4WU9B

Structure of cisptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9B00
1HQ3D 2HIOA 5DNNC 3KUYD 3R45B 4J8UB 1P3PA 4XZQD 4WNNB 5GT0B 4HGAB 4YM6D 4X23A 3AN2D 5AY8B 5GSUA 3AZLD 1F66A 1P3KB 3AZNA 1KX4B 1TZYD 3AYWD 3WKJD 4Z66A 4J8UA 4WU8B 4J8VD 3WAAB 3UTBD 1AOIB 2FJ7C 5DNMD 1KX4A 3C1CC 3REJD 3B0CW 2RVQC 5B1MD 5B1LC 5B31D 5B2JD 5AV5B 1M18C 5CPJA 3W98C 4CAYB 1P3LB 4NFTA 3VH6A 1H3OA 4KUDB 4G92B 3VH5A 1P3MC 5B40D 3X1SD 4CSRA 5AV8B 5B24B 5AV5A 3KXBB 1ID3D 5C3IB 2NZDD 1WWIA 3W96A 3MGRC 2CV5D 3X1TC 3REKD 3REHC 5AV8A 1KX5C 5B24A 5E5AD 5GT3C 1HQ3B 3KUYB 4XZQB 3AN2B 4YM6B 5B32G 3B6GC 5BO0B 3AZLB 5B0ZC 4YS3D 3B6FC 1P3IC 1ZLAA 1TZYB 3AYWB 3O62D 3KUYA 2PYOB 4XZQA 3AV1A 1Q9CA 4YM6A 3AN2A 4J8VB 5B33C 3UTBB 5BO0A 3AZLA 3MNND 5AVCD 4UUZA 5B32C 5CP6D 5DNMB 1TZYA 3AV2C 3AZED 3AZGD 3REJB 1M1AC 4J8XC 5B2JB 3WKJA 3REIB 2LY8A 3X1VC 5GXQD 5CPKC 4LD9C 1P3FC 4JJNC 3UTBA 1EQZD 4R8PD 3W97D 5B40B 3LZ0C 5DNMA 3X1SB 3C1BB 2AROA 5B2JA 5B1MA 5B31A 3AZJA 1M19D 4KGCD 5B2ID 5AVBD 1ID3B 2NZDB 5BNXA 4Z5TC 2CV5B 1P3GD 5B40A 5G49A 3REKB 1JFIB 3X1SA 1KX3C 4WU9C 5E5AB 1P3OC 2NZDA 3WTPC 2CV5A 1P3AC 4H9OB 4H9NB 5AY8D 3X1UA 3MGQC 5B0YD 3O62B 2NQBC 5AV9C 3UTAD 3VH6T 3WA9C 1A7WA 3KWQB 3VH5T 4J8WC 3MNNB 3MGSB 4YS3A 4H9OA 3A6ND 4AWLC 4H9NA 5AVCB 5CP6B 3AZEB 3AZGB 3WTPE 3TU4C 3O62A 4M6BA 3AZMD 4ZUXC 1BH8B 4Z2MG 4R8PB 3MGPD 3RELD 3AZKC 1P3LD 5CP6A 3AZEA 3AZGA 3V9RB 1U35B 1M19B 2F8NK 5DNND 5GXQA 2HUEB 2YFVB 5CHLB 5B2IB 1BH8A 5AVBB 1F66C 1EQZA 3AZNC 1P3GB 3W97A 3KXBD 4NE3A 4Z66C 3V9RA 4HGAC 4E45A 3AZKA 1M19A 4KGCA 4H9SC 5B2IA 5AV6A 5AVBA 4Z2MH 4QLCA 3LZ1C 3B0DB 5CPID 5B0YB 5CPJC 3C1CD 2RVQD 3VH6W 5B1LD 3VH5W 1M18D 3UTAB 2PYOD 3R45A 1B67A 4WNNA 5GT0A 5F99B 3A6NB 5AV5C 5AY8A 5BS7A 5B0YA 3W96C 1P3KA 4E44A 3AZMB 4ZBJB 5JRGC 4WU8A 3REID 3MGRD 3X1TD 5B24C 3MGPB 3RELB 3WAAA 3REHD 1AOIA 3NQJB 5GT3D 3C1BD 5DNNB 1ZLAC 1P3BC 5KDMB 3MGPA 5B0ZD 4CAYA 1P3LA 3B6FD 4KUDA 1P3ID 3AV1C 3NQJA 3W99C 5B33D 4G91C 1N1JB 3KXBA 3AFAC 3WKJC 2FJ7B 5CPIB 5B32D 3AV2D 1M1AD 3C1CB 4H9PB 3UTBC 5B1LB 3X1VD 5CPKD 1M18B 4LD9D 3W98B 1P3FD 1HQ3A 5BT1C 2AROC 2JSSA 4WV4B 1KU5A 5B1MC 5B31C 1P3MB 3AZJC 3KWQD 5CPIA 3AZHD 3MGSD 4H9PA 4H9RB 4WZSB 3AYWA 1M18A 2PYOA 3MGRB 3X1TB 4J8VA 3LELC 3REHB 1KX3D 1KX5B 4H9RA 4WU9D 5GT3B 3REJA 1U35D 4XUJC 4EO5B 3WTPD 3REIA 3X1UC 3MGRA 1BFMA 1P3AD 5B0ZB 3B6FB 3LJAC 3REHA 3AZFC 1P3IB 2NQBD 3C1BA 5JA4B 4DRAA 4YS3C 1S32C 5B33B 3WA9D 3KSYA 4J8WD 1ID3A 5B0ZA 2L5AA 2YFWB 3B6FA 1P3IA 5B32B 3AV2B 1M1AB 3REKA 1JFIA 3NQUB 3TU4D 4J8XB 5JA4A 3X1VB 5CPKB 4LD9B 2F8NG 5E5AA 1P3FB 4ZUXD 5B33A 4JJNB 1P34C 4H9QB 3AZKD 5GXQC 3AV2A 3UT9C 3AZHB 1M1AA 5F99D 3NQUA 3MVDD 1EQZC 1F1EA 5FUGB 3X1VA 5CPKA 3W97C 4Z5TB 3AZND 4KGCC 3KWQA 3AZIC 3AZHA 2BYKB 5AV6C 3MNNA 3MGSA 1KX3B 4WU9B 5AVCA 2HIOC 1P3PC 4QLCC 5FUGA 1P3OB 4X23C 2F8NH 2IO5C 3WTPB 5GSUC 3LZ1D 1P3AB 4R8PA 3MGQB 4WU9A 4J8UC 2NQBB 5AV9B 3B0BA 5GT0C 1U35A 3WTPA 5AY8C 5BS7C 3WA9B 2YFVA 4J8WB 4AWLB 2CWEA 1P3KC 1KX4C 1P3GA 3TU4B 2FJ7D 4WU8C 3WAAC 4ZUXB 5JRGD 1AOIC 3W98D 3AZKB 3TU4A 1P3MD 3MVDB 1ULYA 1F66B 4ZUXA 1P3LC 4KUDC 4G92C 3AZNB 1ZLAD 1P3BD 3UTAA 4Z66B 5AV8C 5F99A 3AV1D 3A6NA 3MVDA 3W99D 3KXBC 1KX5D 5C3IC 1HTAA 3LZ1B 3AZMA 3AFAD 1B6WA 3B6GD 3RELA 5CPJB 1HQ3C 3KUYC 4H9SA 4XZQC 1H3OB 3AN2C 4YM6C 5BT1D 5DNNA 5CPIC 3LZ1A 3AZLC 1WWSA 4CSRB 5B31G 2AROD 3AZJD 1TZYC 3AYWC 5KDMA 2PYOC 3W96B 4J8VC 4J8XD 5JRGB 4NE5A 4JJND 5DNMC 1N1JA 3LELD 3REJC 5B2JC 2FJ7A 3REIC 3LZ0D 3C1CA 5JRGA 5B1LA 4XUJD 3X1UD 1ZLAB 1P3BB 5B40C 3W98A 3X1SC 3C1BC 4Z5TD 3LJAD 3AZFD 3AV1B 1P3MA 4EO5C 3W99B 1ID3C 2NZDC 1S32D 2CV5C 4UUZB 4G91B 1P3OD 1P3BA 3REKC 3AFAB 3WKJB 3X1TA 3B6GB 5E5AC 3W99A 3MGQD 1KX5A 1BH9B 5GT3A 5AV9D 3AFAA 1P34D 2AROB 4KHAB 5B1MB 5B31B 3AZJB 3B6GA 3UT9D 3O62C 5BNXB 1BH9A 5G49B 3KWQC 3AZHC 3MNNC 3MGSC 4KHAA 5AVCC 2F8ND 5CP6C 3AZID 3LELB 3AZEC 3AZGC 5AV6D 2YFWA 3LZ0B 2HIOD 5B32A 1P3PD 4QLCD 4X23D 4J8XA 4R8PC 4XUJB 3X1UB 5GSUD 4LD9A 1P3FA 1F66D 1TAFB 4JJNA 3LELA 3LJAB 3AZFB 1U35C 4H9QA 1M19C 4Z66D 3LZ0A 4J8UD 2HUEC 5AVBC 5B2IC 5GT0D 4YS3B 4XUJA 1S32B 1P3GC 2BYMB 1TAFA 4Z5TA 3LJAA 3AZFA 1P3KD 1KX4D 4WU8D 2BYKA 1KX3A 5CPJD 3WAAD 1S32A 1P3OA 2BYMA 1P34B 3B0DC 1AOID 1R4VA 4DRBA 5B0YC 5BNVB 5GXQB 3UT9B 1P3AA 5AV5D 3MGQA 1EQZB 3B0CT 3UTAC 3W97B 2NQBA 3W96D 5AV9A 4KUDD 5F99C 1P34A 3A6NC 3MVDC 2F8NB 3WA9A 4KGCB 3AZIB 5BNVA 4J8WA 3UT9A 5AV8D 5AV6B 5B24D 1P3PB 2HIOB 4QLCB 3AZMC 4ZBJC 4X23B 2IO5B 5GSUB 3MGPC 3RELC 2F8NA 3AZIA 4NE6A
chains in the Genus database with same CATH superfamily
1HQ3D 2HIOA 5DNNC 3KUYD 3R45B 4J8UB 1P3PA 4XZQD 4WNNB 5GT0B 4HGAB 4YM6D 4X23A 3AN2D 2Y2GA 5AY8B 5GSUA 3AZLD 1F66A 1P3KB 3AZNA 1KX4B 1TZYD 3AYWD 3WKJD 2Y2JA 4Z66A 4J8UA 4WU8B 4J8VD 3WAAB 3UTBD 1AOIB 2FJ7C 5DNMD 1KX4A 3C1CC 3REJD 3B0CW 2RVQC 5B1MD 5B1LC 5B31D 5B2JD 5AV5B 1M18C 5CPJA 3W98C 4CAYB 1P3LB 4NFTA 3VH6A 1H3OA 4KUDB 4G92B 3VH5A 1P3MC 5B40D 3X1SD 4CSRA 5AV8B 5B24B 5AV5A 3KXBB 1ID3D 3EPHA 5C3IB 2NZDD 1WWIA 3W96A 3MGRC 2CV5D 3X1TC 3REKD 3REHC 4DQYB 5AV8A 1KX5C 5B24A 5E5AD 5GT3C 1HQ3B 3KUYB 4XZQB 3AN2B 4YM6B 5B32G 3B6GC 5BO0B 3AZLB 5B0ZC 4YS3D 3B6FC 1P3IC 1ZLAA 1TZYB 3AYWB 3O62D 2Y2MA 3KUYA 2PYOB 2ZY3A 4XZQA 3AV1A 1Q9CA 4YM6A 3AN2A 4J8VB 5B33C 3UTBB 2G5HC 5BO0A 3AZLA 3MNND 5AVCD 4UUZA 5B32C 5CP6D 5DNMB 1TZYA 3AV2C 3AZED 3AZGD 3REJB 1M1AC 4J8XC 5B2JB 3WKJA 3REIB 2LY8A 3X1VC 5GXQD 5CPKC 4LD9C 1P3FC 4JJNC 2W8SA 3UTBA 1EQZD 4R8PD 3W97D 5B40B 3LZ0C 3P5JB 5DNMA 3X1SB 3C1BB 2AROA 5B2JA 5B1MA 5B31A 2Y2IA 3AZJA 1M19D 4KGCD 5B2ID 5AVBD 1ID3B 2NZDB 5BNXA 4Z5TC 2CV5B 1P3GD 5B40A 5G49A 3REKB 1JFIB 3X1SA 3FDDA 1KX3C 2DF4C 3H0RC 4WU9C 5E5AB 1P3OC 2NZDA 3WTPC 3IP4C 2CV5A 1P3AC 2F2AC 4H9OB 4H9NB 5AY8D 3X1UA 3MGQC 5B0YD 3O62B 2NQBC 5AV9C 3UTAD 3VH6T 3WA9C 2ZY5A 1A7WA 3KWQB 2ZY2A 3VH5T 4J8WC 3MNNB 3MGSB 4YS3A 4H9OA 3A6ND 4AWLC 4H9NA 5AVCB 5CP6B 3AZEB 3AZGB 3WTPE 3TU4C 3O62A 4M6BA 3AZMD 4ZUXC 1BH8B 4Z2MG 3AL0C 4R8PB 3MGPD 3RELD 3AZKC 1P3LD 2Y2PA 5CP6A 3AZEA 3AZGA 3V9RB 1U35B 2Y2QA 1M19B 2F8NK 5DNND 5GXQA 4UPKA 2HUEB 2YFVB 5CHLB 5B2IB 1BH8A 5AVBB 1F66C 1EQZA 3AZNC 1P3GB 3W97A 2Y2HA 3KXBD 4NE3A 4Z66C 2BG1A 3V9RA 4HGAC 4E45A 3AZKA 1M19A 4KGCA 4H9SC 5B2IA 5AV6A 5AVBA 4WJ3C 4Z2MH 4QLCA 3LZ1C 2FFFB 3B0DB 5CPID 5B0YB 5CPJC 3C1CD 2RVQD 3VH6W 5B1LD 3VH5W 1M18D 3UTAB 2PYOD 3R45A 1B67A 4WNNA 5GT0A 5F99B 3A1KA 3A6NB 5AV5C 3KFUG 2VQRA 5AY8A 5BS7A 5B0YA 3W96C 1P3KA 4E44A 3AZMB 4ZBJB 5JRGC 4WU8A 3REID 3MGRD 3X1TD 5B24C 3MGPB 3RELB 3WAAA 3REHD 1AOIA 3NQJB 5GT3D 3C1BD 5DNNB 3F6TA 1ZLAC 1P3BC 5KDMB 3MGPA 5B0ZD 4CAYA 1P3LA 3B6FD 4KUDA 1P3ID 3AV1C 3NQJA 3W99C 2JCHA 2RIQA 5B33D 4G91C 1N1JB 3KXBA 3AFAC 3WKJC 2FJ7B 5CPIB 5B32D 3AV2D 1M1AD 3C1CB 4H9PB 3UTBC 5B1LB 2UWXA 3X1VD 5CPKD 1M18B 4LD9D 3W98B 1P3FD 1HQ3A 5BT1C 2AROC 2JSSA 4WV4B 1KU5A 5B1MC 5B31C 1P3MB 3AZJC 3KWQD 5CPIA 3AZHD 3MGSD 4H9PA 4H9RB 4WZSB 3EPKA 3AYWA 1M18A 2PYOA 3MGRB 3X1TB 4J8VA 3LELC 3REHB 1KX3D 1KX5B 4H9RA 4WU9D 5GT3B 3REJA 1U35D 4XUJC 4EO5B 3WTPD 3REIA 3X1UC 3MGRA 1BFMA 1P3AD 5B0ZB 1Z2CB 3B6FB 3LJAC 3REHA 3AZFC 1P3IB 2NQBD 3C1BA 5JA4B 4DRAA 4YS3C 1W2EA 1S32C 5B33B 3WA9D 3KSYA 4J8WD 1ID3A 5B0ZA 2L5AA 2YFWB 2XD1A 3B6FA 1P3IA 5B32B 3AV2B 1M1AB 3REKA 1JFIA 3NQUB 3TU4D 4J8XB 5JA4A 3X1VB 5CPKB 4LD9B 2F8NG 5E5AA 1P3FB 4ZUXD 5B33A 4JJNB 3A1IA 1P34C 4H9QB 3AZKD 2Y2NA 5GXQC 3AV2A 3UT9C 3AZHB 1M1AA 5F99D 3NQUA 3MVDD 1EQZC 1F1EA 5FUGB 3X1VA 5CPKA 3W97C 4Z5TB 3EPJA 3AZND 4KGCC 3KWQA 3AZIC 3AZHA 2BYKB 5AV6C 3MNNA 3MGSA 1KX3B 4WU9B 5AVCA 2HIOC 1P3PC 4QLCC 5FUGA 1P3OB 4X23C 2F8NH 2IO5C 3WTPB 2Y2LA 5GSUC 3LZ1D 1P3AB 4R8PA 3MGQB 4WU9A 4J8UC 2NQBB 5AV9B 3B0BA 5GT0C 1U35A 3WTPA 5AY8C 5BS7C 3WA9B 3H0MC 2YFVA 4J8WB 4AWLB 2CWEA 1P3KC 1KX4C 1P3GA 3TU4B 2ZM5A 2FJ7D 4WU8C 3WAAC 4ZUXB 5JRGD 1AOIC 3W98D 3AZKB 3TU4A 1P3MD 3MVDB 1ULYA 1F66B 4ZUXA 1P3LC 4KUDC 4G92C 3AZNB 1ZLAD 1P3BD 3UTAA 4Z66B 5AV8C 5F99A 3AV1D 3A6NA 3MVDA 3W99D 3KXBC 1KX5D 5C3IC 1HTAA 3LZ1B 3AZMA 3AFAD 1B6WA 3B6GD 2DQNC 3RELA 5CPJB 1HQ3C 3KUYC 4H9SA 2Y2KA 4XZQC 1H3OB 3AN2C 4YM6C 5BT1D 5DNNA 5CPIC 3LZ1A 3AZLC 1WWSA 4CSRB 5B31G 2AROD 3AZJD 1TZYC 2G5IC 2J8PA 5KDMA 3AYWC 2PYOC 3W96B 4J8VC 2ZY4A 5JRGB 4NE5A 4J8XD 4JJND 5DNMC 1N1JA 3H0LC 3LELD 3REJC 5B2JC 2FJ7A 3REIC 3LZ0D 3C1CA 5JRGA 5B1LA 4XUJD 2XD5A 3X1UD 1ZLAB 1P3BB 5B40C 3W98A 3X1SC 3C1BC 4Z5TD 3LJAD 3AZFD 3AV1B 1P3MA 4EO5C 3W99B 1ID3C 2NZDC 1S32D 2CV5C 4UUZB 4G91B 1P3OD 1P3BA 3REKC 3AFAB 3WKJB 3X1TA 3B6GB 5E5AC 3W99A 3MGQD 1KX5A 1BH9B 5GT3A 5AV9D 3AFAA 1P34D 2AROB 4KHAB 5B1MB 5B31B 3AZJB 3B6GA 3UT9D 3O62C 5BNXB 1BH9A 5G49B 3KWQC 3AZHC 3MNNC 3MGSC 3EPLA 4KHAA 5AVCC 2F8ND 5CP6C 3AZID 3LELB 3AZEC 3AZGC 5AV6D 2YFWA 3LZ0B 2HIOD 2Y2OA 5B32A 4QLCD 1P3PD 4X23D 4J8XA 4R8PC 4XUJB 3X1UB 5GSUD 4LD9A 1P3FA 1F66D 1TAFB 4JJNA 3EG5B 3LELA 3LJAB 3AZFB 1U35C 4H9QA 1M19C 4Z66D 3LZ0A 4J8UD 2HUEC 5AVBC 5B2IC 5GT0D 4YS3B 4XUJA 1S32B 1T3UA 2JE5A 1P3GC 2BYMB 1TAFA 4Z5TA 3LJAA 3AZFA 1P3KD 1KX4D 4WU8D 2BYKA 1KX3A 5CPJD 3WAAD 1S32A 1P3OA 2BYMA 1P34B 3B0DC 1AOID 1R4VA 4DRBA 5B0YC 5BNVB 5GXQB 3UT9B 1P3AA 5AV5D 3MGQA 1EQZB 3B0CT 3UTAC 3W97B 2NQBA 3W96D 5AV9A 4KUDD 5F99C 1P34A 3A6NC 3MVDC 2F8NB 3WA9A 1PZRA 4KGCB 3AZIB 5BNVA 4J8WA 3UT9A 5AV8D 5AV6B 5B24D 1P3PB 2HIOB 4QLCB 3AZMC 4ZBJC 4X23B 2IO5B 5GSUB 3MGPC 3RELC 2F8NA 3AZIA 4NE6A
chains in the Genus database with same CATH topology
1HQ3D 2HIOA 5DNNC 3KUYD 3R45B 4J8UB 1P3PA 4XZQD 4WNNB 5GT0B 4HGAB 4YM6D 4X23A 3AN2D 2Y2GA 5AY8B 5GSUA 3AZLD 1F66A 1P3KB 3AZNA 1KX4B 1TZYD 3AYWD 3WKJD 2Y2JA 4Z66A 4J8UA 4WU8B 4J8VD 3WAAB 3UTBD 1AOIB 2FJ7C 5DNMD 1KX4A 3C1CC 3REJD 3B0CW 2RVQC 5B1MD 5B1LC 5B31D 5B2JD 5AV5B 1M18C 5CPJA 3W98C 4CAYB 1P3LB 4NFTA 3VH6A 1H3OA 4KUDB 4G92B 3VH5A 1P3MC 5B40D 3X1SD 4CSRA 5AV8B 5B24B 5AV5A 3KXBB 1ID3D 3EPHA 5C3IB 2NZDD 1WWIA 3W96A 3MGRC 2CV5D 3X1TC 3REKD 3REHC 4DQYB 5AV8A 1KX5C 5B24A 5E5AD 5GT3C 1HQ3B 3KUYB 4XZQB 3AN2B 4YM6B 5B32G 3B6GC 5BO0B 3AZLB 5B0ZC 4YS3D 3B6FC 1P3IC 1ZLAA 1TZYB 3AYWB 3O62D 2Y2MA 3KUYA 2PYOB 2ZY3A 4XZQA 3AV1A 1Q9CA 4YM6A 3AN2A 4J8VB 5B33C 3UTBB 2G5HC 5BO0A 3AZLA 3MNND 5AVCD 4UUZA 5B32C 5CP6D 5DNMB 1TZYA 3AV2C 3AZED 3AZGD 3REJB 1M1AC 4J8XC 5B2JB 3WKJA 3REIB 2LY8A 3X1VC 5GXQD 5CPKC 4LD9C 1P3FC 4JJNC 2W8SA 3UTBA 1EQZD 4R8PD 3W97D 5B40B 3LZ0C 3P5JB 5DNMA 3X1SB 3C1BB 2AROA 5B2JA 5B1MA 5B31A 2Y2IA 3AZJA 1M19D 4KGCD 5B2ID 5AVBD 1ID3B 2NZDB 5BNXA 4Z5TC 2CV5B 1P3GD 5B40A 5G49A 3REKB 1JFIB 3X1SA 3FDDA 1KX3C 2DF4C 3H0RC 4WU9C 5E5AB 1P3OC 2NZDA 3WTPC 3IP4C 2CV5A 1P3AC 2F2AC 4H9OB 4H9NB 5AY8D 3X1UA 3MGQC 5B0YD 3O62B 2NQBC 5AV9C 3UTAD 3VH6T 3WA9C 2ZY5A 1A7WA 3KWQB 2ZY2A 3VH5T 4J8WC 3MNNB 3MGSB 4YS3A 4H9OA 3A6ND 4AWLC 4H9NA 5AVCB 5CP6B 3AZEB 3AZGB 3WTPE 3TU4C 3O62A 4M6BA 3AZMD 4ZUXC 1BH8B 4Z2MG 3AL0C 4R8PB 3MGPD 3RELD 3AZKC 1P3LD 2Y2PA 5CP6A 3AZEA 3AZGA 3V9RB 1U35B 2Y2QA 1M19B 2F8NK 5DNND 5GXQA 4UPKA 2HUEB 2YFVB 5CHLB 5B2IB 1BH8A 5AVBB 1F66C 1EQZA 3AZNC 1P3GB 3W97A 2Y2HA 3KXBD 4NE3A 4Z66C 2BG1A 3V9RA 4HGAC 4E45A 3AZKA 1M19A 4KGCA 4H9SC 5B2IA 5AV6A 5AVBA 4WJ3C 4Z2MH 4QLCA 3LZ1C 2FFFB 3B0DB 5CPID 5B0YB 5CPJC 3C1CD 2RVQD 3VH6W 5B1LD 3VH5W 1M18D 3UTAB 2PYOD 3R45A 1B67A 4WNNA 5GT0A 5F99B 3A1KA 3A6NB 5AV5C 3KFUG 2VQRA 5AY8A 5BS7A 5B0YA 3W96C 1P3KA 4E44A 3AZMB 4ZBJB 5JRGC 4WU8A 3REID 3MGRD 3X1TD 5B24C 3MGPB 3RELB 3WAAA 3REHD 1AOIA 3NQJB 5GT3D 3C1BD 5DNNB 3F6TA 1ZLAC 1P3BC 5KDMB 3MGPA 5B0ZD 4CAYA 1P3LA 3B6FD 4KUDA 1P3ID 3AV1C 3NQJA 3W99C 2JCHA 2RIQA 5B33D 4G91C 1N1JB 3KXBA 3AFAC 3WKJC 2FJ7B 5CPIB 5B32D 3AV2D 1M1AD 3C1CB 4H9PB 3UTBC 5B1LB 2UWXA 3X1VD 5CPKD 1M18B 4LD9D 3W98B 1P3FD 1HQ3A 5BT1C 2AROC 2JSSA 4WV4B 1KU5A 5B1MC 5B31C 1P3MB 3AZJC 3KWQD 5CPIA 3AZHD 3MGSD 4H9PA 4H9RB 4WZSB 3EPKA 3AYWA 1M18A 2PYOA 3MGRB 3X1TB 4J8VA 3LELC 3REHB 1KX3D 1KX5B 4H9RA 4WU9D 5GT3B 3REJA 1U35D 4XUJC 4EO5B 3WTPD 3REIA 3X1UC 3MGRA 1BFMA 1P3AD 5B0ZB 1Z2CB 3B6FB 3LJAC 3REHA 3AZFC 1P3IB 2NQBD 3C1BA 5JA4B 4DRAA 4YS3C 1W2EA 1S32C 5B33B 3WA9D 3KSYA 4J8WD 1ID3A 5B0ZA 2L5AA 2YFWB 2XD1A 3B6FA 1P3IA 5B32B 3AV2B 1M1AB 3REKA 1JFIA 3NQUB 3TU4D 4J8XB 5JA4A 3X1VB 5CPKB 4LD9B 2F8NG 5E5AA 1P3FB 4ZUXD 5B33A 4JJNB 3A1IA 1P34C 4H9QB 3AZKD 2Y2NA 5GXQC 3AV2A 3UT9C 3AZHB 1M1AA 5F99D 3NQUA 3MVDD 1EQZC 1F1EA 5FUGB 3X1VA 5CPKA 3W97C 4Z5TB 3EPJA 3AZND 4KGCC 3KWQA 3AZIC 3AZHA 2BYKB 5AV6C 3MNNA 3MGSA 1KX3B 4WU9B 5AVCA 2HIOC 1P3PC 4QLCC 5FUGA 1P3OB 4X23C 2F8NH 2IO5C 3WTPB 2Y2LA 5GSUC 3LZ1D 1P3AB 4R8PA 3MGQB 4WU9A 4J8UC 2NQBB 5AV9B 3B0BA 5GT0C 1U35A 3WTPA 5AY8C 5BS7C 3WA9B 3H0MC 2YFVA 4J8WB 4AWLB 2CWEA 1P3KC 1KX4C 1P3GA 3TU4B 2ZM5A 2FJ7D 4WU8C 3WAAC 4ZUXB 5JRGD 1AOIC 3W98D 3AZKB 3TU4A 1P3MD 3MVDB 1ULYA 1F66B 4ZUXA 1P3LC 4KUDC 4G92C 3AZNB 1ZLAD 1P3BD 3UTAA 4Z66B 5AV8C 5F99A 3AV1D 3A6NA 3MVDA 3W99D 3KXBC 1KX5D 5C3IC 1HTAA 3LZ1B 3AZMA 3AFAD 1B6WA 3B6GD 2DQNC 3RELA 5CPJB 1HQ3C 3KUYC 4H9SA 2Y2KA 4XZQC 1H3OB 3AN2C 4YM6C 5BT1D 5DNNA 5CPIC 3LZ1A 3AZLC 1WWSA 4CSRB 5B31G 2AROD 3AZJD 1TZYC 2G5IC 2J8PA 5KDMA 3AYWC 2PYOC 3W96B 4J8VC 2ZY4A 5JRGB 4NE5A 4J8XD 4JJND 5DNMC 1N1JA 3H0LC 3LELD 3REJC 5B2JC 2FJ7A 3REIC 3LZ0D 3C1CA 5JRGA 5B1LA 4XUJD 2XD5A 3X1UD 1ZLAB 1P3BB 5B40C 3W98A 3X1SC 3C1BC 4Z5TD 3LJAD 3AZFD 3AV1B 1P3MA 4EO5C 3W99B 1ID3C 2NZDC 1S32D 2CV5C 4UUZB 4G91B 1P3OD 1P3BA 3REKC 3AFAB 3WKJB 3X1TA 3B6GB 5E5AC 3W99A 3MGQD 1KX5A 1BH9B 5GT3A 5AV9D 3AFAA 1P34D 2AROB 4KHAB 5B1MB 5B31B 3AZJB 3B6GA 3UT9D 3O62C 5BNXB 1BH9A 5G49B 3KWQC 3AZHC 3MNNC 3MGSC 3EPLA 4KHAA 5AVCC 2F8ND 5CP6C 3AZID 3LELB 3AZEC 3AZGC 5AV6D 2YFWA 3LZ0B 2HIOD 2Y2OA 5B32A 4QLCD 1P3PD 4X23D 4J8XA 4R8PC 4XUJB 3X1UB 5GSUD 4LD9A 1P3FA 1F66D 1TAFB 4JJNA 3EG5B 3LELA 3LJAB 3AZFB 1U35C 4H9QA 1M19C 4Z66D 3LZ0A 4J8UD 2HUEC 5AVBC 5B2IC 5GT0D 4YS3B 4XUJA 1S32B 1T3UA 2JE5A 1P3GC 2BYMB 1TAFA 4Z5TA 3LJAA 3AZFA 1P3KD 1KX4D 4WU8D 2BYKA 1KX3A 5CPJD 3WAAD 1S32A 1P3OA 2BYMA 1P34B 3B0DC 1AOID 1R4VA 4DRBA 5B0YC 5BNVB 5GXQB 3UT9B 1P3AA 5AV5D 3MGQA 1EQZB 3B0CT 3UTAC 3W97B 2NQBA 3W96D 5AV9A 4KUDD 5F99C 1P34A 3A6NC 3MVDC 2F8NB 3WA9A 1PZRA 4KGCB 3AZIB 5BNVA 4J8WA 3UT9A 5AV8D 5AV6B 5B24D 1P3PB 2HIOB 4QLCB 3AZMC 4ZBJC 4X23B 2IO5B 5GSUB 3MGPC 3RELC 2F8NA 3AZIA 4NE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 D;  2HIO A;  5DNN C;  3KUY D;  3R45 B;  4J8U B;  1P3P A;  4XZQ D;  4WNN B;  5GT0 B;  4HGA B;  4YM6 D;  4X23 A;  3AN2 D;  5AY8 B;  5GSU A;  3AZL D;  1F66 A;  1P3K B;  3AZN A;  1KX4 B;  1TZY D;  3AYW D;  3WKJ D;  4Z66 A;  4J8U A;  4WU8 B;  4J8V D;  3WAA B;  3UTB D;  1AOI B;  2FJ7 C;  5DNM D;  1KX4 A;  3C1C C;  3REJ D;  3B0C W;  2RVQ C;  5B1M D;  5B1L C;  5B31 D;  5B2J D;  5AV5 B;  1M18 C;  5CPJ A;  3W98 C;  4CAY B;  1P3L B;  4NFT A;  3VH6 A;  1H3O A;  4KUD B;  4G92 B;  3VH5 A;  1P3M C;  5B40 D;  3X1S D;  4CSR A;  5AV8 B;  5B24 B;  5AV5 A;  3KXB B;  1ID3 D;  5C3I B;  2NZD D;  1WWI A;  3W96 A;  3MGR C;  2CV5 D;  3X1T C;  3REK D;  3REH C;  5AV8 A;  1KX5 C;  5B24 A;  5E5A D;  5GT3 C;  1HQ3 B;  3KUY B;  4XZQ B;  3AN2 B;  4YM6 B;  5B32 G;  3B6G C;  5BO0 B;  3AZL B;  5B0Z C;  4YS3 D;  3B6F C;  1P3I C;  1ZLA A;  1TZY B;  3AYW B;  3O62 D;  3KUY A;  2PYO B;  4XZQ A;  3AV1 A;  1Q9C A;  4YM6 A;  3AN2 A;  4J8V B;  5B33 C;  3UTB B;  5BO0 A;  3AZL A;  3MNN D;  5AVC D;  4UUZ A;  5B32 C;  5CP6 D;  5DNM B;  1TZY A;  3AV2 C;  3AZE D;  3AZG D;  3REJ B;  1M1A C;  4J8X C;  5B2J B;  3WKJ A;  3REI B;  2LY8 A;  3X1V C;  5GXQ D;  5CPK C;  4LD9 C;  1P3F C;  4JJN C;  3UTB A;  1EQZ D;  4R8P D;  3W97 D;  5B40 B;  3LZ0 C;  5DNM A;  3X1S B;  3C1B B;  2ARO A;  5B2J A;  5B1M A;  5B31 A;  3AZJ A;  1M19 D;  4KGC D;  5B2I D;  5AVB D;  1ID3 B;  2NZD B;  5BNX A;  4Z5T C;  2CV5 B;  1P3G D;  5B40 A;  5G49 A;  3REK B;  1JFI B;  3X1S A;  1KX3 C;  4WU9 C;  5E5A B;  1P3O C;  2NZD A;  3WTP C;  2CV5 A;  1P3A C;  4H9O B;  4H9N B;  5AY8 D;  3X1U A;  3MGQ C;  5B0Y D;  3O62 B;  2NQB C;  5AV9 C;  3UTA D;  3VH6 T;  3WA9 C;  1A7W A;  3KWQ B;  3VH5 T;  4J8W C;  3MNN B;  3MGS B;  4YS3 A;  4H9O A;  3A6N D;  4AWL C;  4H9N A;  5AVC B;  5CP6 B;  3AZE B;  3AZG B;  3WTP E;  3TU4 C;  3O62 A;  4M6B A;  3AZM D;  4ZUX C;  1BH8 B;  4Z2M G;  4R8P B;  3MGP D;  3REL D;  3AZK C;  1P3L D;  5CP6 A;  3AZE A;  3AZG A;  3V9R B;  1U35 B;  1M19 B;  2F8N K;  5DNN D;  5GXQ A;  2HUE B;  2YFV B;  5CHL B;  5B2I B;  1BH8 A;  5AVB B;  1F66 C;  1EQZ A;  3AZN C;  1P3G B;  3W97 A;  3KXB D;  4NE3 A;  4Z66 C;  3V9R A;  4HGA C;  4E45 A;  3AZK A;  1M19 A;  4KGC A;  4H9S C;  5B2I A;  5AV6 A;  5AVB A;  4Z2M H;  4QLC A;  3LZ1 C;  3B0D B;  5CPI D;  5B0Y B;  5CPJ C;  3C1C D;  2RVQ D;  3VH6 W;  5B1L D;  3VH5 W;  1M18 D;  3UTA B;  2PYO D;  3R45 A;  1B67 A;  4WNN A;  5GT0 A;  5F99 B;  3A6N B;  5AV5 C;  5AY8 A;  5BS7 A;  5B0Y A;  3W96 C;  1P3K A;  4E44 A;  3AZM B;  4ZBJ B;  5JRG C;  4WU8 A;  3REI D;  3MGR D;  3X1T D;  5B24 C;  3MGP B;  3REL B;  3WAA A;  3REH D;  1AOI A;  3NQJ B;  5GT3 D;  3C1B D;  5DNN B;  1ZLA C;  1P3B C;  5KDM B;  3MGP A;  5B0Z D;  4CAY A;  1P3L A;  3B6F D;  4KUD A;  1P3I D;  3AV1 C;  3NQJ A;  3W99 C;  5B33 D;  4G91 C;  1N1J B;  3KXB A;  3AFA C;  3WKJ C;  2FJ7 B;  5CPI B;  5B32 D;  3AV2 D;  1M1A D;  3C1C B;  4H9P B;  3UTB C;  5B1L B;  3X1V D;  5CPK D;  1M18 B;  4LD9 D;  3W98 B;  1P3F D;  1HQ3 A;  5BT1 C;  2ARO C;  2JSS A;  4WV4 B;  1KU5 A;  5B1M C;  5B31 C;  1P3M B;  3AZJ C;  3KWQ D;  5CPI A;  3AZH D;  3MGS D;  4H9P A;  4H9R B;  4WZS B;  3AYW A;  1M18 A;  2PYO A;  3MGR B;  3X1T B;  4J8V A;  3LEL C;  3REH B;  1KX3 D;  1KX5 B;  4H9R A;  4WU9 D;  5GT3 B;  3REJ A;  1U35 D;  4XUJ C;  4EO5 B;  3WTP D;  3REI A;  3X1U C;  3MGR A;  1BFM A;  1P3A D;  5B0Z B;  3B6F B;  3LJA C;  3REH A;  3AZF C;  1P3I B;  2NQB D;  3C1B A;  5JA4 B;  4DRA A;  4YS3 C;  1S32 C;  5B33 B;  3WA9 D;  3KSY A;  4J8W D;  1ID3 A;  5B0Z A;  2L5A A;  2YFW B;  3B6F A;  1P3I A;  5B32 B;  3AV2 B;  1M1A B;  3REK A;  1JFI A;  3NQU B;  3TU4 D;  4J8X B;  5JA4 A;  3X1V B;  5CPK B;  4LD9 B;  2F8N G;  5E5A A;  1P3F B;  4ZUX D;  5B33 A;  4JJN B;  1P34 C;  4H9Q B;  3AZK D;  5GXQ C;  3AV2 A;  3UT9 C;  3AZH B;  1M1A A;  5F99 D;  3NQU A;  3MVD D;  1EQZ C;  1F1E A;  5FUG B;  3X1V A;  5CPK A;  3W97 C;  4Z5T B;  3AZN D;  4KGC C;  3KWQ A;  3AZI C;  3AZH A;  2BYK B;  5AV6 C;  3MNN A;  3MGS A;  1KX3 B;  4WU9 B;  5AVC A;  2HIO C;  1P3P C;  4QLC C;  5FUG A;  1P3O B;  4X23 C;  2F8N H;  2IO5 C;  3WTP B;  5GSU C;  3LZ1 D;  1P3A B;  4R8P A;  3MGQ B;  4WU9 A;  4J8U C;  2NQB B;  5AV9 B;  3B0B A;  5GT0 C;  1U35 A;  3WTP A;  5AY8 C;  5BS7 C;  3WA9 B;  2YFV A;  4J8W B;  4AWL B;  2CWE A;  1P3K C;  1KX4 C;  1P3G A;  3TU4 B;  2FJ7 D;  4WU8 C;  3WAA C;  4ZUX B;  5JRG D;  1AOI C;  3W98 D;  3AZK B;  3TU4 A;  1P3M D;  3MVD B;  1ULY A;  1F66 B;  4ZUX A;  1P3L C;  4KUD C;  4G92 C;  3AZN B;  1ZLA D;  1P3B D;  3UTA A;  4Z66 B;  5AV8 C;  5F99 A;  3AV1 D;  3A6N A;  3MVD A;  3W99 D;  3KXB C;  1KX5 D;  5C3I C;  1HTA A;  3LZ1 B;  3AZM A;  3AFA D;  1B6W A;  3B6G D;  3REL A;  5CPJ B;  1HQ3 C;  3KUY C;  4H9S A;  4XZQ C;  1H3O B;  3AN2 C;  4YM6 C;  5BT1 D;  5DNN A;  5CPI C;  3LZ1 A;  3AZL C;  1WWS A;  4CSR B;  5B31 G;  2ARO D;  3AZJ D;  1TZY C;  3AYW C;  5KDM A;  2PYO C;  3W96 B;  4J8V C;  4J8X D;  5JRG B;  4NE5 A;  4JJN D;  5DNM C;  1N1J A;  3LEL D;  3REJ C;  5B2J C;  2FJ7 A;  3REI C;  3LZ0 D;  3C1C A;  5JRG A;  5B1L A;  4XUJ D;  3X1U D;  1ZLA B;  1P3B B;  5B40 C;  3W98 A;  3X1S C;  3C1B C;  4Z5T D;  3LJA D;  3AZF D;  3AV1 B;  1P3M A;  4EO5 C;  3W99 B;  1ID3 C;  2NZD C;  1S32 D;  2CV5 C;  4UUZ B;  4G91 B;  1P3O D;  1P3B A;  3REK C;  3AFA B;  3WKJ B;  3X1T A;  3B6G B;  5E5A C;  3W99 A;  3MGQ D;  1KX5 A;  1BH9 B;  5GT3 A;  5AV9 D;  3AFA A;  1P34 D;  2ARO B;  4KHA B;  5B1M B;  5B31 B;  3AZJ B;  3B6G A;  3UT9 D;  3O62 C;  5BNX B;  1BH9 A;  5G49 B;  3KWQ C;  3AZH C;  3MNN C;  3MGS C;  4KHA A;  5AVC C;  2F8N D;  5CP6 C;  3AZI D;  3LEL B;  3AZE C;  3AZG C;  5AV6 D;  2YFW A;  3LZ0 B;  2HIO D;  5B32 A;  1P3P D;  4QLC D;  4X23 D;  4J8X A;  4R8P C;  4XUJ B;  3X1U B;  5GSU D;  4LD9 A;  1P3F A;  1F66 D;  1TAF B;  4JJN A;  3LEL A;  3LJA B;  3AZF B;  1U35 C;  4H9Q A;  1M19 C;  4Z66 D;  3LZ0 A;  4J8U D;  2HUE C;  5AVB C;  5B2I C;  5GT0 D;  4YS3 B;  4XUJ A;  1S32 B;  1P3G C;  2BYM B;  1TAF A;  4Z5T A;  3LJA A;  3AZF A;  1P3K D;  1KX4 D;  4WU8 D;  2BYK A;  1KX3 A;  5CPJ D;  3WAA D;  1S32 A;  1P3O A;  2BYM A;  1P34 B;  3B0D C;  1AOI D;  1R4V A;  4DRB A;  5B0Y C;  5BNV B;  5GXQ B;  3UT9 B;  1P3A A;  5AV5 D;  3MGQ A;  1EQZ B;  3B0C T;  3UTA C;  3W97 B;  2NQB A;  3W96 D;  5AV9 A;  4KUD D;  5F99 C;  1P34 A;  3A6N C;  3MVD C;  2F8N B;  3WA9 A;  4KGC B;  3AZI B;  5BNV A;  4J8W A;  3UT9 A;  5AV8 D;  5AV6 B;  5B24 D;  1P3P B;  2HIO B;  4QLC B;  3AZM C;  4ZBJ C;  4X23 B;  2IO5 B;  5GSU B;  3MGP C;  3REL C;  2F8N A;  3AZI A;  4NE6 A; 
#chains in the Genus database with same CATH topology
 1HQ3 D;  2HIO A;  5DNN C;  3KUY D;  3R45 B;  4J8U B;  1P3P A;  4XZQ D;  4WNN B;  5GT0 B;  4HGA B;  4YM6 D;  4X23 A;  3AN2 D;  2Y2G A;  5AY8 B;  5GSU A;  3AZL D;  1F66 A;  1P3K B;  3AZN A;  1KX4 B;  1TZY D;  3AYW D;  3WKJ D;  2Y2J A;  4Z66 A;  4J8U A;  4WU8 B;  4J8V D;  3WAA B;  3UTB D;  1AOI B;  2FJ7 C;  5DNM D;  1KX4 A;  3C1C C;  3REJ D;  3B0C W;  2RVQ C;  5B1M D;  5B1L C;  5B31 D;  5B2J D;  5AV5 B;  1M18 C;  5CPJ A;  3W98 C;  4CAY B;  1P3L B;  4NFT A;  3VH6 A;  1H3O A;  4KUD B;  4G92 B;  3VH5 A;  1P3M C;  5B40 D;  3X1S D;  4CSR A;  5AV8 B;  5B24 B;  5AV5 A;  3KXB B;  1ID3 D;  3EPH A;  5C3I B;  2NZD D;  1WWI A;  3W96 A;  3MGR C;  2CV5 D;  3X1T C;  3REK D;  3REH C;  4DQY B;  5AV8 A;  1KX5 C;  5B24 A;  5E5A D;  5GT3 C;  1HQ3 B;  3KUY B;  4XZQ B;  3AN2 B;  4YM6 B;  5B32 G;  3B6G C;  5BO0 B;  3AZL B;  5B0Z C;  4YS3 D;  3B6F C;  1P3I C;  1ZLA A;  1TZY B;  3AYW B;  3O62 D;  2Y2M A;  3KUY A;  2PYO B;  2ZY3 A;  4XZQ A;  3AV1 A;  1Q9C A;  4YM6 A;  3AN2 A;  4J8V B;  5B33 C;  3UTB B;  2G5H C;  5BO0 A;  3AZL A;  3MNN D;  5AVC D;  4UUZ A;  5B32 C;  5CP6 D;  5DNM B;  1TZY A;  3AV2 C;  3AZE D;  3AZG D;  3REJ B;  1M1A C;  4J8X C;  5B2J B;  3WKJ A;  3REI B;  2LY8 A;  3X1V C;  5GXQ D;  5CPK C;  4LD9 C;  1P3F C;  4JJN C;  2W8S A;  3UTB A;  1EQZ D;  4R8P D;  3W97 D;  5B40 B;  3LZ0 C;  3P5J B;  5DNM A;  3X1S B;  3C1B B;  2ARO A;  5B2J A;  5B1M A;  5B31 A;  2Y2I A;  3AZJ A;  1M19 D;  4KGC D;  5B2I D;  5AVB D;  1ID3 B;  2NZD B;  5BNX A;  4Z5T C;  2CV5 B;  1P3G D;  5B40 A;  5G49 A;  3REK B;  1JFI B;  3X1S A;  3FDD A;  1KX3 C;  2DF4 C;  3H0R C;  4WU9 C;  5E5A B;  1P3O C;  2NZD A;  3WTP C;  3IP4 C;  2CV5 A;  1P3A C;  2F2A C;  4H9O B;  4H9N B;  5AY8 D;  3X1U A;  3MGQ C;  5B0Y D;  3O62 B;  2NQB C;  5AV9 C;  3UTA D;  3VH6 T;  3WA9 C;  2ZY5 A;  1A7W A;  3KWQ B;  2ZY2 A;  3VH5 T;  4J8W C;  3MNN B;  3MGS B;  4YS3 A;  4H9O A;  3A6N D;  4AWL C;  4H9N A;  5AVC B;  5CP6 B;  3AZE B;  3AZG B;  3WTP E;  3TU4 C;  3O62 A;  4M6B A;  3AZM D;  4ZUX C;  1BH8 B;  4Z2M G;  3AL0 C;  4R8P B;  3MGP D;  3REL D;  3AZK C;  1P3L D;  2Y2P A;  5CP6 A;  3AZE A;  3AZG A;  3V9R B;  1U35 B;  2Y2Q A;  1M19 B;  2F8N K;  5DNN D;  5GXQ A;  4UPK A;  2HUE B;  2YFV B;  5CHL B;  5B2I B;  1BH8 A;  5AVB B;  1F66 C;  1EQZ A;  3AZN C;  1P3G B;  3W97 A;  2Y2H A;  3KXB D;  4NE3 A;  4Z66 C;  2BG1 A;  3V9R A;  4HGA C;  4E45 A;  3AZK A;  1M19 A;  4KGC A;  4H9S C;  5B2I A;  5AV6 A;  5AVB A;  4WJ3 C;  4Z2M H;  4QLC A;  3LZ1 C;  2FFF B;  3B0D B;  5CPI D;  5B0Y B;  5CPJ C;  3C1C D;  2RVQ D;  3VH6 W;  5B1L D;  3VH5 W;  1M18 D;  3UTA B;  2PYO D;  3R45 A;  1B67 A;  4WNN A;  5GT0 A;  5F99 B;  3A1K A;  3A6N B;  5AV5 C;  3KFU G;  2VQR A;  5AY8 A;  5BS7 A;  5B0Y A;  3W96 C;  1P3K A;  4E44 A;  3AZM B;  4ZBJ B;  5JRG C;  4WU8 A;  3REI D;  3MGR D;  3X1T D;  5B24 C;  3MGP B;  3REL B;  3WAA A;  3REH D;  1AOI A;  3NQJ B;  5GT3 D;  3C1B D;  5DNN B;  3F6T A;  1ZLA C;  1P3B C;  5KDM B;  3MGP A;  5B0Z D;  4CAY A;  1P3L A;  3B6F D;  4KUD A;  1P3I D;  3AV1 C;  3NQJ A;  3W99 C;  2JCH A;  2RIQ A;  5B33 D;  4G91 C;  1N1J B;  3KXB A;  3AFA C;  3WKJ C;  2FJ7 B;  5CPI B;  5B32 D;  3AV2 D;  1M1A D;  3C1C B;  4H9P B;  3UTB C;  5B1L B;  2UWX A;  3X1V D;  5CPK D;  1M18 B;  4LD9 D;  3W98 B;  1P3F D;  1HQ3 A;  5BT1 C;  2ARO C;  2JSS A;  4WV4 B;  1KU5 A;  5B1M C;  5B31 C;  1P3M B;  3AZJ C;  3KWQ D;  5CPI A;  3AZH D;  3MGS D;  4H9P A;  4H9R B;  4WZS B;  3EPK A;  3AYW A;  1M18 A;  2PYO A;  3MGR B;  3X1T B;  4J8V A;  3LEL C;  3REH B;  1KX3 D;  1KX5 B;  4H9R A;  4WU9 D;  5GT3 B;  3REJ A;  1U35 D;  4XUJ C;  4EO5 B;  3WTP D;  3REI A;  3X1U C;  3MGR A;  1BFM A;  1P3A D;  5B0Z B;  1Z2C B;  3B6F B;  3LJA C;  3REH A;  3AZF C;  1P3I B;  2NQB D;  3C1B A;  5JA4 B;  4DRA A;  4YS3 C;  1W2E A;  1S32 C;  5B33 B;  3WA9 D;  3KSY A;  4J8W D;  1ID3 A;  5B0Z A;  2L5A A;  2YFW B;  2XD1 A;  3B6F A;  1P3I A;  5B32 B;  3AV2 B;  1M1A B;  3REK A;  1JFI A;  3NQU B;  3TU4 D;  4J8X B;  5JA4 A;  3X1V B;  5CPK B;  4LD9 B;  2F8N G;  5E5A A;  1P3F B;  4ZUX D;  5B33 A;  4JJN B;  3A1I A;  1P34 C;  4H9Q B;  3AZK D;  2Y2N A;  5GXQ C;  3AV2 A;  3UT9 C;  3AZH B;  1M1A A;  5F99 D;  3NQU A;  3MVD D;  1EQZ C;  1F1E A;  5FUG B;  3X1V A;  5CPK A;  3W97 C;  4Z5T B;  3EPJ A;  3AZN D;  4KGC C;  3KWQ A;  3AZI C;  3AZH A;  2BYK B;  5AV6 C;  3MNN A;  3MGS A;  1KX3 B;  4WU9 B;  5AVC A;  2HIO C;  1P3P C;  4QLC C;  5FUG A;  1P3O B;  4X23 C;  2F8N H;  2IO5 C;  3WTP B;  2Y2L A;  5GSU C;  3LZ1 D;  1P3A B;  4R8P A;  3MGQ B;  4WU9 A;  4J8U C;  2NQB B;  5AV9 B;  3B0B A;  5GT0 C;  1U35 A;  3WTP A;  5AY8 C;  5BS7 C;  3WA9 B;  3H0M C;  2YFV A;  4J8W B;  4AWL B;  2CWE A;  1P3K C;  1KX4 C;  1P3G A;  3TU4 B;  2ZM5 A;  2FJ7 D;  4WU8 C;  3WAA C;  4ZUX B;  5JRG D;  1AOI C;  3W98 D;  3AZK B;  3TU4 A;  1P3M D;  3MVD B;  1ULY A;  1F66 B;  4ZUX A;  1P3L C;  4KUD C;  4G92 C;  3AZN B;  1ZLA D;  1P3B D;  3UTA A;  4Z66 B;  5AV8 C;  5F99 A;  3AV1 D;  3A6N A;  3MVD A;  3W99 D;  3KXB C;  1KX5 D;  5C3I C;  1HTA A;  3LZ1 B;  3AZM A;  3AFA D;  1B6W A;  3B6G D;  2DQN C;  3REL A;  5CPJ B;  1HQ3 C;  3KUY C;  4H9S A;  2Y2K A;  4XZQ C;  1H3O B;  3AN2 C;  4YM6 C;  5BT1 D;  5DNN A;  5CPI C;  3LZ1 A;  3AZL C;  1WWS A;  4CSR B;  5B31 G;  2ARO D;  3AZJ D;  1TZY C;  2G5I C;  2J8P A;  5KDM A;  3AYW C;  2PYO C;  3W96 B;  4J8V C;  2ZY4 A;  5JRG B;  4NE5 A;  4J8X D;  4JJN D;  5DNM C;  1N1J A;  3H0L C;  3LEL D;  3REJ C;  5B2J C;  2FJ7 A;  3REI C;  3LZ0 D;  3C1C A;  5JRG A;  5B1L A;  4XUJ D;  2XD5 A;  3X1U D;  1ZLA B;  1P3B B;  5B40 C;  3W98 A;  3X1S C;  3C1B C;  4Z5T D;  3LJA D;  3AZF D;  3AV1 B;  1P3M A;  4EO5 C;  3W99 B;  1ID3 C;  2NZD C;  1S32 D;  2CV5 C;  4UUZ B;  4G91 B;  1P3O D;  1P3B A;  3REK C;  3AFA B;  3WKJ B;  3X1T A;  3B6G B;  5E5A C;  3W99 A;  3MGQ D;  1KX5 A;  1BH9 B;  5GT3 A;  5AV9 D;  3AFA A;  1P34 D;  2ARO B;  4KHA B;  5B1M B;  5B31 B;  3AZJ B;  3B6G A;  3UT9 D;  3O62 C;  5BNX B;  1BH9 A;  5G49 B;  3KWQ C;  3AZH C;  3MNN C;  3MGS C;  3EPL A;  4KHA A;  5AVC C;  2F8N D;  5CP6 C;  3AZI D;  3LEL B;  3AZE C;  3AZG C;  5AV6 D;  2YFW A;  3LZ0 B;  2HIO D;  2Y2O A;  5B32 A;  4QLC D;  1P3P D;  4X23 D;  4J8X A;  4R8P C;  4XUJ B;  3X1U B;  5GSU D;  4LD9 A;  1P3F A;  1F66 D;  1TAF B;  4JJN A;  3EG5 B;  3LEL A;  3LJA B;  3AZF B;  1U35 C;  4H9Q A;  1M19 C;  4Z66 D;  3LZ0 A;  4J8U D;  2HUE C;  5AVB C;  5B2I C;  5GT0 D;  4YS3 B;  4XUJ A;  1S32 B;  1T3U A;  2JE5 A;  1P3G C;  2BYM B;  1TAF A;  4Z5T A;  3LJA A;  3AZF A;  1P3K D;  1KX4 D;  4WU8 D;  2BYK A;  1KX3 A;  5CPJ D;  3WAA D;  1S32 A;  1P3O A;  2BYM A;  1P34 B;  3B0D C;  1AOI D;  1R4V A;  4DRB A;  5B0Y C;  5BNV B;  5GXQ B;  3UT9 B;  1P3A A;  5AV5 D;  3MGQ A;  1EQZ B;  3B0C T;  3UTA C;  3W97 B;  2NQB A;  3W96 D;  5AV9 A;  4KUD D;  5F99 C;  1P34 A;  3A6N C;  3MVD C;  2F8N B;  3WA9 A;  1PZR A;  4KGC B;  3AZI B;  5BNV A;  4J8W A;  3UT9 A;  5AV8 D;  5AV6 B;  5B24 D;  1P3P B;  2HIO B;  4QLC B;  3AZM C;  4ZBJ C;  4X23 B;  2IO5 B;  5GSU B;  3MGP C;  3REL C;  2F8N A;  3AZI A;  4NE6 A; 
#chains in the Genus database with same CATH homology
 1HQ3 D;  2HIO A;  5DNN C;  3KUY D;  3R45 B;  4J8U B;  1P3P A;  4XZQ D;  4WNN B;  5GT0 B;  4HGA B;  4YM6 D;  4X23 A;  3AN2 D;  2Y2G A;  5AY8 B;  5GSU A;  3AZL D;  1F66 A;  1P3K B;  3AZN A;  1KX4 B;  1TZY D;  3AYW D;  3WKJ D;  2Y2J A;  4Z66 A;  4J8U A;  4WU8 B;  4J8V D;  3WAA B;  3UTB D;  1AOI B;  2FJ7 C;  5DNM D;  1KX4 A;  3C1C C;  3REJ D;  3B0C W;  2RVQ C;  5B1M D;  5B1L C;  5B31 D;  5B2J D;  5AV5 B;  1M18 C;  5CPJ A;  3W98 C;  4CAY B;  1P3L B;  4NFT A;  3VH6 A;  1H3O A;  4KUD B;  4G92 B;  3VH5 A;  1P3M C;  5B40 D;  3X1S D;  4CSR A;  5AV8 B;  5B24 B;  5AV5 A;  3KXB B;  1ID3 D;  3EPH A;  5C3I B;  2NZD D;  1WWI A;  3W96 A;  3MGR C;  2CV5 D;  3X1T C;  3REK D;  3REH C;  4DQY B;  5AV8 A;  1KX5 C;  5B24 A;  5E5A D;  5GT3 C;  1HQ3 B;  3KUY B;  4XZQ B;  3AN2 B;  4YM6 B;  5B32 G;  3B6G C;  5BO0 B;  3AZL B;  5B0Z C;  4YS3 D;  3B6F C;  1P3I C;  1ZLA A;  1TZY B;  3AYW B;  3O62 D;  2Y2M A;  3KUY A;  2PYO B;  2ZY3 A;  4XZQ A;  3AV1 A;  1Q9C A;  4YM6 A;  3AN2 A;  4J8V B;  5B33 C;  3UTB B;  2G5H C;  5BO0 A;  3AZL A;  3MNN D;  5AVC D;  4UUZ A;  5B32 C;  5CP6 D;  5DNM B;  1TZY A;  3AV2 C;  3AZE D;  3AZG D;  3REJ B;  1M1A C;  4J8X C;  5B2J B;  3WKJ A;  3REI B;  2LY8 A;  3X1V C;  5GXQ D;  5CPK C;  4LD9 C;  1P3F C;  4JJN C;  2W8S A;  3UTB A;  1EQZ D;  4R8P D;  3W97 D;  5B40 B;  3LZ0 C;  3P5J B;  5DNM A;  3X1S B;  3C1B B;  2ARO A;  5B2J A;  5B1M A;  5B31 A;  2Y2I A;  3AZJ A;  1M19 D;  4KGC D;  5B2I D;  5AVB D;  1ID3 B;  2NZD B;  5BNX A;  4Z5T C;  2CV5 B;  1P3G D;  5B40 A;  5G49 A;  3REK B;  1JFI B;  3X1S A;  3FDD A;  1KX3 C;  2DF4 C;  3H0R C;  4WU9 C;  5E5A B;  1P3O C;  2NZD A;  3WTP C;  3IP4 C;  2CV5 A;  1P3A C;  2F2A C;  4H9O B;  4H9N B;  5AY8 D;  3X1U A;  3MGQ C;  5B0Y D;  3O62 B;  2NQB C;  5AV9 C;  3UTA D;  3VH6 T;  3WA9 C;  2ZY5 A;  1A7W A;  3KWQ B;  2ZY2 A;  3VH5 T;  4J8W C;  3MNN B;  3MGS B;  4YS3 A;  4H9O A;  3A6N D;  4AWL C;  4H9N A;  5AVC B;  5CP6 B;  3AZE B;  3AZG B;  3WTP E;  3TU4 C;  3O62 A;  4M6B A;  3AZM D;  4ZUX C;  1BH8 B;  4Z2M G;  3AL0 C;  4R8P B;  3MGP D;  3REL D;  3AZK C;  1P3L D;  2Y2P A;  5CP6 A;  3AZE A;  3AZG A;  3V9R B;  1U35 B;  2Y2Q A;  1M19 B;  2F8N K;  5DNN D;  5GXQ A;  4UPK A;  2HUE B;  2YFV B;  5CHL B;  5B2I B;  1BH8 A;  5AVB B;  1F66 C;  1EQZ A;  3AZN C;  1P3G B;  3W97 A;  2Y2H A;  3KXB D;  4NE3 A;  4Z66 C;  2BG1 A;  3V9R A;  4HGA C;  4E45 A;  3AZK A;  1M19 A;  4KGC A;  4H9S C;  5B2I A;  5AV6 A;  5AVB A;  4WJ3 C;  4Z2M H;  4QLC A;  3LZ1 C;  2FFF B;  3B0D B;  5CPI D;  5B0Y B;  5CPJ C;  3C1C D;  2RVQ D;  3VH6 W;  5B1L D;  3VH5 W;  1M18 D;  3UTA B;  2PYO D;  3R45 A;  1B67 A;  4WNN A;  5GT0 A;  5F99 B;  3A1K A;  3A6N B;  5AV5 C;  3KFU G;  2VQR A;  5AY8 A;  5BS7 A;  5B0Y A;  3W96 C;  1P3K A;  4E44 A;  3AZM B;  4ZBJ B;  5JRG C;  4WU8 A;  3REI D;  3MGR D;  3X1T D;  5B24 C;  3MGP B;  3REL B;  3WAA A;  3REH D;  1AOI A;  3NQJ B;  5GT3 D;  3C1B D;  5DNN B;  3F6T A;  1ZLA C;  1P3B C;  5KDM B;  3MGP A;  5B0Z D;  4CAY A;  1P3L A;  3B6F D;  4KUD A;  1P3I D;  3AV1 C;  3NQJ A;  3W99 C;  2JCH A;  2RIQ A;  5B33 D;  4G91 C;  1N1J B;  3KXB A;  3AFA C;  3WKJ C;  2FJ7 B;  5CPI B;  5B32 D;  3AV2 D;  1M1A D;  3C1C B;  4H9P B;  3UTB C;  5B1L B;  2UWX A;  3X1V D;  5CPK D;  1M18 B;  4LD9 D;  3W98 B;  1P3F D;  1HQ3 A;  5BT1 C;  2ARO C;  2JSS A;  4WV4 B;  1KU5 A;  5B1M C;  5B31 C;  1P3M B;  3AZJ C;  3KWQ D;  5CPI A;  3AZH D;  3MGS D;  4H9P A;  4H9R B;  4WZS B;  3EPK A;  3AYW A;  1M18 A;  2PYO A;  3MGR B;  3X1T B;  4J8V A;  3LEL C;  3REH B;  1KX3 D;  1KX5 B;  4H9R A;  4WU9 D;  5GT3 B;  3REJ A;  1U35 D;  4XUJ C;  4EO5 B;  3WTP D;  3REI A;  3X1U C;  3MGR A;  1BFM A;  1P3A D;  5B0Z B;  1Z2C B;  3B6F B;  3LJA C;  3REH A;  3AZF C;  1P3I B;  2NQB D;  3C1B A;  5JA4 B;  4DRA A;  4YS3 C;  1W2E A;  1S32 C;  5B33 B;  3WA9 D;  3KSY A;  4J8W D;  1ID3 A;  5B0Z A;  2L5A A;  2YFW B;  2XD1 A;  3B6F A;  1P3I A;  5B32 B;  3AV2 B;  1M1A B;  3REK A;  1JFI A;  3NQU B;  3TU4 D;  4J8X B;  5JA4 A;  3X1V B;  5CPK B;  4LD9 B;  2F8N G;  5E5A A;  1P3F B;  4ZUX D;  5B33 A;  4JJN B;  3A1I A;  1P34 C;  4H9Q B;  3AZK D;  2Y2N A;  5GXQ C;  3AV2 A;  3UT9 C;  3AZH B;  1M1A A;  5F99 D;  3NQU A;  3MVD D;  1EQZ C;  1F1E A;  5FUG B;  3X1V A;  5CPK A;  3W97 C;  4Z5T B;  3EPJ A;  3AZN D;  4KGC C;  3KWQ A;  3AZI C;  3AZH A;  2BYK B;  5AV6 C;  3MNN A;  3MGS A;  1KX3 B;  4WU9 B;  5AVC A;  2HIO C;  1P3P C;  4QLC C;  5FUG A;  1P3O B;  4X23 C;  2F8N H;  2IO5 C;  3WTP B;  2Y2L A;  5GSU C;  3LZ1 D;  1P3A B;  4R8P A;  3MGQ B;  4WU9 A;  4J8U C;  2NQB B;  5AV9 B;  3B0B A;  5GT0 C;  1U35 A;  3WTP A;  5AY8 C;  5BS7 C;  3WA9 B;  3H0M C;  2YFV A;  4J8W B;  4AWL B;  2CWE A;  1P3K C;  1KX4 C;  1P3G A;  3TU4 B;  2ZM5 A;  2FJ7 D;  4WU8 C;  3WAA C;  4ZUX B;  5JRG D;  1AOI C;  3W98 D;  3AZK B;  3TU4 A;  1P3M D;  3MVD B;  1ULY A;  1F66 B;  4ZUX A;  1P3L C;  4KUD C;  4G92 C;  3AZN B;  1ZLA D;  1P3B D;  3UTA A;  4Z66 B;  5AV8 C;  5F99 A;  3AV1 D;  3A6N A;  3MVD A;  3W99 D;  3KXB C;  1KX5 D;  5C3I C;  1HTA A;  3LZ1 B;  3AZM A;  3AFA D;  1B6W A;  3B6G D;  2DQN C;  3REL A;  5CPJ B;  1HQ3 C;  3KUY C;  4H9S A;  2Y2K A;  4XZQ C;  1H3O B;  3AN2 C;  4YM6 C;  5BT1 D;  5DNN A;  5CPI C;  3LZ1 A;  3AZL C;  1WWS A;  4CSR B;  5B31 G;  2ARO D;  3AZJ D;  1TZY C;  2G5I C;  2J8P A;  5KDM A;  3AYW C;  2PYO C;  3W96 B;  4J8V C;  2ZY4 A;  5JRG B;  4NE5 A;  4J8X D;  4JJN D;  5DNM C;  1N1J A;  3H0L C;  3LEL D;  3REJ C;  5B2J C;  2FJ7 A;  3REI C;  3LZ0 D;  3C1C A;  5JRG A;  5B1L A;  4XUJ D;  2XD5 A;  3X1U D;  1ZLA B;  1P3B B;  5B40 C;  3W98 A;  3X1S C;  3C1B C;  4Z5T D;  3LJA D;  3AZF D;  3AV1 B;  1P3M A;  4EO5 C;  3W99 B;  1ID3 C;  2NZD C;  1S32 D;  2CV5 C;  4UUZ B;  4G91 B;  1P3O D;  1P3B A;  3REK C;  3AFA B;  3WKJ B;  3X1T A;  3B6G B;  5E5A C;  3W99 A;  3MGQ D;  1KX5 A;  1BH9 B;  5GT3 A;  5AV9 D;  3AFA A;  1P34 D;  2ARO B;  4KHA B;  5B1M B;  5B31 B;  3AZJ B;  3B6G A;  3UT9 D;  3O62 C;  5BNX B;  1BH9 A;  5G49 B;  3KWQ C;  3AZH C;  3MNN C;  3MGS C;  3EPL A;  4KHA A;  5AVC C;  2F8N D;  5CP6 C;  3AZI D;  3LEL B;  3AZE C;  3AZG C;  5AV6 D;  2YFW A;  3LZ0 B;  2HIO D;  2Y2O A;  5B32 A;  4QLC D;  1P3P D;  4X23 D;  4J8X A;  4R8P C;  4XUJ B;  3X1U B;  5GSU D;  4LD9 A;  1P3F A;  1F66 D;  1TAF B;  4JJN A;  3EG5 B;  3LEL A;  3LJA B;  3AZF B;  1U35 C;  4H9Q A;  1M19 C;  4Z66 D;  3LZ0 A;  4J8U D;  2HUE C;  5AVB C;  5B2I C;  5GT0 D;  4YS3 B;  4XUJ A;  1S32 B;  1T3U A;  2JE5 A;  1P3G C;  2BYM B;  1TAF A;  4Z5T A;  3LJA A;  3AZF A;  1P3K D;  1KX4 D;  4WU8 D;  2BYK A;  1KX3 A;  5CPJ D;  3WAA D;  1S32 A;  1P3O A;  2BYM A;  1P34 B;  3B0D C;  1AOI D;  1R4V A;  4DRB A;  5B0Y C;  5BNV B;  5GXQ B;  3UT9 B;  1P3A A;  5AV5 D;  3MGQ A;  1EQZ B;  3B0C T;  3UTA C;  3W97 B;  2NQB A;  3W96 D;  5AV9 A;  4KUD D;  5F99 C;  1P34 A;  3A6N C;  3MVD C;  2F8N B;  3WA9 A;  1PZR A;  4KGC B;  3AZI B;  5BNV A;  4J8W A;  3UT9 A;  5AV8 D;  5AV6 B;  5B24 D;  1P3P B;  2HIO B;  4QLC B;  3AZM C;  4ZBJ C;  4X23 B;  2IO5 B;  5GSU B;  3MGP C;  3REL C;  2F8N A;  3AZI A;  4NE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...