  5BS7 A;  5DNM D;  2NZD D;  3W99 B;  3W96 D;  1TZY A;  3AZK C;  3AZH A;  3MGS D;  5DNN D;  3AV1 A;  2W8S A;  1P3I A;  1ZLA C;  3AL0 C;  5CP6 C;  3WA9 B;  2ZY4 A;  5GXQ D;  2YFW A;  4X23 C;  3B6F C;  3O62 A;  3AZF A;  4YS3 C;  5GT3 D;  1M1A D;  4Z66 C;  4G91 C;  5B33 B;  3LZ1 C;  5CPK A;  3TU4 C;  3KUY B;  1BH9 B;  4Z2M G;  5AVB D;  5AVC A;  3W96 A;  1P3O C;  2NQB C;  5B0Z A;  3WTP A;  1P3B D;  2HIO D;  3VH6 A;  3LZ0 B;  1N1J B;  1F1E A;  2FJ7 B;  1B67 A;  3AZE A;  5FUG A;  3AV2 A;  3AZK B;  3MNN C;  3C1C A;  5B1L D;  4H9S C;  5CPJ A;  3W99 D;  1ZLA B;  5CP6 B;  2ARO A;  5B40 A;  1ID3 A;  4X23 B;  4ZUX A;  4QLC B;  3LEL D;  3WA9 D;  4Z66 B;  3LZ1 B;  3TU4 B;  3W97 C;  5AV6 A;  2ZM5 A;  5B33 D;  4H9O A;  1Z2C B;  5BO0 A;  1P3F B;  4XUJ C;  3KUY D;  3AZN A;  4H9N B;  3WAA C;  5B2I D;  2Y2Q A;  3AFA D;  3X1V C;  4J8U C;  1M18 D;  3REL A;  1R4V A;  3LZ0 D;  2Y2K A;  2FJ7 D;  5BNX A;  3REJ C;  4WU9 D;  4HGA B;  5C3I C;  3AZK D;  3AZI C;  3V9R A;  3UTA C;  4WNN B;  5CP6 D;  4H9R B;  3C1B C;  3VH5 W;  1KX4 D;  4X23 D;  4QLC D;  3W97 B;  4JJN D;  2DQN C;  5B0Y A;  2F8N K;  4UPK A;  3LZ1 D;  3X1T A;  2NZD C;  1N1J A;  5DNM C;  4Z5T A;  1U35 A;  4XUJ B;  4H9P B;  1EQZ A;  2RIQ A;  5AV8 A;  1W2E A;  5DNN C;  3X1V B;  1P3F D;  2JE5 A;  2Y2I A;  1F66 A;  4G92 C;  5GXQ C;  1ZLA A;  1AOI D;  3REJ B;  2Y2J A;  4NE3 A;  1P3M D;  3WKJ C;  2BYM B;  1H3O B;  3B6F A;  5GT3 C;  1M1A C;  1TAF B;  3AZM C;  4YS3 A;  4Z66 A;  3UTA B;  5F99 B;  5AVB C;  2F8N B;  2PYO B;  3TU4 A;  3C1B B;  4E44 A;  1P3B C;  1P3O A;  3A6N B;  2NQB A;  5GT0 B;  4R8P B;  5DNM B;  1BH8 A;  1F66 B;  3W97 D;  3X1U B;  5B1L C;  5DNN B;  4XUJ D;  5B31 B;  3MNN A;  4H9S A;  4G92 B;  3B6G A;  3WKJ B;  5B1M B;  3LEL C;  3H0M C;  4LD9 A;  1M1A B;  4WNN A;  3AZM B;  3KWQ D;  5AVB B;  3AYW C;  3REH B;  3W97 A;  2ZY5 A;  4AWL B;  3UTA D;  3KUY C;  2HUE B;  5F99 D;  2F8N D;  4XUJ A;  4H9P A;  2PYO D;  1P3G A;  5B2I C;  3AFA C;  1M18 C;  3WAA A;  3EPL A;  3A6N D;  4J8U A;  3X1V A;  3LZ0 C;  4DRA A;  2FJ7 C;  5GT0 D;  4WU8 C;  4R8P D;  2Y2M A;  1JFI B;  1F66 D;  3REJ A;  3X1U D;  4WU9 C;  1HTA A;  1H3O A;  2Y2N A;  3KSY A;  1TAF A;  5AV5 B;  5B31 D;  3KXB B;  3AZI A;  3LEL B;  1KX4 C;  3WKJ D;  5B1M D;  4QLC C;  3C1B A;  1A7W A;  2Y2P A;  4JJN C;  3AYW B;  3VH6 W;  5JRG B;  4J8W D;  3AZM D;  4DRB A;  2NZD A;  5DNM A;  3H0R C;  5G49 B;  3REH D;  5B2I B;  3AFA B;  3AN2 D;  1P3F C;  1M18 B;  5E5A D;  3MGS A;  2IO5 C;  5DNN A;  4KUD C;  2FFF B;  3MGQ B;  4WZS B;  1AOI C;  5GXQ A;  3A1K A;  4WU8 B;  1P3M C;  2F8N G;  4WU9 B;  4EO5 B;  5GT3 A;  1M1A A;  4H9Q B;  4CAY A;  3P5J B;  3UTB C;  3AZL D;  1KX5 D;  3MVD D;  2VQR A;  2ZY2 A;  4HGA C;  1KX4 B;  5AVB A;  5AV5 D;  3KXB D;  4NE5 A;  5KDM B;  3MGR C;  3W98 B;  1Q9C A;  4JJN B;  2HIO A;  1P3B A;  4UUZ B;  3AYW D;  5JRG D;  3REK B;  3X1S B;  1M19 B;  2BYK B;  5B1L A;  2IO5 B;  4KUD B;  3W99 A;  3LJA B;  5BT1 C;  1JFI A;  1AOI B;  1P3M B;  3MGQ D;  3WA9 A;  3LEL A;  1P3A D;  4WU8 D;  4NE6 A;  3KWQ C;  3UTB B;  3AZG D;  3REI C;  3A1I A;  1KX3 D;  3UT9 D;  5B33 A;  4J8X D;  5F99 C;  3MGR B;  2PYO C;  1B6W A;  3KUY A;  1BH9 A;  3NQU B;  5B24 C;  3W98 D;  5B2I A;  5B32 B;  3A6N C;  3AFA A;  1M18 A;  3AZJ C;  5GSU C;  5GT0 C;  3LZ0 A;  4XZQ B;  4R8P C;  2XD5 A;  4KGC D;  2FJ7 A;  1F66 C;  3X1U C;  4J8V B;  1P3L C;  3REK D;  4WU9 A;  3X1S D;  3NQJ B;  5B31 C;  3AZK A;  1M19 D;  4KUD D;  5JA4 B;  1KU5 A;  3LJA D;  3AV1 C;  1P3K D;  5CP6 A;  4CSR B;  4YM6 B;  3KWQ B;  5B1M C;  5B2J D;  1KX4 A;  4X23 A;  5KDM A;  4QLC A;  3REI B;  3MGP B;  4J8W C;  2Y2L A;  4JJN A;  3UTB D;  4UUZ A;  3LZ1 A;  3REH C;  3AN2 C;  4AWL C;  2HUE C;  5E5A C;  2F2A C;  5B24 B;  3MGR D;  1P3F A;  4Z2M H;  3AZJ B;  5CHL B;  3WTP C;  4KUD A;  5GSU B;  4H9N A;  5B32 D;  4KHA B;  1AOI A;  1P3M A;  1P3L B;  4XZQ D;  3AZE C;  3AZL C;  3EPH A;  1KX5 C;  3MVD C;  4WV4 B;  4J8V D;  1ULY A;  3AV1 B;  5BT1 D;  4ZBJ B;  5AV5 C;  3KXB C;  1P34 D;  5B40 C;  2YFV B;  1HQ3 D;  4H9R A;  4J8W B;  4YM6 D;  5CPI C;  3NQU A;  3REI D;  5AY8 D;  5JRG C;  3MGP D;  3AN2 B;  1P3P D;  5E5A B;  2LY8 A;  5AVC B;  2BG1 A;  2ZY3 A;  3WTP B;  5B0Z B;  5B24 D;  3EPJ A;  3AZJ D;  3MGQ C;  3REL C;  5BNV B;  2CV5 D;  5GSU D;  1P3A C;  3AZE B;  3AZL B;  5FUG B;  3AZG C;  4CSR A;  3AV2 B;  3MVD B;  1KX5 B;  3KWQ A;  1P3L D;  2BYM A;  4EO5 C;  5B32 G;  1KX3 C;  3UT9 C;  4J8X C;  1TZY D;  5B40 B;  3UTA A;  3AZH D;  3AV1 D;  1ID3 B;  5F99 A;  1P3I D;  2F8N A;  2PYO A;  3W98 C;  3VH6 T;  5CPI B;  3A6N A;  3O62 D;  1T3U A;  4KGC C;  2RVQ D;  5GT0 A;  4R8P A;  3X1T C;  4KHA A;  3REK C;  4Z5T C;  3X1U A;  3X1S C; 
#chains in the Genus database with same CATH homology
 3KFU G;  1M19 C;  3AZN B;  1WWS A;  5AV8 C;  5AVC D;  3B0C W;  5B31 A;  3LJA C;  1P3K C;  5B0Z D;  3WTP D;  3REL B;  1P3A B;  5B2J C;  3AZG B;  3WKJ A;  2XD1 A;  5B1M A;  5BNX B;  3R45 B;  2YFV A;  3AZE D;  1KX3 B;  3UT9 B;  3AV2 D;  4J8X B;  4J8W A;  3AZM A;  2G5H C;  3C1C D;  3V9R B;  5CPJ D;  3REH A;  2ARO D;  3AN2 A;  5B40 D;  1ID3 D;  5E5A A;  4ZUX D;  2G5I C;  5B31 G;  2UWX A;  1S32 C;  4KGC B;  1WWI A;  5B32 C;  5CPI D;  5B0Y B;  3H0L C;  2Y2G A;  3X1T B;  1U35 B;  1EQZ B;  4Z5T B;  4XZQ C;  5BNV A;  5AV6 D;  5AV8 B;  2DF4 C;  4J8V C;  3AZL A;  1KX5 A;  3MVD A;  1P3K B;  5B2J B;  3AZN D;  1P34 C;  5AV5 A;  3KXB A;  3B6G C;  1HQ3 C;  3REL D;  4YM6 C;  3B6F B;  4WJ3 C;  4LD9 C;  4YS3 B;  5AY8 C;  3MGP C;  5CPI A;  4G91 B;  3AYW A;  1P3P C;  5JRG A;  3VH5 T;  3EPK A;  5AV9 C;  1S32 B;  5G49 A;  1P3O B;  2NQB B;  1BFM A;  1P3G C;  2CV5 C;  1BH8 B;  3MGQ A;  1P3A A;  4WU8 A;  5B0Y D;  3X1T D;  3AZG A;  5BS7 C;  1U35 D;  1EQZ D;  4Z5T D;  3MNN B;  3R45 A;  1TZY C;  5AV8 D;  4H9Q A;  1P34 B;  3UT9 A;  1KX3 A;  3AZH C;  4J8X A;  3B6G B;  4ZBJ C;  1HQ3 B;  1P3I C;  2JSS A;  1ZLA D;  4LD9 B;  3W98 A;  5AY8 B;  3O62 C;  3AZF C;  3B6F D;  2RVQ C;  1P3P B;  2Y2H A;  1PZR A;  2L5A A;  4KGC A;  4YS3 D;  5AV9 B;  5CPK C;  4Z66 D;  3REK A;  5AVC C;  3W96 C;  3X1S A;  3TU4 D;  1P3G B;  3VH5 A;  1M19 A;  2BYK A;  1S32 D;  5B0Z C;  3WAA B;  3EG5 B;  2CV5 B;  1P3O D;  3LJA A;  3MGS C;  4J8U B;  1P3K A;  2NQB D;  5B2J A;  3F6T A;  3AV2 C;  2F8N H;  1TZY B;  3WTP E;  3UTB A;  3C1C C;  3AZH B;  5CPJ C;  5C3I B;  4DQY B;  1P3I B;  3MNN D;  3AZI B;  3IP4 C;  2ARO C;  1ID3 C;  2YFW B;  2Y2O A;  4NFT A;  4ZUX C;  3MGR A;  3B6G D;  3O62 B;  3AZF B;  2CWE A;  1S32 A;  4LD9 D;  2HIO C;  5B32 A;  5CPK B;  4E45 A;  2NZD B;  5AV6 C;  4XZQ A;  3B0D C;  2JCH A;  3W96 B;  5AV9 D;  4J8V A;  3MGS B;  3AZN C;  3W99 C;  1P3G D;  3NQJ A;  4M6B A;  5GXQ B;  1P34 A;  3WAA D;  5JA4 A;  4J8U D;  1HQ3 A;  3X1V D;  4YM6 A;  3WA9 C;  5GT3 B;  3C1C B;  4CAY B;  5CPJ B;  3REI A;  3REJ D;  5AY8 A;  3MGP A;  2ARO B;  1P3P A;  4ZUX B;  3FDD A;  5B33 C;  5AV9 A;  3AZI D;  1P3B B;  2HIO B;  2J8P A;  5B24 A;  3AZF D;  3C1B D;  3AZJ A;  3B0B A;  2CV5 A;  5GSU A;  5AV6 B;  5B0Y C;  4H9O B;  3B0D B;  5BO0 B;  1U35 C;  5CPK D;  1EQZ C;  1P3L A;  3B0C T;  5B1L B;  5BS7 A;  5DNM D;  2NZD D;  3W99 B;  3W96 D;  1TZY A;  3AZK C;  3AZH A;  3MGS D;  5DNN D;  3AV1 A;  2W8S A;  1P3I A;  1ZLA C;  3AL0 C;  5CP6 C;  3WA9 B;  2ZY4 A;  5GXQ D;  2YFW A;  4X23 C;  3B6F C;  3O62 A;  3AZF A;  4YS3 C;  5GT3 D;  1M1A D;  4Z66 C;  4G91 C;  5B33 B;  3LZ1 C;  5CPK A;  3TU4 C;  3KUY B;  1BH9 B;  4Z2M G;  5AVB D;  5AVC A;  3W96 A;  1P3O C;  2NQB C;  5B0Z A;  3WTP A;  1P3B D;  2HIO D;  3VH6 A;  3LZ0 B;  1N1J B;  1F1E A;  2FJ7 B;  1B67 A;  3AZE A;  5FUG A;  3AV2 A;  3AZK B;  3MNN C;  3C1C A;  5B1L D;  4H9S C;  5CPJ A;  3W99 D;  1ZLA B;  5CP6 B;  2ARO A;  5B40 A;  1ID3 A;  4X23 B;  4ZUX A;  4QLC B;  3LEL D;  3WA9 D;  4Z66 B;  3LZ1 B;  3TU4 B;  3W97 C;  5AV6 A;  2ZM5 A;  5B33 D;  4H9O A;  1Z2C B;  5BO0 A;  1P3F B;  4XUJ C;  3KUY D;  3AZN A;  4H9N B;  3WAA C;  5B2I D;  2Y2Q A;  3AFA D;  3X1V C;  4J8U C;  1M18 D;  3REL A;  1R4V A;  3LZ0 D;  2Y2K A;  2FJ7 D;  5BNX A;  3REJ C;  4WU9 D;  4HGA B;  5C3I C;  3AZK D;  3AZI C;  3V9R A;  3UTA C;  4WNN B;  5CP6 D;  4H9R B;  3C1B C;  3VH5 W;  1KX4 D;  4X23 D;  4QLC D;  3W97 B;  4JJN D;  2DQN C;  5B0Y A;  2F8N K;  4UPK A;  3LZ1 D;  3X1T A;  2NZD C;  1N1J A;  5DNM C;  4Z5T A;  1U35 A;  4XUJ B;  4H9P B;  1EQZ A;  2RIQ A;  5AV8 A;  1W2E A;  5DNN C;  3X1V B;  1P3F D;  2JE5 A;  2Y2I A;  1F66 A;  4G92 C;  5GXQ C;  1ZLA A;  1AOI D;  3REJ B;  2Y2J A;  4NE3 A;  1P3M D;  3WKJ C;  2BYM B;  1H3O B;  3B6F A;  5GT3 C;  1M1A C;  1TAF B;  3AZM C;  4YS3 A;  4Z66 A;  3UTA B;  5F99 B;  5AVB C;  2F8N B;  2PYO B;  3TU4 A;  3C1B B;  4E44 A;  1P3B C;  1P3O A;  3A6N B;  2NQB A;  5GT0 B;  4R8P B;  5DNM B;  1BH8 A;  1F66 B;  3W97 D;  3X1U B;  5B1L C;  5DNN B;  4XUJ D;  5B31 B;  3MNN A;  4H9S A;  4G92 B;  3B6G A;  3WKJ B;  5B1M B;  3LEL C;  3H0M C;  4LD9 A;  1M1A B;  4WNN A;  3AZM B;  3KWQ D;  5AVB B;  3AYW C;  3REH B;  3W97 A;  2ZY5 A;  4AWL B;  3UTA D;  3KUY C;  2HUE B;  5F99 D;  2F8N D;  4XUJ A;  4H9P A;  2PYO D;  1P3G A;  5B2I C;  3AFA C;  1M18 C;  3WAA A;  3EPL A;  3A6N D;  4J8U A;  3X1V A;  3LZ0 C;  4DRA A;  2FJ7 C;  5GT0 D;  4WU8 C;  4R8P D;  2Y2M A;  1JFI B;  1F66 D;  3REJ A;  3X1U D;  4WU9 C;  1HTA A;  1H3O A;  2Y2N A;  3KSY A;  1TAF A;  5AV5 B;  5B31 D;  3KXB B;  3AZI A;  3LEL B;  1KX4 C;  3WKJ D;  5B1M D;  4QLC C;  3C1B A;  1A7W A;  2Y2P A;  4JJN C;  3AYW B;  3VH6 W;  5JRG B;  4J8W D;  3AZM D;  4DRB A;  2NZD A;  5DNM A;  3H0R C;  5G49 B;  3REH D;  5B2I B;  3AFA B;  3AN2 D;  1P3F C;  1M18 B;  5E5A D;  3MGS A;  2IO5 C;  5DNN A;  4KUD C;  2FFF B;  3MGQ B;  4WZS B;  1AOI C;  5GXQ A;  3A1K A;  4WU8 B;  1P3M C;  2F8N G;  4WU9 B;  4EO5 B;  5GT3 A;  1M1A A;  4H9Q B;  4CAY A;  3P5J B;  3UTB C;  3AZL D;  1KX5 D;  3MVD D;  2VQR A;  2ZY2 A;  4HGA C;  1KX4 B;  5AVB A;  5AV5 D;  3KXB D;  4NE5 A;  5KDM B;  3MGR C;  3W98 B;  1Q9C A;  4JJN B;  2HIO A;  1P3B A;  4UUZ B;  3AYW D;  5JRG D;  3REK B;  3X1S B;  1M19 B;  2BYK B;  5B1L A;  2IO5 B;  4KUD B;  3W99 A;  3LJA B;  5BT1 C;  1JFI A;  1AOI B;  1P3M B;  3MGQ D;  3WA9 A;  3LEL A;  1P3A D;  4WU8 D;  4NE6 A;  3KWQ C;  3UTB B;  3AZG D;  3REI C;  3A1I A;  1KX3 D;  3UT9 D;  5B33 A;  4J8X D;  5F99 C;  3MGR B;  2PYO C;  1B6W A;  3KUY A;  1BH9 A;  3NQU B;  5B24 C;  3W98 D;  5B2I A;  5B32 B;  3A6N C;  3AFA A;  1M18 A;  3AZJ C;  5GSU C;  5GT0 C;  3LZ0 A;  4XZQ B;  4R8P C;  2XD5 A;  4KGC D;  2FJ7 A;  1F66 C;  3X1U C;  4J8V B;  1P3L C;  3REK D;  4WU9 A;  3X1S D;  3NQJ B;  5B31 C;  3AZK A;  1M19 D;  4KUD D;  5JA4 B;  1KU5 A;  3LJA D;  3AV1 C;  1P3K D;  5CP6 A;  4CSR B;  4YM6 B;  3KWQ B;  5B1M C;  5B2J D;  1KX4 A;  4X23 A;  5KDM A;  4QLC A;  3REI B;  3MGP B;  4J8W C;  2Y2L A;  4JJN A;  3UTB D;  4UUZ A;  3LZ1 A;  3REH C;  3AN2 C;  4AWL C;  2HUE C;  5E5A C;  2F2A C;  5B24 B;  3MGR D;  1P3F A;  4Z2M H;  3AZJ B;  5CHL B;  3WTP C;  4KUD A;  5GSU B;  4H9N A;  5B32 D;  4KHA B;  1AOI A;  1P3M A;  1P3L B;  4XZQ D;  3AZE C;  3AZL C;  3EPH A;  1KX5 C;  3MVD C;  4WV4 B;  4J8V D;  1ULY A;  3AV1 B;  5BT1 D;  4ZBJ B;  5AV5 C;  3KXB C;  1P34 D;  5B40 C;  2YFV B;  1HQ3 D;  4H9R A;  4J8W B;  4YM6 D;  5CPI C;  3NQU A;  3REI D;  5AY8 D;  5JRG C;  3MGP D;  3AN2 B;  1P3P D;  5E5A B;  2LY8 A;  5AVC B;  2BG1 A;  2ZY3 A;  3WTP B;  5B0Z B;  5B24 D;  3EPJ A;  3AZJ D;  3MGQ C;  3REL C;  5BNV B;  2CV5 D;  5GSU D;  1P3A C;  3AZE B;  3AZL B;  5FUG B;  3AZG C;  4CSR A;  3AV2 B;  3MVD B;  1KX5 B;  3KWQ A;  1P3L D;  2BYM A;  4EO5 C;  5B32 G;  1KX3 C;  3UT9 C;  4J8X C;  1TZY D;  5B40 B;  3UTA A;  3AZH D;  3AV1 D;  1ID3 B;  5F99 A;  1P3I D;  2F8N A;  2PYO A;  3W98 C;  3VH6 T;  5CPI B;  3A6N A;  3O62 D;  1T3U A;  4KGC C;  2RVQ D;  5GT0 A;  4R8P A;  3X1T C;  4KHA A;  3REK C;  4Z5T C;  3X1U A;  3X1S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...