4WU9B

Structure of cisptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9B00
3X1SB 4J8WB 5E5AB 3UTAB 3MGSC 1P34A 3WTPA 4KHAB 1P3PA 2FJ7D 3LZ0A 3RELD 3A6NA 4YS3B 4G91B 3AV2C 1H3OB 2BYKA 2HUEB 3KXBC 4X23A 3UTBC 5F99D 4LD9A 3AN2D 3VH6W 4KUDD 5B2IA 4QLCC 3B6FC 4KGCC 3WA9D 5B33A 3REHD 3RELB 2NZDD 3AZMA 2HIOC 1AOIC 5JRGD 5F99B 5AV6D 2CWEA 5AVBD 3REJA 5AV8D 3AN2B 3AZNC 5B32A 3NQUB 3AZFA 4E45A 3WA9B 3AZKA 1M1AA 2F8NK 4G92C 1U35D 1P3KB 2RVQD 5DNNB 3TU4D 1P3BA 1P3GD 3AYWB 2L5AA 4JJND 4UUZB 3B0DC 1KX3C 5B1MC 4H9OA 3B0CT 5AV8B 5B2JB 1ULYA 5AVCB 1BH9A 4Z2MG 5B0ZC 5B32G 1ID3A 1KX5A 4H9NA 3W97C 4ZUXA 3LZ1D 1P3AD 4CSRA 4WZSB 3AZIA 5AV9B 5B24C 3LELC 2CV5A 1TZYC 5GT3D 1KX4D 5BS7C 1P34B 3X1SC 5E5AC 3REIA 3UTAC 3LZ0B 5B40D 3W96D 2AROC 4H9SA 2YFWB 3C1BA 3KWQC 2BYKB 4WU8C 4X23B 3REKD 4YS3C 3UT9A 1P3FC 5GT0D 4LD9B 4G91C 5CPID 3WKJA 4J8UD 1EQZA 2HUEC 5CPKA 5B2IB 3MGQD 5CP6A 3X1UA 3O62C 5B33B 5B40B 3MGPC 1P3LD 1M19D 3AZGC 3AZMB 5DNMA 4YM6A 4R8PA 4J8UB 3REJB 1ZLAD 4AWLB 3V9RA 3AZFB 3AZKB 1M1AB 1KX5D 3X1TA 3C1CC 4EO5B 1P3BB 2FJ7A 4H9OB 5DNNC 3WAAC 3W99D 3AYWC 4ZBJB 1BH9B 3AZED 1ID3B 4WU9D 1KX5B 5F99A 4NFTA 1A7WA 5B2JC 4H9NB 3X1VD 5AVCC 4DRBA 2HIOD 5GSUD 1AOID 4CSRB 1S32D 5AY8C 5B31D 4KUDA 5AV5D 3AZIB 3WA9A 3REHA 2CV5B 3KUYA 2NZDA 1HTAA 1F66C 3AZEB 2PYOD 5JRGA 3B6GD 5AV6A 3REIB 5C3IB 3W98D 5CHLB 2IO5B 5GSUB 5AVBA 4DRAA 3WTPC 3AZHD 5B1MD 1TAFA 1P3PC 5AV5B 3LZ0C 4J8VA 3A6NC 3UT9B 1U35A 1F66A 1M18A 3WKJB 4Z5TD 4R8PD 3TU4A 1EQZB 1P3GA 3NQJA 4X23C 5CPKB 4JJNA 5CP6B 3X1UB 3W98B 4LD9C 4XUJD 5B1LD 3X1TD 5B2IC 2F8NH 3LJAC 5B33C 1Q9CA 3MGRD 5DNMB 4YM6B 3LZ1A 1P3AA 3AZMC 4R8PB 2YFWA 3V9RB 5GT3A 3REJC 3AV1A 3X1TB 1KX4A 4AWLC 5CPJA 5B32C 3AZFC 5JA4A 1M1AC 3MGRB 2FJ7B 1BFMA 5B40A 3W96A 3KUYD 3REKA 1JFIA 2NQBC 1N1JA 4H9QA 4ZBJC 5GT0A 5CPIA 4J8UA 1ID3C 3MVDD 4KUDB 3MGQA 5BT1C 4J8XC 4ZUXC 1P3OD 3REHB 4J8VD 3VH5W 3KUYB 1P3LA 2NZDB 1M19A 1M18D 3AZIC 4Z66D 2CV5C 5KDMA 5JRGB 5AV6B 4CAYA 1HQ3D 5AVBB 1ZLAA 5C3IC 1TAFB 3WAAD 1P3ID 4J8VB 3AV2A 4H9SC 3C1BC 1U35B 1M18B 3TU4B 1P3GB 3NQJB 3UT9C 4JJNB 3AZJD 3MNND 1EQZC 3AV1D 3W99A 5CPJD 4QLCA 5GXQD 5CP6C 3X1UC 4XZQD 3AZEA 4J8WC 4WU9A 3AZLD 4NE6A 3X1VA 3VH6T 3LZ1B 1P3MD 2HIOA 5GSUA 1P3AB 1S32A 1AOIA 5B31A 5DNMC 3AFAD 2YFVB 5AV5A 5B0YD 3AZJB 4YM6C 4H9RB 3AZNA 5GT3B 3AV1B 1KX4B 5CPJB 5GXQB 4XZQB 5JA4B 3KSYA 2PYOA 3B6GA 3AZLB 3W98A 2F8ND 4WNNB 1P3MB 2JSSA 3W96B 3AZHA 5B1MA 3WTPE 2FJ7C 5B31G 3RELC 3REKB 1JFIB 1R4VA 3MGSD 1N1JB 4H9QB 5GT0B 5BNVA 5CPIB 4Z5TA 5F99C 3MGQB 1KU5A 4XUJA 5B1LA 3AN2C 3AV2D 1P3LB 4KUDC 1M19B 3KXBD 5G49A 3WA9C 3UTBD 3MGRA 3REHC 1B6WA 5KDMB 2NZDC 1P3KC 4CAYB 1ZLAB 4QLCD 3B6FD 4KGCD 5JRGC 5AV6C 5BO0B 2AROA 5AV8C 3AV2B 4WU8A 3VH6A 1BH8A 1P3FA 1U35C 2RVQC 3AZND 3W99B 4J8XD 4QLCB 3B6FB 4JJNC 5AV9C 3MGPA 4WU9B 5FUGA 3AZGA 3X1VB 1P34C 2HIOB 1AOIB 1S32B 3MVDA 5B31B 1KX3D 1P3OA 1P3AC 3AZNB 5B0ZD 3R45B 4Z66A 5GT3C 4G92B 2PYOB 1KX4C 3C1CA 3B6GB 3W97D 1HQ3A 1KX3B 3B0DB 3AZHB 5B1MB 5B24D 3LELD 1TZYD 3WAAA 5B40C 1P3IA 3W96C 5B0ZB 5BNVB 3X1SD 4Z5TB 5E5AD 3REKC 3UTAD 2YFVA 3AZJA 3MNNA 5GT0C 4H9RA 5CPIC 4XUJB 2AROD 5B1LB 5AY8A 4J8UC 4H9PB 3KWQD 5GXQA 4XZQA 4WU8D 5G49B 3AZKC 4YS3D 3B0CW 1P3FD 3AZLA 1P3LC 1WWIA 4WNNA 4EO5C 1P3MA 1M19C 4Z2MH 1P3BC 3AFAA 3O62D 5B0YA 3MGPD 2AROB 1ZLAC 4WV4B 3AZGD 3KWQB 4WU8B 1KX5C 1BH8B 1P3FB 2BYMA 5BNXA 2F8NA 4HGAB 3O62B 3MGPB 5FUGB 3W99C 3MGSA 3C1CD 3LJAA 3AZGB 3AZEC 3MVDB 4WU9C 3REIC 1P3KD 3X1VC 5DNND 5BO0A 2IO5C 5GSUC 1P3OB 3AYWD 1S32C 2F8NG 5B31C 3KXBA 5AV5C 3UTBA 5B2JD 4Z66B 5AVCD 3C1CB 1HQ3B 5AY8D 3WKJC 5CPKC 2PYOC 3B6FA 4KGCA 3B6GC 3W98C 4M6BA 3WAAB 1P3IB 2LY8A 5AV9D 3AZHC 1F66D 2NQBA 1P34D 3MNNB 5AY8B 3WTPD 4R8PC 4Z5TC 1F1EA 4J8XA 1P3PD 3LZ0D 3R45A 4XUJC 5B1LC 3A6ND 3X1TC 1F66B 1WWSA 4X23D 3MGRC 1KX3A 3AFAB 4LD9D 5B0YB 3VH5T 3WTPB 5B2ID 1P3PB 5B0ZA 3LJAD 4E44A 5B33D 3A6NB 3W97A 2BYMB 5BNXB 3AZMD 2F8NB 4H9PA 5B24A 3LELA 1TZYA 3REJD 3KUYC 5B32D 5BS7A 3MGSB 3AZFD 3LJAB 4HGAC 3AZKD 1M1AD 3X1SA 4J8WA 5E5AA 3UTAA 5AVBC 4KHAA 1P3BD 3B0BA 3MVDC 3KWQA 3KXBB 3UTBB 4YS3A 1P3OC 2NQBD 4J8VC 5B32B 1H3OA 1M18C 1ID3D 3TU4C 5BT1D 4Z66C 1P3GC 4KGCB 3O62A 4ZUXD 1HQ3C 4NE5A 3AZID 3RELA 2CV5D 2NQBB 1P3IC 3LZ1C 3REID 3VH5A 4J8XB 4NE3A 4ZUXB 3AZJC 3MNNC 3AN2A 3C1BD 3AV1C 3NQUA 5CPJC 5GXQC 4XZQC 3UT9D 1B67A 1P3KA 3AZLC 5DNNA 3WKJD 1P3MC 1EQZD 5CPKD 3AYWA 4UUZA 5CP6D 3X1UD 3AFAC 5B0YC 4J8WD 5B2JA 5AV8A 3C1BB 3W97B 5AVCA 5DNMD 3MGQC 4YM6D 5B24B 3LELB 1TZYB 5AV9A
chains in the Genus database with same CATH superfamily
3X1SB 4J8WB 5E5AB 3UTAB 3MGSC 1P34A 2JE5A 3WTPA 4KHAB 1P3PA 2FJ7D 3LZ0A 3RELD 3A6NA 4YS3B 2Y2MA 4G91B 3AV2C 1H3OB 2BYKA 2HUEB 3KXBC 4X23A 3UTBC 5F99D 4LD9A 3AN2D 3VH6W 4KUDD 5B2IA 4QLCC 3B6FC 4KGCC 3WA9D 5B33A 3REHD 3RELB 2Y2GA 2NZDD 3AZMA 3EPHA 2HIOC 1AOIC 5JRGD 5F99B 5AV6D 2CWEA 5AVBD 3REJA 5AV8D 3AN2B 3AZNC 5B32A 3NQUB 3AZFA 4E45A 3WA9B 3AZKA 1M1AA 2F8NK 4G92C 1U35D 1P3KB 2RVQD 2XD1A 5DNNB 3TU4D 3F6TA 1P3BA 1P3GD 3AYWB 2L5AA 4JJND 4UUZB 3B0DC 1KX3C 5B1MC 4H9OA 3B0CT 5AV8B 5B2JB 1ULYA 5AVCB 1BH9A 4Z2MG 2BG1A 5B0ZC 5B32G 1ID3A 1KX5A 4H9NA 3W97C 4ZUXA 3LZ1D 1P3AD 4CSRA 4WZSB 3A1KA 3A1IA 3AZIA 2DQNC 5AV9B 5B24C 3LELC 2CV5A 1TZYC 5GT3D 1KX4D 5BS7C 1P34B 3X1SC 5E5AC 3REIA 3UTAC 3LZ0B 5B40D 3W96D 2AROC 4H9SA 2YFWB 3C1BA 3KWQC 2BYKB 4WU8C 2ZY2A 4X23B 4YS3C 2RIQA 3REKD 3UT9A 1P3FC 5GT0D 4LD9B 4G91C 5CPID 3WKJA 4J8UD 1EQZA 2HUEC 5CPKA 5B2IB 3MGQD 5CP6A 3X1UA 3O62C 5B33B 5B40B 3MGPC 1P3LD 1M19D 3AZGC 3AZMB 5DNMA 4YM6A 4R8PA 4J8UB 3REJB 1ZLAD 4AWLB 3V9RA 2FFFB 3AZFB 3AZKB 1M1AB 1KX5D 3X1TA 3C1CC 4EO5B 1P3BB 2FJ7A 4H9OB 5DNNC 3WAAC 3W99D 3AYWC 4ZBJB 1BH9B 3AZED 1ID3B 4WU9D 1KX5B 5F99A 4NFTA 1A7WA 5B2JC 4H9NB 3X1VD 5AVCC 4DRBA 2HIOD 5GSUD 1AOID 4CSRB 1S32D 5AY8C 5B31D 4KUDA 5AV5D 3AZIB 3WA9A 3REHA 2CV5B 3KUYA 3EPLA 1HTAA 2NZDA 2F2AC 1F66C 3AZEB 2PYOD 5JRGA 3B6GD 5AV6A 3REIB 5C3IB 3W98D 5CHLB 2Y2OA 2Y2PA 2IO5B 3H0MC 5GSUB 5AVBA 4DRAA 3WTPC 3AZHD 5B1MD 1TAFA 1P3PC 2ZY3A 5AV5B 3LZ0C 4J8VA 3A6NC 3UT9B 1U35A 1F66A 1M18A 3WKJB 4Z5TD 4R8PD 3TU4A 1EQZB 1P3GA 3NQJA 4X23C 5CPKB 4JJNA 5CP6B 3X1UB 3W98B 4LD9C 4XUJD 5B1LD 3X1TD 5B2IC 2F8NH 3LJAC 5B33C 1Q9CA 3MGRD 5DNMB 2Y2LA 4YM6B 3LZ1A 1P3AA 4WJ3C 3AZMC 4R8PB 2YFWA 3V9RB 5GT3A 3EPKA 3REJC 3AV1A 3X1TB 1KX4A 4AWLC 5CPJA 5B32C 3AZFC 5JA4A 1M1AC 3MGRB 2FJ7B 1BFMA 5B40A 3W96A 3KUYD 3FDDA 3IP4C 3REKA 1JFIA 2NQBC 1N1JA 4H9QA 4ZBJC 1Z2CB 5GT0A 5CPIA 4J8UA 1ID3C 3MVDD 4KUDB 3MGQA 5BT1C 4J8XC 4ZUXC 1P3OD 3REHB 4J8VD 3VH5W 3KUYB 1P3LA 2NZDB 1M19A 1M18D 3AZIC 4Z66D 2CV5C 5KDMA 5JRGB 5AV6B 3EPJA 4CAYA 1HQ3D 5AVBB 1ZLAA 5C3IC 1TAFB 3WAAD 1P3ID 4J8VB 3AV2A 4H9SC 3C1BC 1U35B 1PZRA 2W8SA 1M18B 3TU4B 1P3GB 3NQJB 3UT9C 4JJNB 3AZJD 3MNND 1EQZC 3AV1D 3W99A 2Y2HA 5CPJD 4QLCA 5GXQD 5CP6C 3X1UC 4XZQD 3AZEA 4J8WC 4WU9A 3AZLD 2Y2IA 2DF4C 2G5IC 4NE6A 3VH6T 3LZ1B 3X1VA 1P3MD 2HIOA 5GSUA 1P3AB 1S32A 1AOIA 5B31A 5DNMC 3AFAD 2YFVB 5AV5A 5B0YD 3AZJB 4YM6C 4H9RB 3AZNA 5GT3B 3EG5B 3AV1B 1KX4B 5CPJB 5GXQB 4XZQB 5JA4B 3KSYA 2PYOA 3B6GA 3AZLB 3W98A 2F8ND 4WNNB 1P3MB 3KFUG 2JSSA 2UWXA 3W96B 3AZHA 5B1MA 3WTPE 2FJ7C 5B31G 4DQYB 3RELC 3REKB 1JFIB 1R4VA 3MGSD 1N1JB 4H9QB 5GT0B 5BNVA 5CPIB 4Z5TA 5F99C 3MGQB 2JCHA 1KU5A 4XUJA 5B1LA 3AN2C 3AV2D 1P3LB 4KUDC 1M19B 3KXBD 5G49A 3WA9C 3UTBD 3MGRA 3REHC 1B6WA 5KDMB 2NZDC 1P3KC 4CAYB 1ZLAB 4QLCD 3B6FD 4KGCD 5JRGC 5AV6C 5BO0B 2AROA 5AV8C 3AV2B 4WU8A 3VH6A 1BH8A 1P3FA 1U35C 2RVQC 3AZND 3W99B 4J8XD 4QLCB 3B6FB 4JJNC 5AV9C 3MGPA 4WU9B 5FUGA 3AZGA 3X1VB 1P34C 2HIOB 1AOIB 1S32B 3MVDA 5B31B 1KX3D 2Y2QA 1P3OA 1P3AC 3AZNB 2Y2JA 5B0ZD 3R45B 4Z66A 5GT3C 4G92B 2PYOB 1KX4C 3C1CA 3B6GB 3W97D 2Y2KA 1HQ3A 1KX3B 3B0DB 3AZHB 5B1MB 5B24D 3LELD 1TZYD 3WAAA 5B40C 1P3IA 3W96C 5B0ZB 5BNVB 3X1SD 4Z5TB 5E5AD 3REKC 3UTAD 2YFVA 2J8PA 3MNNA 5GT0C 3AZJA 4H9RA 5CPIC 4XUJB 2AROD 5B1LB 5AY8A 4J8UC 4H9PB 3KWQD 5GXQA 4XZQA 4WU8D 5G49B 3AZKC 4YS3D 3B0CW 1P3FD 3AZLA 1P3LC 1WWIA 4WNNA 4EO5C 1P3MA 1M19C 4Z2MH 1P3BC 3AFAA 3O62D 5B0YA 2XD5A 3MGPD 2AROB 1ZLAC 4WV4B 3AZGD 3KWQB 4WU8B 1T3UA 1KX5C 1BH8B 1P3FB 2BYMA 5BNXA 2F8NA 4HGAB 3O62B 3MGPB 5FUGB 3W99C 3MGSA 3C1CD 3LJAA 3AZGB 3AZEC 3MVDB 4WU9C 3REIC 1P3KD 3X1VC 5DNND 5BO0A 2IO5C 5GSUC 1P3OB 3AYWD 1S32C 2F8NG 5B31C 3H0RC 3KXBA 5AV5C 3UTBA 5B2JD 4Z66B 5AVCD 3C1CB 1HQ3B 5AY8D 3WKJC 5CPKC 2PYOC 3B6FA 4KGCA 3B6GC 3W98C 2ZY5A 4M6BA 3WAAB 1P3IB 2LY8A 5AV9D 3AZHC 1F66D 2NQBA 2ZM5A 1P34D 3MNNB 5AY8B 3WTPD 4R8PC 4Z5TC 1F1EA 4J8XA 1P3PD 3LZ0D 3R45A 4XUJC 5B1LC 3A6ND 3X1TC 1F66B 1WWSA 4X23D 3MGRC 1KX3A 3AFAB 4LD9D 5B0YB 3VH5T 3WTPB 5B2ID 1P3PB 5B0ZA 3LJAD 4E44A 5B33D 3A6NB 2G5HC 3W97A 2BYMB 5BNXB 3AZMD 2F8NB 2Y2NA 1W2EA 4H9PA 5B24A 3LELA 1TZYA 3REJD 3KUYC 5B32D 5BS7A 3MGSB 3AZFD 3LJAB 4HGAC 3AZKD 1M1AD 3X1SA 4J8WA 5E5AA 3UTAA 5AVBC 4KHAA 1P3BD 3B0BA 3MVDC 3KWQA 3KXBB 3UTBB 4YS3A 1P3OC 2NQBD 4J8VC 5B32B 1H3OA 1M18C 4UPKA 1ID3D 3TU4C 5BT1D 4Z66C 1P3GC 4KGCB 3O62A 4ZUXD 1HQ3C 4NE5A 3AZID 3RELA 2CV5D 2NQBB 1P3IC 3LZ1C 3REID 3VH5A 4J8XB 4NE3A 4ZUXB 3P5JB 3AZJC 3MNNC 3AN2A 3C1BD 3AV1C 3NQUA 5CPJC 5GXQC 4XZQC 3UT9D 1B67A 1P3KA 3AZLC 3H0LC 5DNNA 3WKJD 1P3MC 1EQZD 5CPKD 3AYWA 4UUZA 3AL0C 5CP6D 3X1UD 3AFAC 5B0YC 4J8WD 5B2JA 5AV8A 3C1BB 3W97B 5AVCA 5DNMD 3MGQC 4YM6D 5B24B 3LELB 1TZYB 2ZY4A 2VQRA 5AV9A
chains in the Genus database with same CATH topology
3X1SB 4J8WB 5E5AB 3UTAB 3MGSC 1P34A 2JE5A 3WTPA 4KHAB 1P3PA 2FJ7D 3LZ0A 3RELD 3A6NA 4YS3B 2Y2MA 4G91B 3AV2C 1H3OB 2BYKA 2HUEB 3KXBC 4X23A 3UTBC 5F99D 4LD9A 3AN2D 3VH6W 4KUDD 5B2IA 4QLCC 3B6FC 4KGCC 3WA9D 5B33A 3REHD 3RELB 2Y2GA 2NZDD 3AZMA 3EPHA 2HIOC 1AOIC 5JRGD 5F99B 5AV6D 2CWEA 5AVBD 3REJA 5AV8D 3AN2B 3AZNC 5B32A 3NQUB 3AZFA 4E45A 3WA9B 3AZKA 1M1AA 2F8NK 4G92C 1U35D 1P3KB 2RVQD 2XD1A 5DNNB 3TU4D 3F6TA 1P3BA 1P3GD 3AYWB 2L5AA 4JJND 4UUZB 3B0DC 1KX3C 5B1MC 4H9OA 3B0CT 5AV8B 5B2JB 1ULYA 5AVCB 1BH9A 4Z2MG 2BG1A 5B0ZC 5B32G 1ID3A 1KX5A 4H9NA 3W97C 4ZUXA 3LZ1D 1P3AD 4CSRA 4WZSB 3A1KA 3A1IA 3AZIA 2DQNC 5AV9B 5B24C 3LELC 2CV5A 1TZYC 5GT3D 1KX4D 5BS7C 1P34B 3X1SC 5E5AC 3REIA 3UTAC 3LZ0B 5B40D 3W96D 2AROC 4H9SA 2YFWB 3C1BA 3KWQC 2BYKB 4WU8C 2ZY2A 4X23B 4YS3C 2RIQA 3REKD 3UT9A 1P3FC 5GT0D 4LD9B 4G91C 5CPID 3WKJA 4J8UD 1EQZA 2HUEC 5CPKA 5B2IB 3MGQD 5CP6A 3X1UA 3O62C 5B33B 5B40B 3MGPC 1P3LD 1M19D 3AZGC 3AZMB 5DNMA 4YM6A 4R8PA 4J8UB 3REJB 1ZLAD 4AWLB 3V9RA 2FFFB 3AZFB 3AZKB 1M1AB 1KX5D 3X1TA 3C1CC 4EO5B 1P3BB 2FJ7A 4H9OB 5DNNC 3WAAC 3W99D 3AYWC 4ZBJB 1BH9B 3AZED 1ID3B 4WU9D 1KX5B 5F99A 4NFTA 1A7WA 5B2JC 4H9NB 3X1VD 5AVCC 4DRBA 2HIOD 5GSUD 1AOID 4CSRB 1S32D 5AY8C 5B31D 4KUDA 5AV5D 3AZIB 3WA9A 3REHA 2CV5B 3KUYA 3EPLA 1HTAA 2NZDA 2F2AC 1F66C 3AZEB 2PYOD 5JRGA 3B6GD 5AV6A 3REIB 5C3IB 3W98D 5CHLB 2Y2OA 2Y2PA 2IO5B 3H0MC 5GSUB 5AVBA 4DRAA 3WTPC 3AZHD 5B1MD 1TAFA 1P3PC 2ZY3A 5AV5B 3LZ0C 4J8VA 3A6NC 3UT9B 1U35A 1F66A 1M18A 3WKJB 4Z5TD 4R8PD 3TU4A 1EQZB 1P3GA 3NQJA 4X23C 5CPKB 4JJNA 5CP6B 3X1UB 3W98B 4LD9C 4XUJD 5B1LD 3X1TD 5B2IC 2F8NH 3LJAC 5B33C 1Q9CA 3MGRD 5DNMB 2Y2LA 4YM6B 3LZ1A 1P3AA 4WJ3C 3AZMC 4R8PB 2YFWA 3V9RB 5GT3A 3EPKA 3REJC 3AV1A 3X1TB 1KX4A 4AWLC 5CPJA 5B32C 3AZFC 5JA4A 1M1AC 3MGRB 2FJ7B 1BFMA 5B40A 3W96A 3KUYD 3FDDA 3IP4C 3REKA 1JFIA 2NQBC 1N1JA 4H9QA 4ZBJC 1Z2CB 5GT0A 5CPIA 4J8UA 1ID3C 3MVDD 4KUDB 3MGQA 5BT1C 4J8XC 4ZUXC 1P3OD 3REHB 4J8VD 3VH5W 3KUYB 1P3LA 2NZDB 1M19A 1M18D 3AZIC 4Z66D 2CV5C 5KDMA 5JRGB 5AV6B 3EPJA 4CAYA 1HQ3D 5AVBB 1ZLAA 5C3IC 1TAFB 3WAAD 1P3ID 4J8VB 3AV2A 4H9SC 3C1BC 1U35B 1PZRA 2W8SA 1M18B 3TU4B 1P3GB 3NQJB 3UT9C 4JJNB 3AZJD 3MNND 1EQZC 3AV1D 3W99A 2Y2HA 5CPJD 4QLCA 5GXQD 5CP6C 3X1UC 4XZQD 3AZEA 4J8WC 4WU9A 3AZLD 2Y2IA 2DF4C 2G5IC 4NE6A 3VH6T 3LZ1B 3X1VA 1P3MD 2HIOA 5GSUA 1P3AB 1S32A 1AOIA 5B31A 5DNMC 3AFAD 2YFVB 5AV5A 5B0YD 3AZJB 4YM6C 4H9RB 3AZNA 5GT3B 3EG5B 3AV1B 1KX4B 5CPJB 5GXQB 4XZQB 5JA4B 3KSYA 2PYOA 3B6GA 3AZLB 3W98A 2F8ND 4WNNB 1P3MB 3KFUG 2JSSA 2UWXA 3W96B 3AZHA 5B1MA 3WTPE 2FJ7C 5B31G 4DQYB 3RELC 3REKB 1JFIB 1R4VA 3MGSD 1N1JB 4H9QB 5GT0B 5BNVA 5CPIB 4Z5TA 5F99C 3MGQB 2JCHA 1KU5A 4XUJA 5B1LA 3AN2C 3AV2D 1P3LB 4KUDC 1M19B 3KXBD 5G49A 3WA9C 3UTBD 3MGRA 3REHC 1B6WA 5KDMB 2NZDC 1P3KC 4CAYB 1ZLAB 4QLCD 3B6FD 4KGCD 5JRGC 5AV6C 5BO0B 2AROA 5AV8C 3AV2B 4WU8A 3VH6A 1BH8A 1P3FA 1U35C 2RVQC 3AZND 3W99B 4J8XD 4QLCB 3B6FB 4JJNC 5AV9C 3MGPA 4WU9B 5FUGA 3AZGA 3X1VB 1P34C 2HIOB 1AOIB 1S32B 3MVDA 5B31B 1KX3D 2Y2QA 1P3OA 1P3AC 3AZNB 2Y2JA 5B0ZD 3R45B 4Z66A 5GT3C 4G92B 2PYOB 1KX4C 3C1CA 3B6GB 3W97D 2Y2KA 1HQ3A 1KX3B 3B0DB 3AZHB 5B1MB 5B24D 3LELD 1TZYD 3WAAA 5B40C 1P3IA 3W96C 5B0ZB 5BNVB 3X1SD 4Z5TB 5E5AD 3REKC 3UTAD 2YFVA 2J8PA 3MNNA 5GT0C 3AZJA 4H9RA 5CPIC 4XUJB 2AROD 5B1LB 5AY8A 4J8UC 4H9PB 3KWQD 5GXQA 4XZQA 4WU8D 5G49B 3AZKC 4YS3D 3B0CW 1P3FD 3AZLA 1P3LC 1WWIA 4WNNA 4EO5C 1P3MA 1M19C 4Z2MH 1P3BC 3AFAA 3O62D 5B0YA 2XD5A 3MGPD 2AROB 1ZLAC 4WV4B 3AZGD 3KWQB 4WU8B 1T3UA 1KX5C 1BH8B 1P3FB 2BYMA 5BNXA 2F8NA 4HGAB 3O62B 3MGPB 5FUGB 3W99C 3MGSA 3C1CD 3LJAA 3AZGB 3AZEC 3MVDB 4WU9C 3REIC 1P3KD 3X1VC 5DNND 5BO0A 2IO5C 5GSUC 1P3OB 3AYWD 1S32C 2F8NG 5B31C 3H0RC 3KXBA 5AV5C 3UTBA 5B2JD 4Z66B 5AVCD 3C1CB 1HQ3B 5AY8D 3WKJC 5CPKC 2PYOC 3B6FA 4KGCA 3B6GC 3W98C 2ZY5A 4M6BA 3WAAB 1P3IB 2LY8A 5AV9D 3AZHC 1F66D 2NQBA 2ZM5A 1P34D 3MNNB 5AY8B 3WTPD 4R8PC 4Z5TC 1F1EA 4J8XA 1P3PD 3LZ0D 3R45A 4XUJC 5B1LC 3A6ND 3X1TC 1F66B 1WWSA 4X23D 3MGRC 1KX3A 3AFAB 4LD9D 5B0YB 3VH5T 3WTPB 5B2ID 1P3PB 5B0ZA 3LJAD 4E44A 5B33D 3A6NB 2G5HC 3W97A 2BYMB 5BNXB 3AZMD 2F8NB 2Y2NA 1W2EA 4H9PA 5B24A 3LELA 1TZYA 3REJD 3KUYC 5B32D 5BS7A 3MGSB 3AZFD 3LJAB 4HGAC 3AZKD 1M1AD 3X1SA 4J8WA 5E5AA 3UTAA 5AVBC 4KHAA 1P3BD 3B0BA 3MVDC 3KWQA 3KXBB 3UTBB 4YS3A 1P3OC 2NQBD 4J8VC 5B32B 1H3OA 1M18C 4UPKA 1ID3D 3TU4C 5BT1D 4Z66C 1P3GC 4KGCB 3O62A 4ZUXD 1HQ3C 4NE5A 3AZID 3RELA 2CV5D 2NQBB 1P3IC 3LZ1C 3REID 3VH5A 4J8XB 4NE3A 4ZUXB 3P5JB 3AZJC 3MNNC 3AN2A 3C1BD 3AV1C 3NQUA 5CPJC 5GXQC 4XZQC 3UT9D 1B67A 1P3KA 3AZLC 3H0LC 5DNNA 3WKJD 1P3MC 1EQZD 5CPKD 3AYWA 4UUZA 3AL0C 5CP6D 3X1UD 3AFAC 5B0YC 4J8WD 5B2JA 5AV8A 3C1BB 3W97B 5AVCA 5DNMD 3MGQC 4YM6D 5B24B 3LELB 1TZYB 2ZY4A 2VQRA 5AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S B;  4J8W B;  5E5A B;  3UTA B;  3MGS C;  1P34 A;  3WTP A;  4KHA B;  1P3P A;  2FJ7 D;  3LZ0 A;  3REL D;  3A6N A;  4YS3 B;  4G91 B;  3AV2 C;  1H3O B;  2BYK A;  2HUE B;  3KXB C;  4X23 A;  3UTB C;  5F99 D;  4LD9 A;  3AN2 D;  3VH6 W;  4KUD D;  5B2I A;  4QLC C;  3B6F C;  4KGC C;  3WA9 D;  5B33 A;  3REH D;  3REL B;  2NZD D;  3AZM A;  2HIO C;  1AOI C;  5JRG D;  5F99 B;  5AV6 D;  2CWE A;  5AVB D;  3REJ A;  5AV8 D;  3AN2 B;  3AZN C;  5B32 A;  3NQU B;  3AZF A;  4E45 A;  3WA9 B;  3AZK A;  1M1A A;  2F8N K;  4G92 C;  1U35 D;  1P3K B;  2RVQ D;  5DNN B;  3TU4 D;  1P3B A;  1P3G D;  3AYW B;  2L5A A;  4JJN D;  4UUZ B;  3B0D C;  1KX3 C;  5B1M C;  4H9O A;  3B0C T;  5AV8 B;  5B2J B;  1ULY A;  5AVC B;  1BH9 A;  4Z2M G;  5B0Z C;  5B32 G;  1ID3 A;  1KX5 A;  4H9N A;  3W97 C;  4ZUX A;  3LZ1 D;  1P3A D;  4CSR A;  4WZS B;  3AZI A;  5AV9 B;  5B24 C;  3LEL C;  2CV5 A;  1TZY C;  5GT3 D;  1KX4 D;  5BS7 C;  1P34 B;  3X1S C;  5E5A C;  3REI A;  3UTA C;  3LZ0 B;  5B40 D;  3W96 D;  2ARO C;  4H9S A;  2YFW B;  3C1B A;  3KWQ C;  2BYK B;  4WU8 C;  4X23 B;  3REK D;  4YS3 C;  3UT9 A;  1P3F C;  5GT0 D;  4LD9 B;  4G91 C;  5CPI D;  3WKJ A;  4J8U D;  1EQZ A;  2HUE C;  5CPK A;  5B2I B;  3MGQ D;  5CP6 A;  3X1U A;  3O62 C;  5B33 B;  5B40 B;  3MGP C;  1P3L D;  1M19 D;  3AZG C;  3AZM B;  5DNM A;  4YM6 A;  4R8P A;  4J8U B;  3REJ B;  1ZLA D;  4AWL B;  3V9R A;  3AZF B;  3AZK B;  1M1A B;  1KX5 D;  3X1T A;  3C1C C;  4EO5 B;  1P3B B;  2FJ7 A;  4H9O B;  5DNN C;  3WAA C;  3W99 D;  3AYW C;  4ZBJ B;  1BH9 B;  3AZE D;  1ID3 B;  4WU9 D;  1KX5 B;  5F99 A;  4NFT A;  1A7W A;  5B2J C;  4H9N B;  3X1V D;  5AVC C;  4DRB A;  2HIO D;  5GSU D;  1AOI D;  4CSR B;  1S32 D;  5AY8 C;  5B31 D;  4KUD A;  5AV5 D;  3AZI B;  3WA9 A;  3REH A;  2CV5 B;  3KUY A;  2NZD A;  1HTA A;  1F66 C;  3AZE B;  2PYO D;  5JRG A;  3B6G D;  5AV6 A;  3REI B;  5C3I B;  3W98 D;  5CHL B;  2IO5 B;  5GSU B;  5AVB A;  4DRA A;  3WTP C;  3AZH D;  5B1M D;  1TAF A;  1P3P C;  5AV5 B;  3LZ0 C;  4J8V A;  3A6N C;  3UT9 B;  1U35 A;  1F66 A;  1M18 A;  3WKJ B;  4Z5T D;  4R8P D;  3TU4 A;  1EQZ B;  1P3G A;  3NQJ A;  4X23 C;  5CPK B;  4JJN A;  5CP6 B;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5B1L D;  3X1T D;  5B2I C;  2F8N H;  3LJA C;  5B33 C;  1Q9C A;  3MGR D;  5DNM B;  4YM6 B;  3LZ1 A;  1P3A A;  3AZM C;  4R8P B;  2YFW A;  3V9R B;  5GT3 A;  3REJ C;  3AV1 A;  3X1T B;  1KX4 A;  4AWL C;  5CPJ A;  5B32 C;  3AZF C;  5JA4 A;  1M1A C;  3MGR B;  2FJ7 B;  1BFM A;  5B40 A;  3W96 A;  3KUY D;  3REK A;  1JFI A;  2NQB C;  1N1J A;  4H9Q A;  4ZBJ C;  5GT0 A;  5CPI A;  4J8U A;  1ID3 C;  3MVD D;  4KUD B;  3MGQ A;  5BT1 C;  4J8X C;  4ZUX C;  1P3O D;  3REH B;  4J8V D;  3VH5 W;  3KUY B;  1P3L A;  2NZD B;  1M19 A;  1M18 D;  3AZI C;  4Z66 D;  2CV5 C;  5KDM A;  5JRG B;  5AV6 B;  4CAY A;  1HQ3 D;  5AVB B;  1ZLA A;  5C3I C;  1TAF B;  3WAA D;  1P3I D;  4J8V B;  3AV2 A;  4H9S C;  3C1B C;  1U35 B;  1M18 B;  3TU4 B;  1P3G B;  3NQJ B;  3UT9 C;  4JJN B;  3AZJ D;  3MNN D;  1EQZ C;  3AV1 D;  3W99 A;  5CPJ D;  4QLC A;  5GXQ D;  5CP6 C;  3X1U C;  4XZQ D;  3AZE A;  4J8W C;  4WU9 A;  3AZL D;  4NE6 A;  3X1V A;  3VH6 T;  3LZ1 B;  1P3M D;  2HIO A;  5GSU A;  1P3A B;  1S32 A;  1AOI A;  5B31 A;  5DNM C;  3AFA D;  2YFV B;  5AV5 A;  5B0Y D;  3AZJ B;  4YM6 C;  4H9R B;  3AZN A;  5GT3 B;  3AV1 B;  1KX4 B;  5CPJ B;  5GXQ B;  4XZQ B;  5JA4 B;  3KSY A;  2PYO A;  3B6G A;  3AZL B;  3W98 A;  2F8N D;  4WNN B;  1P3M B;  2JSS A;  3W96 B;  3AZH A;  5B1M A;  3WTP E;  2FJ7 C;  5B31 G;  3REL C;  3REK B;  1JFI B;  1R4V A;  3MGS D;  1N1J B;  4H9Q B;  5GT0 B;  5BNV A;  5CPI B;  4Z5T A;  5F99 C;  3MGQ B;  1KU5 A;  4XUJ A;  5B1L A;  3AN2 C;  3AV2 D;  1P3L B;  4KUD C;  1M19 B;  3KXB D;  5G49 A;  3WA9 C;  3UTB D;  3MGR A;  3REH C;  1B6W A;  5KDM B;  2NZD C;  1P3K C;  4CAY B;  1ZLA B;  4QLC D;  3B6F D;  4KGC D;  5JRG C;  5AV6 C;  5BO0 B;  2ARO A;  5AV8 C;  3AV2 B;  4WU8 A;  3VH6 A;  1BH8 A;  1P3F A;  1U35 C;  2RVQ C;  3AZN D;  3W99 B;  4J8X D;  4QLC B;  3B6F B;  4JJN C;  5AV9 C;  3MGP A;  4WU9 B;  5FUG A;  3AZG A;  3X1V B;  1P34 C;  2HIO B;  1AOI B;  1S32 B;  3MVD A;  5B31 B;  1KX3 D;  1P3O A;  1P3A C;  3AZN B;  5B0Z D;  3R45 B;  4Z66 A;  5GT3 C;  4G92 B;  2PYO B;  1KX4 C;  3C1C A;  3B6G B;  3W97 D;  1HQ3 A;  1KX3 B;  3B0D B;  3AZH B;  5B1M B;  5B24 D;  3LEL D;  1TZY D;  3WAA A;  5B40 C;  1P3I A;  3W96 C;  5B0Z B;  5BNV B;  3X1S D;  4Z5T B;  5E5A D;  3REK C;  3UTA D;  2YFV A;  3AZJ A;  3MNN A;  5GT0 C;  4H9R A;  5CPI C;  4XUJ B;  2ARO D;  5B1L B;  5AY8 A;  4J8U C;  4H9P B;  3KWQ D;  5GXQ A;  4XZQ A;  4WU8 D;  5G49 B;  3AZK C;  4YS3 D;  3B0C W;  1P3F D;  3AZL A;  1P3L C;  1WWI A;  4WNN A;  4EO5 C;  1P3M A;  1M19 C;  4Z2M H;  1P3B C;  3AFA A;  3O62 D;  5B0Y A;  3MGP D;  2ARO B;  1ZLA C;  4WV4 B;  3AZG D;  3KWQ B;  4WU8 B;  1KX5 C;  1BH8 B;  1P3F B;  2BYM A;  5BNX A;  2F8N A;  4HGA B;  3O62 B;  3MGP B;  5FUG B;  3W99 C;  3MGS A;  3C1C D;  3LJA A;  3AZG B;  3AZE C;  3MVD B;  4WU9 C;  3REI C;  1P3K D;  3X1V C;  5DNN D;  5BO0 A;  2IO5 C;  5GSU C;  1P3O B;  3AYW D;  1S32 C;  2F8N G;  5B31 C;  3KXB A;  5AV5 C;  3UTB A;  5B2J D;  4Z66 B;  5AVC D;  3C1C B;  1HQ3 B;  5AY8 D;  3WKJ C;  5CPK C;  2PYO C;  3B6F A;  4KGC A;  3B6G C;  3W98 C;  4M6B A;  3WAA B;  1P3I B;  2LY8 A;  5AV9 D;  3AZH C;  1F66 D;  2NQB A;  1P34 D;  3MNN B;  5AY8 B;  3WTP D;  4R8P C;  4Z5T C;  1F1E A;  4J8X A;  1P3P D;  3LZ0 D;  3R45 A;  4XUJ C;  5B1L C;  3A6N D;  3X1T C;  1F66 B;  1WWS A;  4X23 D;  3MGR C;  1KX3 A;  3AFA B;  4LD9 D;  5B0Y B;  3VH5 T;  3WTP B;  5B2I D;  1P3P B;  5B0Z A;  3LJA D;  4E44 A;  5B33 D;  3A6N B;  3W97 A;  2BYM B;  5BNX B;  3AZM D;  2F8N B;  4H9P A;  5B24 A;  3LEL A;  1TZY A;  3REJ D;  3KUY C;  5B32 D;  5BS7 A;  3MGS B;  3AZF D;  3LJA B;  4HGA C;  3AZK D;  1M1A D;  3X1S A;  4J8W A;  5E5A A;  3UTA A;  5AVB C;  4KHA A;  1P3B D;  3B0B A;  3MVD C;  3KWQ A;  3KXB B;  3UTB B;  4YS3 A;  1P3O C;  2NQB D;  4J8V C;  5B32 B;  1H3O A;  1M18 C;  1ID3 D;  3TU4 C;  5BT1 D;  4Z66 C;  1P3G C;  4KGC B;  3O62 A;  4ZUX D;  1HQ3 C;  4NE5 A;  3AZI D;  3REL A;  2CV5 D;  2NQB B;  1P3I C;  3LZ1 C;  3REI D;  3VH5 A;  4J8X B;  4NE3 A;  4ZUX B;  3AZJ C;  3MNN C;  3AN2 A;  3C1B D;  3AV1 C;  3NQU A;  5CPJ C;  5GXQ C;  4XZQ C;  3UT9 D;  1B67 A;  1P3K A;  3AZL C;  5DNN A;  3WKJ D;  1P3M C;  1EQZ D;  5CPK D;  3AYW A;  4UUZ A;  5CP6 D;  3X1U D;  3AFA C;  5B0Y C;  4J8W D;  5B2J A;  5AV8 A;  3C1B B;  3W97 B;  5AVC A;  5DNM D;  3MGQ C;  4YM6 D;  5B24 B;  3LEL B;  1TZY B;  5AV9 A; 
#chains in the Genus database with same CATH topology
 3X1S B;  4J8W B;  5E5A B;  3UTA B;  3MGS C;  1P34 A;  2JE5 A;  3WTP A;  4KHA B;  1P3P A;  2FJ7 D;  3LZ0 A;  3REL D;  3A6N A;  4YS3 B;  2Y2M A;  4G91 B;  3AV2 C;  1H3O B;  2BYK A;  2HUE B;  3KXB C;  4X23 A;  3UTB C;  5F99 D;  4LD9 A;  3AN2 D;  3VH6 W;  4KUD D;  5B2I A;  4QLC C;  3B6F C;  4KGC C;  3WA9 D;  5B33 A;  3REH D;  3REL B;  2Y2G A;  2NZD D;  3AZM A;  3EPH A;  2HIO C;  1AOI C;  5JRG D;  5F99 B;  5AV6 D;  2CWE A;  5AVB D;  3REJ A;  5AV8 D;  3AN2 B;  3AZN C;  5B32 A;  3NQU B;  3AZF A;  4E45 A;  3WA9 B;  3AZK A;  1M1A A;  2F8N K;  4G92 C;  1U35 D;  1P3K B;  2RVQ D;  2XD1 A;  5DNN B;  3TU4 D;  3F6T A;  1P3B A;  1P3G D;  3AYW B;  2L5A A;  4JJN D;  4UUZ B;  3B0D C;  1KX3 C;  5B1M C;  4H9O A;  3B0C T;  5AV8 B;  5B2J B;  1ULY A;  5AVC B;  1BH9 A;  4Z2M G;  2BG1 A;  5B0Z C;  5B32 G;  1ID3 A;  1KX5 A;  4H9N A;  3W97 C;  4ZUX A;  3LZ1 D;  1P3A D;  4CSR A;  4WZS B;  3A1K A;  3A1I A;  3AZI A;  2DQN C;  5AV9 B;  5B24 C;  3LEL C;  2CV5 A;  1TZY C;  5GT3 D;  1KX4 D;  5BS7 C;  1P34 B;  3X1S C;  5E5A C;  3REI A;  3UTA C;  3LZ0 B;  5B40 D;  3W96 D;  2ARO C;  4H9S A;  2YFW B;  3C1B A;  3KWQ C;  2BYK B;  4WU8 C;  2ZY2 A;  4X23 B;  4YS3 C;  2RIQ A;  3REK D;  3UT9 A;  1P3F C;  5GT0 D;  4LD9 B;  4G91 C;  5CPI D;  3WKJ A;  4J8U D;  1EQZ A;  2HUE C;  5CPK A;  5B2I B;  3MGQ D;  5CP6 A;  3X1U A;  3O62 C;  5B33 B;  5B40 B;  3MGP C;  1P3L D;  1M19 D;  3AZG C;  3AZM B;  5DNM A;  4YM6 A;  4R8P A;  4J8U B;  3REJ B;  1ZLA D;  4AWL B;  3V9R A;  2FFF B;  3AZF B;  3AZK B;  1M1A B;  1KX5 D;  3X1T A;  3C1C C;  4EO5 B;  1P3B B;  2FJ7 A;  4H9O B;  5DNN C;  3WAA C;  3W99 D;  3AYW C;  4ZBJ B;  1BH9 B;  3AZE D;  1ID3 B;  4WU9 D;  1KX5 B;  5F99 A;  4NFT A;  1A7W A;  5B2J C;  4H9N B;  3X1V D;  5AVC C;  4DRB A;  2HIO D;  5GSU D;  1AOI D;  4CSR B;  1S32 D;  5AY8 C;  5B31 D;  4KUD A;  5AV5 D;  3AZI B;  3WA9 A;  3REH A;  2CV5 B;  3KUY A;  3EPL A;  1HTA A;  2NZD A;  2F2A C;  1F66 C;  3AZE B;  2PYO D;  5JRG A;  3B6G D;  5AV6 A;  3REI B;  5C3I B;  3W98 D;  5CHL B;  2Y2O A;  2Y2P A;  2IO5 B;  3H0M C;  5GSU B;  5AVB A;  4DRA A;  3WTP C;  3AZH D;  5B1M D;  1TAF A;  1P3P C;  2ZY3 A;  5AV5 B;  3LZ0 C;  4J8V A;  3A6N C;  3UT9 B;  1U35 A;  1F66 A;  1M18 A;  3WKJ B;  4Z5T D;  4R8P D;  3TU4 A;  1EQZ B;  1P3G A;  3NQJ A;  4X23 C;  5CPK B;  4JJN A;  5CP6 B;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5B1L D;  3X1T D;  5B2I C;  2F8N H;  3LJA C;  5B33 C;  1Q9C A;  3MGR D;  5DNM B;  2Y2L A;  4YM6 B;  3LZ1 A;  1P3A A;  4WJ3 C;  3AZM C;  4R8P B;  2YFW A;  3V9R B;  5GT3 A;  3EPK A;  3REJ C;  3AV1 A;  3X1T B;  1KX4 A;  4AWL C;  5CPJ A;  5B32 C;  3AZF C;  5JA4 A;  1M1A C;  3MGR B;  2FJ7 B;  1BFM A;  5B40 A;  3W96 A;  3KUY D;  3FDD A;  3IP4 C;  3REK A;  1JFI A;  2NQB C;  1N1J A;  4H9Q A;  4ZBJ C;  1Z2C B;  5GT0 A;  5CPI A;  4J8U A;  1ID3 C;  3MVD D;  4KUD B;  3MGQ A;  5BT1 C;  4J8X C;  4ZUX C;  1P3O D;  3REH B;  4J8V D;  3VH5 W;  3KUY B;  1P3L A;  2NZD B;  1M19 A;  1M18 D;  3AZI C;  4Z66 D;  2CV5 C;  5KDM A;  5JRG B;  5AV6 B;  3EPJ A;  4CAY A;  1HQ3 D;  5AVB B;  1ZLA A;  5C3I C;  1TAF B;  3WAA D;  1P3I D;  4J8V B;  3AV2 A;  4H9S C;  3C1B C;  1U35 B;  1PZR A;  2W8S A;  1M18 B;  3TU4 B;  1P3G B;  3NQJ B;  3UT9 C;  4JJN B;  3AZJ D;  3MNN D;  1EQZ C;  3AV1 D;  3W99 A;  2Y2H A;  5CPJ D;  4QLC A;  5GXQ D;  5CP6 C;  3X1U C;  4XZQ D;  3AZE A;  4J8W C;  4WU9 A;  3AZL D;  2Y2I A;  2DF4 C;  2G5I C;  4NE6 A;  3VH6 T;  3LZ1 B;  3X1V A;  1P3M D;  2HIO A;  5GSU A;  1P3A B;  1S32 A;  1AOI A;  5B31 A;  5DNM C;  3AFA D;  2YFV B;  5AV5 A;  5B0Y D;  3AZJ B;  4YM6 C;  4H9R B;  3AZN A;  5GT3 B;  3EG5 B;  3AV1 B;  1KX4 B;  5CPJ B;  5GXQ B;  4XZQ B;  5JA4 B;  3KSY A;  2PYO A;  3B6G A;  3AZL B;  3W98 A;  2F8N D;  4WNN B;  1P3M B;  3KFU G;  2JSS A;  2UWX A;  3W96 B;  3AZH A;  5B1M A;  3WTP E;  2FJ7 C;  5B31 G;  4DQY B;  3REL C;  3REK B;  1JFI B;  1R4V A;  3MGS D;  1N1J B;  4H9Q B;  5GT0 B;  5BNV A;  5CPI B;  4Z5T A;  5F99 C;  3MGQ B;  2JCH A;  1KU5 A;  4XUJ A;  5B1L A;  3AN2 C;  3AV2 D;  1P3L B;  4KUD C;  1M19 B;  3KXB D;  5G49 A;  3WA9 C;  3UTB D;  3MGR A;  3REH C;  1B6W A;  5KDM B;  2NZD C;  1P3K C;  4CAY B;  1ZLA B;  4QLC D;  3B6F D;  4KGC D;  5JRG C;  5AV6 C;  5BO0 B;  2ARO A;  5AV8 C;  3AV2 B;  4WU8 A;  3VH6 A;  1BH8 A;  1P3F A;  1U35 C;  2RVQ C;  3AZN D;  3W99 B;  4J8X D;  4QLC B;  3B6F B;  4JJN C;  5AV9 C;  3MGP A;  4WU9 B;  5FUG A;  3AZG A;  3X1V B;  1P34 C;  2HIO B;  1AOI B;  1S32 B;  3MVD A;  5B31 B;  1KX3 D;  2Y2Q A;  1P3O A;  1P3A C;  3AZN B;  2Y2J A;  5B0Z D;  3R45 B;  4Z66 A;  5GT3 C;  4G92 B;  2PYO B;  1KX4 C;  3C1C A;  3B6G B;  3W97 D;  2Y2K A;  1HQ3 A;  1KX3 B;  3B0D B;  3AZH B;  5B1M B;  5B24 D;  3LEL D;  1TZY D;  3WAA A;  5B40 C;  1P3I A;  3W96 C;  5B0Z B;  5BNV B;  3X1S D;  4Z5T B;  5E5A D;  3REK C;  3UTA D;  2YFV A;  2J8P A;  3MNN A;  5GT0 C;  3AZJ A;  4H9R A;  5CPI C;  4XUJ B;  2ARO D;  5B1L B;  5AY8 A;  4J8U C;  4H9P B;  3KWQ D;  5GXQ A;  4XZQ A;  4WU8 D;  5G49 B;  3AZK C;  4YS3 D;  3B0C W;  1P3F D;  3AZL A;  1P3L C;  1WWI A;  4WNN A;  4EO5 C;  1P3M A;  1M19 C;  4Z2M H;  1P3B C;  3AFA A;  3O62 D;  5B0Y A;  2XD5 A;  3MGP D;  2ARO B;  1ZLA C;  4WV4 B;  3AZG D;  3KWQ B;  4WU8 B;  1T3U A;  1KX5 C;  1BH8 B;  1P3F B;  2BYM A;  5BNX A;  2F8N A;  4HGA B;  3O62 B;  3MGP B;  5FUG B;  3W99 C;  3MGS A;  3C1C D;  3LJA A;  3AZG B;  3AZE C;  3MVD B;  4WU9 C;  3REI C;  1P3K D;  3X1V C;  5DNN D;  5BO0 A;  2IO5 C;  5GSU C;  1P3O B;  3AYW D;  1S32 C;  2F8N G;  5B31 C;  3H0R C;  3KXB A;  5AV5 C;  3UTB A;  5B2J D;  4Z66 B;  5AVC D;  3C1C B;  1HQ3 B;  5AY8 D;  3WKJ C;  5CPK C;  2PYO C;  3B6F A;  4KGC A;  3B6G C;  3W98 C;  2ZY5 A;  4M6B A;  3WAA B;  1P3I B;  2LY8 A;  5AV9 D;  3AZH C;  1F66 D;  2NQB A;  2ZM5 A;  1P34 D;  3MNN B;  5AY8 B;  3WTP D;  4R8P C;  4Z5T C;  1F1E A;  4J8X A;  1P3P D;  3LZ0 D;  3R45 A;  4XUJ C;  5B1L C;  3A6N D;  3X1T C;  1F66 B;  1WWS A;  4X23 D;  3MGR C;  1KX3 A;  3AFA B;  4LD9 D;  5B0Y B;  3VH5 T;  3WTP B;  5B2I D;  1P3P B;  5B0Z A;  3LJA D;  4E44 A;  5B33 D;  3A6N B;  2G5H C;  3W97 A;  2BYM B;  5BNX B;  3AZM D;  2F8N B;  2Y2N A;  1W2E A;  4H9P A;  5B24 A;  3LEL A;  1TZY A;  3REJ D;  3KUY C;  5B32 D;  5BS7 A;  3MGS B;  3AZF D;  3LJA B;  4HGA C;  3AZK D;  1M1A D;  3X1S A;  4J8W A;  5E5A A;  3UTA A;  5AVB C;  4KHA A;  1P3B D;  3B0B A;  3MVD C;  3KWQ A;  3KXB B;  3UTB B;  4YS3 A;  1P3O C;  2NQB D;  4J8V C;  5B32 B;  1H3O A;  1M18 C;  4UPK A;  1ID3 D;  3TU4 C;  5BT1 D;  4Z66 C;  1P3G C;  4KGC B;  3O62 A;  4ZUX D;  1HQ3 C;  4NE5 A;  3AZI D;  3REL A;  2CV5 D;  2NQB B;  1P3I C;  3LZ1 C;  3REI D;  3VH5 A;  4J8X B;  4NE3 A;  4ZUX B;  3P5J B;  3AZJ C;  3MNN C;  3AN2 A;  3C1B D;  3AV1 C;  3NQU A;  5CPJ C;  5GXQ C;  4XZQ C;  3UT9 D;  1B67 A;  1P3K A;  3AZL C;  3H0L C;  5DNN A;  3WKJ D;  1P3M C;  1EQZ D;  5CPK D;  3AYW A;  4UUZ A;  3AL0 C;  5CP6 D;  3X1U D;  3AFA C;  5B0Y C;  4J8W D;  5B2J A;  5AV8 A;  3C1B B;  3W97 B;  5AVC A;  5DNM D;  3MGQ C;  4YM6 D;  5B24 B;  3LEL B;  1TZY B;  2ZY4 A;  2VQR A;  5AV9 A; 
#chains in the Genus database with same CATH homology
 3X1S B;  4J8W B;  5E5A B;  3UTA B;  3MGS C;  1P34 A;  2JE5 A;  3WTP A;  4KHA B;  1P3P A;  2FJ7 D;  3LZ0 A;  3REL D;  3A6N A;  4YS3 B;  2Y2M A;  4G91 B;  3AV2 C;  1H3O B;  2BYK A;  2HUE B;  3KXB C;  4X23 A;  3UTB C;  5F99 D;  4LD9 A;  3AN2 D;  3VH6 W;  4KUD D;  5B2I A;  4QLC C;  3B6F C;  4KGC C;  3WA9 D;  5B33 A;  3REH D;  3REL B;  2Y2G A;  2NZD D;  3AZM A;  3EPH A;  2HIO C;  1AOI C;  5JRG D;  5F99 B;  5AV6 D;  2CWE A;  5AVB D;  3REJ A;  5AV8 D;  3AN2 B;  3AZN C;  5B32 A;  3NQU B;  3AZF A;  4E45 A;  3WA9 B;  3AZK A;  1M1A A;  2F8N K;  4G92 C;  1U35 D;  1P3K B;  2RVQ D;  2XD1 A;  5DNN B;  3TU4 D;  3F6T A;  1P3B A;  1P3G D;  3AYW B;  2L5A A;  4JJN D;  4UUZ B;  3B0D C;  1KX3 C;  5B1M C;  4H9O A;  3B0C T;  5AV8 B;  5B2J B;  1ULY A;  5AVC B;  1BH9 A;  4Z2M G;  2BG1 A;  5B0Z C;  5B32 G;  1ID3 A;  1KX5 A;  4H9N A;  3W97 C;  4ZUX A;  3LZ1 D;  1P3A D;  4CSR A;  4WZS B;  3A1K A;  3A1I A;  3AZI A;  2DQN C;  5AV9 B;  5B24 C;  3LEL C;  2CV5 A;  1TZY C;  5GT3 D;  1KX4 D;  5BS7 C;  1P34 B;  3X1S C;  5E5A C;  3REI A;  3UTA C;  3LZ0 B;  5B40 D;  3W96 D;  2ARO C;  4H9S A;  2YFW B;  3C1B A;  3KWQ C;  2BYK B;  4WU8 C;  2ZY2 A;  4X23 B;  4YS3 C;  2RIQ A;  3REK D;  3UT9 A;  1P3F C;  5GT0 D;  4LD9 B;  4G91 C;  5CPI D;  3WKJ A;  4J8U D;  1EQZ A;  2HUE C;  5CPK A;  5B2I B;  3MGQ D;  5CP6 A;  3X1U A;  3O62 C;  5B33 B;  5B40 B;  3MGP C;  1P3L D;  1M19 D;  3AZG C;  3AZM B;  5DNM A;  4YM6 A;  4R8P A;  4J8U B;  3REJ B;  1ZLA D;  4AWL B;  3V9R A;  2FFF B;  3AZF B;  3AZK B;  1M1A B;  1KX5 D;  3X1T A;  3C1C C;  4EO5 B;  1P3B B;  2FJ7 A;  4H9O B;  5DNN C;  3WAA C;  3W99 D;  3AYW C;  4ZBJ B;  1BH9 B;  3AZE D;  1ID3 B;  4WU9 D;  1KX5 B;  5F99 A;  4NFT A;  1A7W A;  5B2J C;  4H9N B;  3X1V D;  5AVC C;  4DRB A;  2HIO D;  5GSU D;  1AOI D;  4CSR B;  1S32 D;  5AY8 C;  5B31 D;  4KUD A;  5AV5 D;  3AZI B;  3WA9 A;  3REH A;  2CV5 B;  3KUY A;  3EPL A;  1HTA A;  2NZD A;  2F2A C;  1F66 C;  3AZE B;  2PYO D;  5JRG A;  3B6G D;  5AV6 A;  3REI B;  5C3I B;  3W98 D;  5CHL B;  2Y2O A;  2Y2P A;  2IO5 B;  3H0M C;  5GSU B;  5AVB A;  4DRA A;  3WTP C;  3AZH D;  5B1M D;  1TAF A;  1P3P C;  2ZY3 A;  5AV5 B;  3LZ0 C;  4J8V A;  3A6N C;  3UT9 B;  1U35 A;  1F66 A;  1M18 A;  3WKJ B;  4Z5T D;  4R8P D;  3TU4 A;  1EQZ B;  1P3G A;  3NQJ A;  4X23 C;  5CPK B;  4JJN A;  5CP6 B;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5B1L D;  3X1T D;  5B2I C;  2F8N H;  3LJA C;  5B33 C;  1Q9C A;  3MGR D;  5DNM B;  2Y2L A;  4YM6 B;  3LZ1 A;  1P3A A;  4WJ3 C;  3AZM C;  4R8P B;  2YFW A;  3V9R B;  5GT3 A;  3EPK A;  3REJ C;  3AV1 A;  3X1T B;  1KX4 A;  4AWL C;  5CPJ A;  5B32 C;  3AZF C;  5JA4 A;  1M1A C;  3MGR B;  2FJ7 B;  1BFM A;  5B40 A;  3W96 A;  3KUY D;  3FDD A;  3IP4 C;  3REK A;  1JFI A;  2NQB C;  1N1J A;  4H9Q A;  4ZBJ C;  1Z2C B;  5GT0 A;  5CPI A;  4J8U A;  1ID3 C;  3MVD D;  4KUD B;  3MGQ A;  5BT1 C;  4J8X C;  4ZUX C;  1P3O D;  3REH B;  4J8V D;  3VH5 W;  3KUY B;  1P3L A;  2NZD B;  1M19 A;  1M18 D;  3AZI C;  4Z66 D;  2CV5 C;  5KDM A;  5JRG B;  5AV6 B;  3EPJ A;  4CAY A;  1HQ3 D;  5AVB B;  1ZLA A;  5C3I C;  1TAF B;  3WAA D;  1P3I D;  4J8V B;  3AV2 A;  4H9S C;  3C1B C;  1U35 B;  1PZR A;  2W8S A;  1M18 B;  3TU4 B;  1P3G B;  3NQJ B;  3UT9 C;  4JJN B;  3AZJ D;  3MNN D;  1EQZ C;  3AV1 D;  3W99 A;  2Y2H A;  5CPJ D;  4QLC A;  5GXQ D;  5CP6 C;  3X1U C;  4XZQ D;  3AZE A;  4J8W C;  4WU9 A;  3AZL D;  2Y2I A;  2DF4 C;  2G5I C;  4NE6 A;  3VH6 T;  3LZ1 B;  3X1V A;  1P3M D;  2HIO A;  5GSU A;  1P3A B;  1S32 A;  1AOI A;  5B31 A;  5DNM C;  3AFA D;  2YFV B;  5AV5 A;  5B0Y D;  3AZJ B;  4YM6 C;  4H9R B;  3AZN A;  5GT3 B;  3EG5 B;  3AV1 B;  1KX4 B;  5CPJ B;  5GXQ B;  4XZQ B;  5JA4 B;  3KSY A;  2PYO A;  3B6G A;  3AZL B;  3W98 A;  2F8N D;  4WNN B;  1P3M B;  3KFU G;  2JSS A;  2UWX A;  3W96 B;  3AZH A;  5B1M A;  3WTP E;  2FJ7 C;  5B31 G;  4DQY B;  3REL C;  3REK B;  1JFI B;  1R4V A;  3MGS D;  1N1J B;  4H9Q B;  5GT0 B;  5BNV A;  5CPI B;  4Z5T A;  5F99 C;  3MGQ B;  2JCH A;  1KU5 A;  4XUJ A;  5B1L A;  3AN2 C;  3AV2 D;  1P3L B;  4KUD C;  1M19 B;  3KXB D;  5G49 A;  3WA9 C;  3UTB D;  3MGR A;  3REH C;  1B6W A;  5KDM B;  2NZD C;  1P3K C;  4CAY B;  1ZLA B;  4QLC D;  3B6F D;  4KGC D;  5JRG C;  5AV6 C;  5BO0 B;  2ARO A;  5AV8 C;  3AV2 B;  4WU8 A;  3VH6 A;  1BH8 A;  1P3F A;  1U35 C;  2RVQ C;  3AZN D;  3W99 B;  4J8X D;  4QLC B;  3B6F B;  4JJN C;  5AV9 C;  3MGP A;  4WU9 B;  5FUG A;  3AZG A;  3X1V B;  1P34 C;  2HIO B;  1AOI B;  1S32 B;  3MVD A;  5B31 B;  1KX3 D;  2Y2Q A;  1P3O A;  1P3A C;  3AZN B;  2Y2J A;  5B0Z D;  3R45 B;  4Z66 A;  5GT3 C;  4G92 B;  2PYO B;  1KX4 C;  3C1C A;  3B6G B;  3W97 D;  2Y2K A;  1HQ3 A;  1KX3 B;  3B0D B;  3AZH B;  5B1M B;  5B24 D;  3LEL D;  1TZY D;  3WAA A;  5B40 C;  1P3I A;  3W96 C;  5B0Z B;  5BNV B;  3X1S D;  4Z5T B;  5E5A D;  3REK C;  3UTA D;  2YFV A;  2J8P A;  3MNN A;  5GT0 C;  3AZJ A;  4H9R A;  5CPI C;  4XUJ B;  2ARO D;  5B1L B;  5AY8 A;  4J8U C;  4H9P B;  3KWQ D;  5GXQ A;  4XZQ A;  4WU8 D;  5G49 B;  3AZK C;  4YS3 D;  3B0C W;  1P3F D;  3AZL A;  1P3L C;  1WWI A;  4WNN A;  4EO5 C;  1P3M A;  1M19 C;  4Z2M H;  1P3B C;  3AFA A;  3O62 D;  5B0Y A;  2XD5 A;  3MGP D;  2ARO B;  1ZLA C;  4WV4 B;  3AZG D;  3KWQ B;  4WU8 B;  1T3U A;  1KX5 C;  1BH8 B;  1P3F B;  2BYM A;  5BNX A;  2F8N A;  4HGA B;  3O62 B;  3MGP B;  5FUG B;  3W99 C;  3MGS A;  3C1C D;  3LJA A;  3AZG B;  3AZE C;  3MVD B;  4WU9 C;  3REI C;  1P3K D;  3X1V C;  5DNN D;  5BO0 A;  2IO5 C;  5GSU C;  1P3O B;  3AYW D;  1S32 C;  2F8N G;  5B31 C;  3H0R C;  3KXB A;  5AV5 C;  3UTB A;  5B2J D;  4Z66 B;  5AVC D;  3C1C B;  1HQ3 B;  5AY8 D;  3WKJ C;  5CPK C;  2PYO C;  3B6F A;  4KGC A;  3B6G C;  3W98 C;  2ZY5 A;  4M6B A;  3WAA B;  1P3I B;  2LY8 A;  5AV9 D;  3AZH C;  1F66 D;  2NQB A;  2ZM5 A;  1P34 D;  3MNN B;  5AY8 B;  3WTP D;  4R8P C;  4Z5T C;  1F1E A;  4J8X A;  1P3P D;  3LZ0 D;  3R45 A;  4XUJ C;  5B1L C;  3A6N D;  3X1T C;  1F66 B;  1WWS A;  4X23 D;  3MGR C;  1KX3 A;  3AFA B;  4LD9 D;  5B0Y B;  3VH5 T;  3WTP B;  5B2I D;  1P3P B;  5B0Z A;  3LJA D;  4E44 A;  5B33 D;  3A6N B;  2G5H C;  3W97 A;  2BYM B;  5BNX B;  3AZM D;  2F8N B;  2Y2N A;  1W2E A;  4H9P A;  5B24 A;  3LEL A;  1TZY A;  3REJ D;  3KUY C;  5B32 D;  5BS7 A;  3MGS B;  3AZF D;  3LJA B;  4HGA C;  3AZK D;  1M1A D;  3X1S A;  4J8W A;  5E5A A;  3UTA A;  5AVB C;  4KHA A;  1P3B D;  3B0B A;  3MVD C;  3KWQ A;  3KXB B;  3UTB B;  4YS3 A;  1P3O C;  2NQB D;  4J8V C;  5B32 B;  1H3O A;  1M18 C;  4UPK A;  1ID3 D;  3TU4 C;  5BT1 D;  4Z66 C;  1P3G C;  4KGC B;  3O62 A;  4ZUX D;  1HQ3 C;  4NE5 A;  3AZI D;  3REL A;  2CV5 D;  2NQB B;  1P3I C;  3LZ1 C;  3REI D;  3VH5 A;  4J8X B;  4NE3 A;  4ZUX B;  3P5J B;  3AZJ C;  3MNN C;  3AN2 A;  3C1B D;  3AV1 C;  3NQU A;  5CPJ C;  5GXQ C;  4XZQ C;  3UT9 D;  1B67 A;  1P3K A;  3AZL C;  3H0L C;  5DNN A;  3WKJ D;  1P3M C;  1EQZ D;  5CPK D;  3AYW A;  4UUZ A;  3AL0 C;  5CP6 D;  3X1U D;  3AFA C;  5B0Y C;  4J8W D;  5B2J A;  5AV8 A;  3C1B B;  3W97 B;  5AVC A;  5DNM D;  3MGQ C;  4YM6 D;  5B24 B;  3LEL B;  1TZY B;  2ZY4 A;  2VQR A;  5AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...