1P3GA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gA00
2AROA 5DNMB 5AY8B 4CAYA 4X23B 2CV5B 4Z2MG 3X1VA 4WU9C 2HIOC 2BYMB 4JJNC 4R8PA 1S32C 5B2JB 4KGCD 3AZIC 3WA9D 5AV6A 4Z66D 5B2IC 1F66C 4NE6A 2F8ND 1P3BC 2NZDC 2L5AA 2HUEC 3B6GC 3REIA 3AZJD 1TAFB 1P3AB 5B1MB 5AV9A 1M18A 3C1CD 5E5AA 4HGAC 5FUGB 3A6NB 3AV1C 3MGPA 4G91B 1P3MA 5F99B 5AV8B 5B31B 5GXQD 5JA4B 4DRBA 4XZQD 1U35B 5G49B 5B32A 1BH8A 5AV6D 1BH9A 4EO5B 5GSUA 5B0ZD 5BS7A 1P3LB 1KX3B 5AV5D 1HTAA 5CPIC 4KUDA 5B1LD 3MVDB 4YM6D 3REID 5CPJC 2HIOD 5E5AD 3AV2B 3VH6T 4CAYB 5B2ID 3REKC 1F66D 1P3OC 3X1VB 3LJAC 3MGSB 2F8NG 1P3MD 3X1UC 1P3BD 1KX5C 4H9OA 4LD9C 3W99C 5B33C 3REJA 4ZUXA 4J8XA 4J8UD 4G92C 3B6FA 5B32D 3AV1D 1AOIC 4WU8B 3AZGA 5AV9B 3KSYA 5C3IB 3TU4A 3AZFC 1M18B 1P3KD 2PYOC 4KUDD 3MGPB 5CP6A 2IO5C 2RVQC 3UTBA 3B0DB 4WNNA 1M1AA 4CSRB 3MGQA 1ID3C 5CPID 5B40A 5JRGA 3AZNA 3O62A 5GSUB 5BT1C 5B24B 3REJD 5AVCA 4J8XD 2FJ7B 3B6FD 3AZHA 1B67A 3LJAD 4XUJA 3AZGD 3X1UD 4J8VA 3MGRC 1P34A 1HQ3A 3WTPB 4E45A 3LZ1D 1P3IA 5B33D 5CP6D 1P3FA 3UTBD 4H9OB 3C1BB 3X1TC 5B0YB 5DNNB 1P3PA 5GT3B 3UT9D 4ZUXB 3AFAD 2PYOD 4J8WD 4YS3A 3WAAD 3O62D 2RVQD 5CPKC 3TU4B 1TZYD 4QLCB 3WKJB 1ZLAA 3W96A 3KWQA 5GT0A 3LZ0A 3X1SC 4XUJD 3AZEA 1M19C 4WNNB 5DNMC 5AY8C 4X23C 2CV5C 4H9QA 4H9SC 5AVBB 1M1AB 3W98B 3LELD 5BT1D 5B2JC 1KX4B 3AZKB 3MGQB 4KHAB 1P3GB 5B40B 5JRGB 1Q9CA 3AZNB 4KGCA 3WA9A 1P3AC 5B1MC 2YFVA 3AZHB 3KXBB 2F8NA 2JSSA 3A6NC 3AZJA 4J8VB 1HQ3B 1ZLAD 3X1TD 4G91C 5F99C 5AV8C 3RELA 5GT0D 5B31C 3NQUA 3LZ0D 3AN2B 3KUYA 4H9NA 4ZBJB 4XZQA 4Z5TA 4EO5C 4YS3B 3REHD 3AZMD 1P3LC 1KX3C 1M19D 5DNMD 5BO0A 1EQZB 5B0ZA 3MVDC 3AYWD 3UTAB 3W96B 3VH6A 3B0CW 5AV5A 3AZLB 3MNNB 3AZEB 3AV2C 5B1LA 4YM6A 2NQBB 2HIOA 4JJNA 4H9QB 4DRAA 3X1VC 3MGSC 1S32A 3AZIA 3RELD 3NQJA 5B2IA 1F66A 3WTPE 4AWLB 1P3BA 3KUYD 4KGCB 5BNVA 4Z66B 4WU8C 1KU5A 2YFVB 4Z5TD 5KDMA 5AV8D 5AV9C 5C3IC 1M18C 4J8UA 3AV1A 3MGPC 3C1CB 1B6WA 2YFWB 1P3KA 3B0DC 3NQUB 2F8NH 4WU9D 4JJND 1S32D 5GXQB 4E44A 3AZID 3W97B 2AROB 4NFTA 5GSUC 5BS7C 1WWIA 4R8PB 5B24C 5CPIA 2NZDD 3B6GD 5BO0B 2FJ7C 5AV6B 5B0ZB 5AV5B 1ULYA 5B1LB 3WTPC 4YM6B 3REIB 3LJAA 3REKA 2HIOB 3X1UA 1KX5A 5E5AB 3W99A 3LZ1A 3C1BC 5B31G 5B33A 5B0YC 5DNNC 1P3MB 5GT3C 1P3BB 4ZUXC 1AOIA 3B0CT 1F1EA 2BYKA 3AZFA 3UT9A 3AFAA 3TU4C 4J8UB 2PYOA 4QLCC 5B32B 3WKJC 4J8WA 1BH8B 3WAAA 5CPJD 1BH9B 1TZYA 1P3KB 3VH5W 3AV2A 4KUDB 1M1AC 5AVBC 3REKD 2LY8A 1P3OD 3W98C 1KX4C 3AZKC 3MGQC 1KX5D 1P3GC 5B40C 4LD9D 3W99D 5JRGC 3LELA 3AZNC 4NE5A 4NE3A 1AOID 3KXBC 3AZFD 3REJB 4J8XB 3MGRA 4J8VC 3B6FB 1HQ3C 5B0YD 5DNND 3AZGB 3AN2C 3X1TA 3LZ1B 5B33B 5CP6B 3UTBB 1ID3D 4ZBJC 4YS3C 3UT9B 3AFAB 1EQZC 4J8WB 3X1SA 3UTAC 3W96C 3REHA 3AZMA 3WAAB 4UUZA 1N1JA 5BNXA 3O62B 1M19A 1TZYB 5DNMA 3AZKD 5AY8A 4X23A 3MNNC 3AZEC 3AZLC 2CV5A 4H9SA 5AVCB 3MGRD 3AYWA 1P3GD 2NQBC 2BYMA 4XUJB 1P34B 1P3IB 3LELB 4AWLC 4KGCC 1TAFA 4Z2MH 1P3AA 4Z66C 1P3FB 1U35C 3A6NA 5CPKD 1P3PB 3VH5T 5F99A 5AV8A 3X1SD 5B31A 1R4VA 3C1CC 5AY8D 4X23D 2CV5D 1ZLAB 3X1TB 3KWQB 5GT0B 3LZ0B 5B2JD 5GXQC 3W97C 2AROC 4WU9A 3UTAD 1P3LA 1KX3A 4R8PC 3AZLD 5AV6C 5B0ZC 1P3AD 5B1MD 3REHB 3AZMB 4UUZB 2NZDA 5AV5C 3WA9B 3B6GA 3A6ND 5B1LC 1H3OA 4YM6C 3REIC 3MGSA 3AYWB 5F99D 5B31D 5E5AC 2F8NB 3AZJB 1U35D 1P3MC 3RELB 3R45A 4WU8A 1P3LD 3KUYB 4H9NB 1KX3D 4J8UC 5B32C 1A7WA 4XZQB 3MVDD 4Z5TB 4H9RA 1P3KC 3W97D 3AV2D 2AROD 3B0BA 4KUDC 4CSRA 4WZSB 5CPJA 3X1VD 3MGSD 2CWEA 4R8PD 1P3OA 4WU9B 3W97A 4JJNB 1S32B 5B24A 3AZIB 2FJ7A 3NQJB 4LD9A 5B2IB 1F66B 4WU8D 5AV9D 1M18D 3REJC 2NZDB 1WWSA 2HUEB 4J8XC 3WTPA 3B6GB 5BNVB 3B6FC 1H3OB 2F8NK 3MGPD 3AZGC 5KDMB 4HGAB 3C1BA 3AV1B 3LZ1C 5B0YA 5DNNA 5GT3A 5CP6C 3UTBC 3R45B 5GSUD 3UT9C 3AFAC 4QLCA 5B24D 1ID3A 3WKJA 2FJ7D 4J8WC 3WAAC 3O62C 4H9RB 1TZYC 5CPIB 5AVCC 5AVBA 3WTPD 3W98A 4M6BA 5CPJB 3AZHC 1KX4A 3AZKA 4XUJC 3V9RA 5CHLB 4KHAA 1P3GA 3C1BD 1P34C 3REKB 1P3OB 3LJAB 1P3IC 3LELC 5GT3D 3X1UB 4ZUXD 1KX5B 1P3FC 4LD9B 3W99B 4H9PA 3VH5A 1JFIA 3KXBA 3TU4D 1P3PC 4G92B 4QLCD 3WKJD 1AOIB 3AN2A 5B32G 5CPKA 2BYKB 3AZFB 2PYOB 1ZLAC 1M1AD 5AVBD 3KWQC 3W98D 2IO5B 5GT0C 3LZ0C 1KX4D 3MGQD 5B40D 5JRGD 3AZND 5B2JA 1EQZA 1ID3B 1BFMA 5AVCD 3UTAA 3AZHD 3REHC 3AZMC 3AZLA 3KXBD 3MNNA 3WA9C 2NQBA 4J8VD 5B1MA 3AYWC 1HQ3D 1P34D 1P3ID 5FUGA 3AN2D 3V9RB 3AZJC 3MGRB 1P3FD 3RELC 1P3PD 4Z66A 5JA4A 4H9PB 3VH6W 1U35A 1JFIB 5G49A 4YS3D 3KUYC 1EQZD 4XZQC 3C1CA 2YFWA 4Z5TC 3KWQD 3W96D 5CPKB 3MNND 3AZED 3MVDA 2NQBD 3X1SB 5GXQA 1N1JB 5BNXB 1M19B 4WV4B
chains in the Genus database with same CATH superfamily
2AROA 5DNMB 5AY8B 4CAYA 4X23B 2CV5B 4Z2MG 3X1VA 4WU9C 2HIOC 2BYMB 4JJNC 4R8PA 1S32C 5B2JB 4KGCD 3AZIC 3WA9D 5AV6A 4Z66D 5B2IC 2DQNC 1F66C 4NE6A 2F8ND 1P3BC 2NZDC 2L5AA 2HUEC 3B6GC 3REIA 3AZJD 1TAFB 1P3AB 5B1MB 5AV9A 1M18A 3C1CD 5E5AA 4HGAC 5FUGB 3A6NB 2Y2LA 3AV1C 3MGPA 4G91B 1P3MA 5F99B 5AV8B 5B31B 5GXQD 5JA4B 4DRBA 4XZQD 1U35B 5G49B 5B32A 1BH8A 5AV6D 1BH9A 4EO5B 5GSUA 5B0ZD 5BS7A 1P3LB 1KX3B 5AV5D 1HTAA 5CPIC 4KUDA 5B1LD 2Y2QA 4YM6D 3MVDB 3REID 5CPJC 2HIOD 5E5AD 3AV2B 3VH6T 4CAYB 5B2ID 3REKC 1F66D 1P3OC 3X1VB 3LJAC 3MGSB 2F8NG 1P3MD 3X1UC 1P3BD 1KX5C 4H9OA 4LD9C 3W99C 5B33C 3REJA 4ZUXA 4J8XA 4J8UD 4G92C 3P5JB 5B32D 3B6FA 3AV1D 1AOIC 4WU8B 3AZGA 2ZY2A 3KSYA 5AV9B 5C3IB 3TU4A 3IP4C 3AZFC 1P3KD 1M18B 2Y2KA 2PYOC 4KUDD 3MGPB 5CP6A 2IO5C 2RVQC 3UTBA 3B0DB 4WNNA 3AL0C 1M1AA 4CSRB 3MGQA 1ID3C 5CPID 5B40A 5JRGA 3AZNA 3O62A 5GSUB 5BT1C 5B24B 3REJD 5AVCA 4J8XD 2FJ7B 3B6FD 3AZHA 2Y2GA 1B67A 3LJAD 2Y2OA 4XUJA 3AZGD 3X1UD 2J8PA 4J8VA 3MGRC 1P34A 1HQ3A 3WTPB 4E45A 3LZ1D 1P3IA 5B33D 5CP6D 1P3FA 3UTBD 4H9OB 3C1BB 3X1TC 5B0YB 5DNNB 1P3PA 5GT3B 3UT9D 4ZUXB 3AFAD 2PYOD 4J8WD 4YS3A 3WAAD 3O62D 2RVQD 5CPKC 3TU4B 1TZYD 4QLCB 3WKJB 1ZLAA 3W96A 3KWQA 5GT0A 2F2AC 3LZ0A 3X1SC 4UPKA 4XUJD 3AZEA 1M19C 4WNNB 5DNMC 5AY8C 4X23C 2CV5C 4H9QA 4H9SC 5AVBB 1M1AB 3W98B 3LELD 5BT1D 5B2JC 1KX4B 3AZKB 3MGQB 4KHAB 1P3GB 5B40B 2ZY4A 1Q9CA 5JRGB 3AZNB 4KGCA 3WA9A 1P3AC 3EG5B 2YFVA 5B1MC 3AZHB 3KXBB 2F8NA 2JSSA 3A6NC 3AZJA 4J8VB 2Y2IA 1HQ3B 1ZLAD 3X1TD 4G91C 5F99C 5AV8C 3RELA 5GT0D 5B31C 3NQUA 3LZ0D 3AN2B 2XD1A 3KUYA 4H9NA 4ZBJB 4XZQA 4Z5TA 4EO5C 4YS3B 3REHD 3AZMD 1P3LC 1KX3C 1M19D 5DNMD 5BO0A 1EQZB 5B0ZA 3MVDC 3AYWD 3UTAB 3W96B 3VH6A 3B0CW 2Y2PA 5AV5A 3AZLB 3MNNB 3AZEB 3AV2C 5B1LA 4YM6A 2NQBB 2HIOA 4JJNA 4H9QB 4DRAA 3X1VC 3MGSC 1S32A 2W8SA 3AZIA 3RELD 3NQJA 5B2IA 1F66A 3WTPE 4AWLB 1P3BA 3KUYD 4KGCB 3EPHA 5BNVA 4Z66B 4WU8C 1KU5A 2YFVB 4Z5TD 5KDMA 5AV8D 5AV9C 5C3IC 1M18C 4J8UA 3AV1A 3MGPC 3C1CB 1B6WA 2YFWB 1P3KA 3B0DC 3NQUB 2BG1A 2F8NH 2FFFB 4WU9D 4JJND 1S32D 5GXQB 4E44A 3AZID 3W97B 2AROB 4NFTA 5GSUC 2Y2MA 5BS7C 1WWIA 4R8PB 5B24C 5CPIA 2NZDD 3B6GD 5BO0B 2FJ7C 5AV6B 5B0ZB 5AV5B 1ULYA 5B1LB 3WTPC 4YM6B 3REIB 3LJAA 3EPKA 3REKA 2HIOB 3X1UA 1KX5A 2RIQA 5E5AB 3W99A 3LZ1A 3C1BC 5B31G 5B33A 5B0YC 5DNNC 1P3MB 5GT3C 1P3BB 4ZUXC 1AOIA 3B0CT 1F1EA 2BYKA 3AZFA 3UT9A 3AFAA 3TU4C 3A1KA 4J8UB 2PYOA 4QLCC 5B32B 3WKJC 4J8WA 1BH8B 3WAAA 5CPJD 1BH9B 1TZYA 1P3KB 3H0MC 3VH5W 3AV2A 4KUDB 1M1AC 5AVBC 3REKD 2LY8A 1P3OD 3W98C 1KX4C 3AZKC 3MGQC 1KX5D 1P3GC 5B40C 4LD9D 3W99D 5JRGC 3LELA 3AZNC 4NE5A 4NE3A 1AOID 3KXBC 3AZFD 3REJB 4J8XB 3MGRA 4J8VC 3B6FB 1HQ3C 5B0YD 5DNND 3AZGB 3AN2C 2Y2NA 3X1TA 3LZ1B 5B33B 5CP6B 3UTBB 1ID3D 4ZBJC 4YS3C 3UT9B 3AFAB 1EQZC 4J8WB 2DF4C 3X1SA 2XD5A 3W96C 3REHA 3UTAC 3AZMA 4UUZA 1N1JA 5BNXA 3O62B 1M19A 3WAAB 1TZYB 5DNMA 3AZKD 5AY8A 4X23A 3MNNC 3AZEC 3AZLC 2CV5A 4H9SA 5AVCB 3MGRD 3AYWA 1P3GD 2NQBC 2BYMA 4XUJB 1P34B 1P3IB 3LELB 4AWLC 4KGCC 1PZRA 1TAFA 4Z2MH 1P3AA 4Z66C 2JCHA 1P3FB 1U35C 3A6NA 5CPKD 1P3PB 3VH5T 5F99A 5AV8A 3X1SD 5B31A 1R4VA 3C1CC 5AY8D 4X23D 2CV5D 1ZLAB 3X1TB 3KWQB 4WJ3C 5GT0B 3LZ0B 5B2JD 5GXQC 3W97C 3H0RC 2AROC 4WU9A 3UTAD 1P3LA 1KX3A 4R8PC 3AZLD 3EPJA 1Z2CB 5AV6C 5B0ZC 1P3AD 5B1MD 3REHB 3AZMB 4UUZB 2NZDA 5AV5C 3WA9B 3B6GA 3A6ND 5B1LC 1H3OA 4YM6C 3REIC 3MGSA 3AYWB 5F99D 3F6TA 5B31D 5E5AC 5GXQA 2F8NB 3AZJB 1U35D 1P3MC 3RELB 3R45A 4WU8A 2ZM5A 1P3LD 3KUYB 4H9NB 1KX3D 4J8UC 2ZY3A 5B32C 1A7WA 4XZQB 3MVDD 4Z5TB 4H9RA 1P3KC 3A1IA 3W97D 3AV2D 2AROD 3B0BA 4KUDC 4CSRA 4WZSB 5CPJA 3X1VD 3MGSD 2CWEA 4R8PD 1P3OA 4WU9B 4JJNB 1S32B 5B24A 3AZIB 2FJ7A 3NQJB 4LD9A 5B2IB 1F66B 4WU8D 5AV9D 1M18D 3REJC 2NZDB 1WWSA 2HUEB 4J8XC 3WTPA 3B6GB 5BNVB 3B6FC 1H3OB 2ZY5A 4DQYB 2F8NK 3MGPD 3AZGC 5KDMB 2G5IC 4HGAB 3C1BA 3AV1B 3LZ1C 5B0YA 2VQRA 5DNNA 5GT3A 2JE5A 5CP6C 3UTBC 3R45B 2Y2HA 5GSUD 3UT9C 3AFAC 4QLCA 5B24D 1ID3A 3WKJA 2FJ7D 4J8WC 3WAAC 3O62C 1W2EA 2G5HC 4H9RB 1TZYC 5CPIB 2Y2JA 5AVCC 5AVBA 3WTPD 3W98A 4M6BA 5CPJB 3AZHC 1KX4A 3AZKA 4XUJC 3V9RA 5CHLB 4KHAA 1P3GA 3C1BD 1P34C 3REKB 1P3OB 3LJAB 1P3IC 3LELC 5GT3D 3X1UB 4ZUXD 1KX5B 3FDDA 1P3FC 4LD9B 3W99B 4H9PA 3VH5A 1JFIA 3KXBA 1T3UA 3TU4D 1P3PC 4G92B 3H0LC 4QLCD 3WKJD 1AOIB 3AN2A 5B32G 5CPKA 2BYKB 3AZFB 3KFUG 2PYOB 1ZLAC 1M1AD 5AVBD 3KWQC 3W98D 2IO5B 5GT0C 3LZ0C 1KX4D 3MGQD 5B40D 5JRGD 3AZND 5B2JA 1EQZA 1ID3B 1BFMA 5AVCD 3UTAA 3AZHD 3REHC 3AZMC 3AZLA 3KXBD 3MNNA 3WA9C 2NQBA 4J8VD 5B1MA 3AYWC 1HQ3D 1P34D 3EPLA 1P3ID 5FUGA 3AN2D 3V9RB 3AZJC 3MGRB 1P3FD 3RELC 1P3PD 4Z66A 5JA4A 4H9PB 3VH6W 1U35A 1JFIB 5G49A 4YS3D 3KUYC 1EQZD 4XZQC 3C1CA 2YFWA 4Z5TC 3KWQD 3W96D 2UWXA 5CPKB 3MNND 3AZED 3MVDA 2NQBD 3X1SB 3W97A 1N1JB 5BNXB 1M19B 4WV4B
chains in the Genus database with same CATH topology
2AROA 5DNMB 5AY8B 4CAYA 4X23B 2CV5B 4Z2MG 3X1VA 4WU9C 2HIOC 2BYMB 4JJNC 4R8PA 1S32C 5B2JB 4KGCD 3AZIC 3WA9D 5AV6A 4Z66D 5B2IC 2DQNC 1F66C 4NE6A 2F8ND 1P3BC 2NZDC 2L5AA 2HUEC 3B6GC 3REIA 3AZJD 1TAFB 1P3AB 5B1MB 5AV9A 1M18A 3C1CD 5E5AA 4HGAC 5FUGB 3A6NB 2Y2LA 3AV1C 3MGPA 4G91B 1P3MA 5F99B 5AV8B 5B31B 5GXQD 5JA4B 4DRBA 4XZQD 1U35B 5G49B 5B32A 1BH8A 5AV6D 1BH9A 4EO5B 5GSUA 5B0ZD 5BS7A 1P3LB 1KX3B 5AV5D 1HTAA 5CPIC 4KUDA 5B1LD 2Y2QA 4YM6D 3MVDB 3REID 5CPJC 2HIOD 5E5AD 3AV2B 3VH6T 4CAYB 5B2ID 3REKC 1F66D 1P3OC 3X1VB 3LJAC 3MGSB 2F8NG 1P3MD 3X1UC 1P3BD 1KX5C 4H9OA 4LD9C 3W99C 5B33C 3REJA 4ZUXA 4J8XA 4J8UD 4G92C 3P5JB 5B32D 3B6FA 3AV1D 1AOIC 4WU8B 3AZGA 2ZY2A 3KSYA 5AV9B 5C3IB 3TU4A 3IP4C 3AZFC 1P3KD 1M18B 2Y2KA 2PYOC 4KUDD 3MGPB 5CP6A 2IO5C 2RVQC 3UTBA 3B0DB 4WNNA 3AL0C 1M1AA 4CSRB 3MGQA 1ID3C 5CPID 5B40A 5JRGA 3AZNA 3O62A 5GSUB 5BT1C 5B24B 3REJD 5AVCA 4J8XD 2FJ7B 3B6FD 3AZHA 2Y2GA 1B67A 3LJAD 2Y2OA 4XUJA 3AZGD 3X1UD 2J8PA 4J8VA 3MGRC 1P34A 1HQ3A 3WTPB 4E45A 3LZ1D 1P3IA 5B33D 5CP6D 1P3FA 3UTBD 4H9OB 3C1BB 3X1TC 5B0YB 5DNNB 1P3PA 5GT3B 3UT9D 4ZUXB 3AFAD 2PYOD 4J8WD 4YS3A 3WAAD 3O62D 2RVQD 5CPKC 3TU4B 1TZYD 4QLCB 3WKJB 1ZLAA 3W96A 3KWQA 5GT0A 2F2AC 3LZ0A 3X1SC 4UPKA 4XUJD 3AZEA 1M19C 4WNNB 5DNMC 5AY8C 4X23C 2CV5C 4H9QA 4H9SC 5AVBB 1M1AB 3W98B 3LELD 5BT1D 5B2JC 1KX4B 3AZKB 3MGQB 4KHAB 1P3GB 5B40B 2ZY4A 1Q9CA 5JRGB 3AZNB 4KGCA 3WA9A 1P3AC 3EG5B 2YFVA 5B1MC 3AZHB 3KXBB 2F8NA 2JSSA 3A6NC 3AZJA 4J8VB 2Y2IA 1HQ3B 1ZLAD 3X1TD 4G91C 5F99C 5AV8C 3RELA 5GT0D 5B31C 3NQUA 3LZ0D 3AN2B 2XD1A 3KUYA 4H9NA 4ZBJB 4XZQA 4Z5TA 4EO5C 4YS3B 3REHD 3AZMD 1P3LC 1KX3C 1M19D 5DNMD 5BO0A 1EQZB 5B0ZA 3MVDC 3AYWD 3UTAB 3W96B 3VH6A 3B0CW 2Y2PA 5AV5A 3AZLB 3MNNB 3AZEB 3AV2C 5B1LA 4YM6A 2NQBB 2HIOA 4JJNA 4H9QB 4DRAA 3X1VC 3MGSC 1S32A 2W8SA 3AZIA 3RELD 3NQJA 5B2IA 1F66A 3WTPE 4AWLB 1P3BA 3KUYD 4KGCB 3EPHA 5BNVA 4Z66B 4WU8C 1KU5A 2YFVB 4Z5TD 5KDMA 5AV8D 5AV9C 5C3IC 1M18C 4J8UA 3AV1A 3MGPC 3C1CB 1B6WA 2YFWB 1P3KA 3B0DC 3NQUB 2BG1A 2F8NH 2FFFB 4WU9D 4JJND 1S32D 5GXQB 4E44A 3AZID 3W97B 2AROB 4NFTA 5GSUC 2Y2MA 5BS7C 1WWIA 4R8PB 5B24C 5CPIA 2NZDD 3B6GD 5BO0B 2FJ7C 5AV6B 5B0ZB 5AV5B 1ULYA 5B1LB 3WTPC 4YM6B 3REIB 3LJAA 3EPKA 3REKA 2HIOB 3X1UA 1KX5A 2RIQA 5E5AB 3W99A 3LZ1A 3C1BC 5B31G 5B33A 5B0YC 5DNNC 1P3MB 5GT3C 1P3BB 4ZUXC 1AOIA 3B0CT 1F1EA 2BYKA 3AZFA 3UT9A 3AFAA 3TU4C 3A1KA 4J8UB 2PYOA 4QLCC 5B32B 3WKJC 4J8WA 1BH8B 3WAAA 5CPJD 1BH9B 1TZYA 1P3KB 3H0MC 3VH5W 3AV2A 4KUDB 1M1AC 5AVBC 3REKD 2LY8A 1P3OD 3W98C 1KX4C 3AZKC 3MGQC 1KX5D 1P3GC 5B40C 4LD9D 3W99D 5JRGC 3LELA 3AZNC 4NE5A 4NE3A 1AOID 3KXBC 3AZFD 3REJB 4J8XB 3MGRA 4J8VC 3B6FB 1HQ3C 5B0YD 5DNND 3AZGB 3AN2C 2Y2NA 3X1TA 3LZ1B 5B33B 5CP6B 3UTBB 1ID3D 4ZBJC 4YS3C 3UT9B 3AFAB 1EQZC 4J8WB 2DF4C 3X1SA 2XD5A 3W96C 3REHA 3UTAC 3AZMA 4UUZA 1N1JA 5BNXA 3O62B 1M19A 3WAAB 1TZYB 5DNMA 3AZKD 5AY8A 4X23A 3MNNC 3AZEC 3AZLC 2CV5A 4H9SA 5AVCB 3MGRD 3AYWA 1P3GD 2NQBC 2BYMA 4XUJB 1P34B 1P3IB 3LELB 4AWLC 4KGCC 1PZRA 1TAFA 4Z2MH 1P3AA 4Z66C 2JCHA 1P3FB 1U35C 3A6NA 5CPKD 1P3PB 3VH5T 5F99A 5AV8A 3X1SD 5B31A 1R4VA 3C1CC 5AY8D 4X23D 2CV5D 1ZLAB 3X1TB 3KWQB 4WJ3C 5GT0B 3LZ0B 5B2JD 5GXQC 3W97C 3H0RC 2AROC 4WU9A 3UTAD 1P3LA 1KX3A 4R8PC 3AZLD 3EPJA 1Z2CB 5AV6C 5B0ZC 1P3AD 5B1MD 3REHB 3AZMB 4UUZB 2NZDA 5AV5C 3WA9B 3B6GA 3A6ND 5B1LC 1H3OA 4YM6C 3REIC 3MGSA 3AYWB 5F99D 3F6TA 5B31D 5E5AC 5GXQA 2F8NB 3AZJB 1U35D 1P3MC 3RELB 3R45A 4WU8A 2ZM5A 1P3LD 3KUYB 4H9NB 1KX3D 4J8UC 2ZY3A 5B32C 1A7WA 4XZQB 3MVDD 4Z5TB 4H9RA 1P3KC 3A1IA 3W97D 3AV2D 2AROD 3B0BA 4KUDC 4CSRA 4WZSB 5CPJA 3X1VD 3MGSD 2CWEA 4R8PD 1P3OA 4WU9B 4JJNB 1S32B 5B24A 3AZIB 2FJ7A 3NQJB 4LD9A 5B2IB 1F66B 4WU8D 5AV9D 1M18D 3REJC 2NZDB 1WWSA 2HUEB 4J8XC 3WTPA 3B6GB 5BNVB 3B6FC 1H3OB 2ZY5A 4DQYB 2F8NK 3MGPD 3AZGC 5KDMB 2G5IC 4HGAB 3C1BA 3AV1B 3LZ1C 5B0YA 2VQRA 5DNNA 5GT3A 2JE5A 5CP6C 3UTBC 3R45B 2Y2HA 5GSUD 3UT9C 3AFAC 4QLCA 5B24D 1ID3A 3WKJA 2FJ7D 4J8WC 3WAAC 3O62C 1W2EA 2G5HC 4H9RB 1TZYC 5CPIB 2Y2JA 5AVCC 5AVBA 3WTPD 3W98A 4M6BA 5CPJB 3AZHC 1KX4A 3AZKA 4XUJC 3V9RA 5CHLB 4KHAA 1P3GA 3C1BD 1P34C 3REKB 1P3OB 3LJAB 1P3IC 3LELC 5GT3D 3X1UB 4ZUXD 1KX5B 3FDDA 1P3FC 4LD9B 3W99B 4H9PA 3VH5A 1JFIA 3KXBA 1T3UA 3TU4D 1P3PC 4G92B 3H0LC 4QLCD 3WKJD 1AOIB 3AN2A 5B32G 5CPKA 2BYKB 3AZFB 3KFUG 2PYOB 1ZLAC 1M1AD 5AVBD 3KWQC 3W98D 2IO5B 5GT0C 3LZ0C 1KX4D 3MGQD 5B40D 5JRGD 3AZND 5B2JA 1EQZA 1ID3B 1BFMA 5AVCD 3UTAA 3AZHD 3REHC 3AZMC 3AZLA 3KXBD 3MNNA 3WA9C 2NQBA 4J8VD 5B1MA 3AYWC 1HQ3D 1P34D 3EPLA 1P3ID 5FUGA 3AN2D 3V9RB 3AZJC 3MGRB 1P3FD 3RELC 1P3PD 4Z66A 5JA4A 4H9PB 3VH6W 1U35A 1JFIB 5G49A 4YS3D 3KUYC 1EQZD 4XZQC 3C1CA 2YFWA 4Z5TC 3KWQD 3W96D 2UWXA 5CPKB 3MNND 3AZED 3MVDA 2NQBD 3X1SB 3W97A 1N1JB 5BNXB 1M19B 4WV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO A;  5DNM B;  5AY8 B;  4CAY A;  4X23 B;  2CV5 B;  4Z2M G;  3X1V A;  4WU9 C;  2HIO C;  2BYM B;  4JJN C;  4R8P A;  1S32 C;  5B2J B;  4KGC D;  3AZI C;  3WA9 D;  5AV6 A;  4Z66 D;  5B2I C;  1F66 C;  4NE6 A;  2F8N D;  1P3B C;  2NZD C;  2L5A A;  2HUE C;  3B6G C;  3REI A;  3AZJ D;  1TAF B;  1P3A B;  5B1M B;  5AV9 A;  1M18 A;  3C1C D;  5E5A A;  4HGA C;  5FUG B;  3A6N B;  3AV1 C;  3MGP A;  4G91 B;  1P3M A;  5F99 B;  5AV8 B;  5B31 B;  5GXQ D;  5JA4 B;  4DRB A;  4XZQ D;  1U35 B;  5G49 B;  5B32 A;  1BH8 A;  5AV6 D;  1BH9 A;  4EO5 B;  5GSU A;  5B0Z D;  5BS7 A;  1P3L B;  1KX3 B;  5AV5 D;  1HTA A;  5CPI C;  4KUD A;  5B1L D;  3MVD B;  4YM6 D;  3REI D;  5CPJ C;  2HIO D;  5E5A D;  3AV2 B;  3VH6 T;  4CAY B;  5B2I D;  3REK C;  1F66 D;  1P3O C;  3X1V B;  3LJA C;  3MGS B;  2F8N G;  1P3M D;  3X1U C;  1P3B D;  1KX5 C;  4H9O A;  4LD9 C;  3W99 C;  5B33 C;  3REJ A;  4ZUX A;  4J8X A;  4J8U D;  4G92 C;  3B6F A;  5B32 D;  3AV1 D;  1AOI C;  4WU8 B;  3AZG A;  5AV9 B;  3KSY A;  5C3I B;  3TU4 A;  3AZF C;  1M18 B;  1P3K D;  2PYO C;  4KUD D;  3MGP B;  5CP6 A;  2IO5 C;  2RVQ C;  3UTB A;  3B0D B;  4WNN A;  1M1A A;  4CSR B;  3MGQ A;  1ID3 C;  5CPI D;  5B40 A;  5JRG A;  3AZN A;  3O62 A;  5GSU B;  5BT1 C;  5B24 B;  3REJ D;  5AVC A;  4J8X D;  2FJ7 B;  3B6F D;  3AZH A;  1B67 A;  3LJA D;  4XUJ A;  3AZG D;  3X1U D;  4J8V A;  3MGR C;  1P34 A;  1HQ3 A;  3WTP B;  4E45 A;  3LZ1 D;  1P3I A;  5B33 D;  5CP6 D;  1P3F A;  3UTB D;  4H9O B;  3C1B B;  3X1T C;  5B0Y B;  5DNN B;  1P3P A;  5GT3 B;  3UT9 D;  4ZUX B;  3AFA D;  2PYO D;  4J8W D;  4YS3 A;  3WAA D;  3O62 D;  2RVQ D;  5CPK C;  3TU4 B;  1TZY D;  4QLC B;  3WKJ B;  1ZLA A;  3W96 A;  3KWQ A;  5GT0 A;  3LZ0 A;  3X1S C;  4XUJ D;  3AZE A;  1M19 C;  4WNN B;  5DNM C;  5AY8 C;  4X23 C;  2CV5 C;  4H9Q A;  4H9S C;  5AVB B;  1M1A B;  3W98 B;  3LEL D;  5BT1 D;  5B2J C;  1KX4 B;  3AZK B;  3MGQ B;  4KHA B;  1P3G B;  5B40 B;  5JRG B;  1Q9C A;  3AZN B;  4KGC A;  3WA9 A;  1P3A C;  5B1M C;  2YFV A;  3AZH B;  3KXB B;  2F8N A;  2JSS A;  3A6N C;  3AZJ A;  4J8V B;  1HQ3 B;  1ZLA D;  3X1T D;  4G91 C;  5F99 C;  5AV8 C;  3REL A;  5GT0 D;  5B31 C;  3NQU A;  3LZ0 D;  3AN2 B;  3KUY A;  4H9N A;  4ZBJ B;  4XZQ A;  4Z5T A;  4EO5 C;  4YS3 B;  3REH D;  3AZM D;  1P3L C;  1KX3 C;  1M19 D;  5DNM D;  5BO0 A;  1EQZ B;  5B0Z A;  3MVD C;  3AYW D;  3UTA B;  3W96 B;  3VH6 A;  3B0C W;  5AV5 A;  3AZL B;  3MNN B;  3AZE B;  3AV2 C;  5B1L A;  4YM6 A;  2NQB B;  2HIO A;  4JJN A;  4H9Q B;  4DRA A;  3X1V C;  3MGS C;  1S32 A;  3AZI A;  3REL D;  3NQJ A;  5B2I A;  1F66 A;  3WTP E;  4AWL B;  1P3B A;  3KUY D;  4KGC B;  5BNV A;  4Z66 B;  4WU8 C;  1KU5 A;  2YFV B;  4Z5T D;  5KDM A;  5AV8 D;  5AV9 C;  5C3I C;  1M18 C;  4J8U A;  3AV1 A;  3MGP C;  3C1C B;  1B6W A;  2YFW B;  1P3K A;  3B0D C;  3NQU B;  2F8N H;  4WU9 D;  4JJN D;  1S32 D;  5GXQ B;  4E44 A;  3AZI D;  3W97 B;  2ARO B;  4NFT A;  5GSU C;  5BS7 C;  1WWI A;  4R8P B;  5B24 C;  5CPI A;  2NZD D;  3B6G D;  5BO0 B;  2FJ7 C;  5AV6 B;  5B0Z B;  5AV5 B;  1ULY A;  5B1L B;  3WTP C;  4YM6 B;  3REI B;  3LJA A;  3REK A;  2HIO B;  3X1U A;  1KX5 A;  5E5A B;  3W99 A;  3LZ1 A;  3C1B C;  5B31 G;  5B33 A;  5B0Y C;  5DNN C;  1P3M B;  5GT3 C;  1P3B B;  4ZUX C;  1AOI A;  3B0C T;  1F1E A;  2BYK A;  3AZF A;  3UT9 A;  3AFA A;  3TU4 C;  4J8U B;  2PYO A;  4QLC C;  5B32 B;  3WKJ C;  4J8W A;  1BH8 B;  3WAA A;  5CPJ D;  1BH9 B;  1TZY A;  1P3K B;  3VH5 W;  3AV2 A;  4KUD B;  1M1A C;  5AVB C;  3REK D;  2LY8 A;  1P3O D;  3W98 C;  1KX4 C;  3AZK C;  3MGQ C;  1KX5 D;  1P3G C;  5B40 C;  4LD9 D;  3W99 D;  5JRG C;  3LEL A;  3AZN C;  4NE5 A;  4NE3 A;  1AOI D;  3KXB C;  3AZF D;  3REJ B;  4J8X B;  3MGR A;  4J8V C;  3B6F B;  1HQ3 C;  5B0Y D;  5DNN D;  3AZG B;  3AN2 C;  3X1T A;  3LZ1 B;  5B33 B;  5CP6 B;  3UTB B;  1ID3 D;  4ZBJ C;  4YS3 C;  3UT9 B;  3AFA B;  1EQZ C;  4J8W B;  3X1S A;  3UTA C;  3W96 C;  3REH A;  3AZM A;  3WAA B;  4UUZ A;  1N1J A;  5BNX A;  3O62 B;  1M19 A;  1TZY B;  5DNM A;  3AZK D;  5AY8 A;  4X23 A;  3MNN C;  3AZE C;  3AZL C;  2CV5 A;  4H9S A;  5AVC B;  3MGR D;  3AYW A;  1P3G D;  2NQB C;  2BYM A;  4XUJ B;  1P34 B;  1P3I B;  3LEL B;  4AWL C;  4KGC C;  1TAF A;  4Z2M H;  1P3A A;  4Z66 C;  1P3F B;  1U35 C;  3A6N A;  5CPK D;  1P3P B;  3VH5 T;  5F99 A;  5AV8 A;  3X1S D;  5B31 A;  1R4V A;  3C1C C;  5AY8 D;  4X23 D;  2CV5 D;  1ZLA B;  3X1T B;  3KWQ B;  5GT0 B;  3LZ0 B;  5B2J D;  5GXQ C;  3W97 C;  2ARO C;  4WU9 A;  3UTA D;  1P3L A;  1KX3 A;  4R8P C;  3AZL D;  5AV6 C;  5B0Z C;  1P3A D;  5B1M D;  3REH B;  3AZM B;  4UUZ B;  2NZD A;  5AV5 C;  3WA9 B;  3B6G A;  3A6N D;  5B1L C;  1H3O A;  4YM6 C;  3REI C;  3MGS A;  3AYW B;  5F99 D;  5B31 D;  5E5A C;  2F8N B;  3AZJ B;  1U35 D;  1P3M C;  3REL B;  3R45 A;  4WU8 A;  1P3L D;  3KUY B;  4H9N B;  1KX3 D;  4J8U C;  5B32 C;  1A7W A;  4XZQ B;  3MVD D;  4Z5T B;  4H9R A;  1P3K C;  3W97 D;  3AV2 D;  2ARO D;  3B0B A;  4KUD C;  4CSR A;  4WZS B;  5CPJ A;  3X1V D;  3MGS D;  2CWE A;  4R8P D;  1P3O A;  4WU9 B;  3W97 A;  4JJN B;  1S32 B;  5B24 A;  3AZI B;  2FJ7 A;  3NQJ B;  4LD9 A;  5B2I B;  1F66 B;  4WU8 D;  5AV9 D;  1M18 D;  3REJ C;  2NZD B;  1WWS A;  2HUE B;  4J8X C;  3WTP A;  3B6G B;  5BNV B;  3B6F C;  1H3O B;  2F8N K;  3MGP D;  3AZG C;  5KDM B;  4HGA B;  3C1B A;  3AV1 B;  3LZ1 C;  5B0Y A;  5DNN A;  5GT3 A;  5CP6 C;  3UTB C;  3R45 B;  5GSU D;  3UT9 C;  3AFA C;  4QLC A;  5B24 D;  1ID3 A;  3WKJ A;  2FJ7 D;  4J8W C;  3WAA C;  3O62 C;  4H9R B;  1TZY C;  5CPI B;  5AVC C;  5AVB A;  3WTP D;  3W98 A;  4M6B A;  5CPJ B;  3AZH C;  1KX4 A;  3AZK A;  4XUJ C;  3V9R A;  5CHL B;  4KHA A;  1P3G A;  3C1B D;  1P34 C;  3REK B;  1P3O B;  3LJA B;  1P3I C;  3LEL C;  5GT3 D;  3X1U B;  4ZUX D;  1KX5 B;  1P3F C;  4LD9 B;  3W99 B;  4H9P A;  3VH5 A;  1JFI A;  3KXB A;  3TU4 D;  1P3P C;  4G92 B;  4QLC D;  3WKJ D;  1AOI B;  3AN2 A;  5B32 G;  5CPK A;  2BYK B;  3AZF B;  2PYO B;  1ZLA C;  1M1A D;  5AVB D;  3KWQ C;  3W98 D;  2IO5 B;  5GT0 C;  3LZ0 C;  1KX4 D;  3MGQ D;  5B40 D;  5JRG D;  3AZN D;  5B2J A;  1EQZ A;  1ID3 B;  1BFM A;  5AVC D;  3UTA A;  3AZH D;  3REH C;  3AZM C;  3AZL A;  3KXB D;  3MNN A;  3WA9 C;  2NQB A;  4J8V D;  5B1M A;  3AYW C;  1HQ3 D;  1P34 D;  1P3I D;  5FUG A;  3AN2 D;  3V9R B;  3AZJ C;  3MGR B;  1P3F D;  3REL C;  1P3P D;  4Z66 A;  5JA4 A;  4H9P B;  3VH6 W;  1U35 A;  1JFI B;  5G49 A;  4YS3 D;  3KUY C;  1EQZ D;  4XZQ C;  3C1C A;  2YFW A;  4Z5T C;  3KWQ D;  3W96 D;  5CPK B;  3MNN D;  3AZE D;  3MVD A;  2NQB D;  3X1S B;  5GXQ A;  1N1J B;  5BNX B;  1M19 B;  4WV4 B; 
#chains in the Genus database with same CATH topology
 2ARO A;  5DNM B;  5AY8 B;  4CAY A;  4X23 B;  2CV5 B;  4Z2M G;  3X1V A;  4WU9 C;  2HIO C;  2BYM B;  4JJN C;  4R8P A;  1S32 C;  5B2J B;  4KGC D;  3AZI C;  3WA9 D;  5AV6 A;  4Z66 D;  5B2I C;  2DQN C;  1F66 C;  4NE6 A;  2F8N D;  1P3B C;  2NZD C;  2L5A A;  2HUE C;  3B6G C;  3REI A;  3AZJ D;  1TAF B;  1P3A B;  5B1M B;  5AV9 A;  1M18 A;  3C1C D;  5E5A A;  4HGA C;  5FUG B;  3A6N B;  2Y2L A;  3AV1 C;  3MGP A;  4G91 B;  1P3M A;  5F99 B;  5AV8 B;  5B31 B;  5GXQ D;  5JA4 B;  4DRB A;  4XZQ D;  1U35 B;  5G49 B;  5B32 A;  1BH8 A;  5AV6 D;  1BH9 A;  4EO5 B;  5GSU A;  5B0Z D;  5BS7 A;  1P3L B;  1KX3 B;  5AV5 D;  1HTA A;  5CPI C;  4KUD A;  5B1L D;  2Y2Q A;  4YM6 D;  3MVD B;  3REI D;  5CPJ C;  2HIO D;  5E5A D;  3AV2 B;  3VH6 T;  4CAY B;  5B2I D;  3REK C;  1F66 D;  1P3O C;  3X1V B;  3LJA C;  3MGS B;  2F8N G;  1P3M D;  3X1U C;  1P3B D;  1KX5 C;  4H9O A;  4LD9 C;  3W99 C;  5B33 C;  3REJ A;  4ZUX A;  4J8X A;  4J8U D;  4G92 C;  3P5J B;  5B32 D;  3B6F A;  3AV1 D;  1AOI C;  4WU8 B;  3AZG A;  2ZY2 A;  3KSY A;  5AV9 B;  5C3I B;  3TU4 A;  3IP4 C;  3AZF C;  1P3K D;  1M18 B;  2Y2K A;  2PYO C;  4KUD D;  3MGP B;  5CP6 A;  2IO5 C;  2RVQ C;  3UTB A;  3B0D B;  4WNN A;  3AL0 C;  1M1A A;  4CSR B;  3MGQ A;  1ID3 C;  5CPI D;  5B40 A;  5JRG A;  3AZN A;  3O62 A;  5GSU B;  5BT1 C;  5B24 B;  3REJ D;  5AVC A;  4J8X D;  2FJ7 B;  3B6F D;  3AZH A;  2Y2G A;  1B67 A;  3LJA D;  2Y2O A;  4XUJ A;  3AZG D;  3X1U D;  2J8P A;  4J8V A;  3MGR C;  1P34 A;  1HQ3 A;  3WTP B;  4E45 A;  3LZ1 D;  1P3I A;  5B33 D;  5CP6 D;  1P3F A;  3UTB D;  4H9O B;  3C1B B;  3X1T C;  5B0Y B;  5DNN B;  1P3P A;  5GT3 B;  3UT9 D;  4ZUX B;  3AFA D;  2PYO D;  4J8W D;  4YS3 A;  3WAA D;  3O62 D;  2RVQ D;  5CPK C;  3TU4 B;  1TZY D;  4QLC B;  3WKJ B;  1ZLA A;  3W96 A;  3KWQ A;  5GT0 A;  2F2A C;  3LZ0 A;  3X1S C;  4UPK A;  4XUJ D;  3AZE A;  1M19 C;  4WNN B;  5DNM C;  5AY8 C;  4X23 C;  2CV5 C;  4H9Q A;  4H9S C;  5AVB B;  1M1A B;  3W98 B;  3LEL D;  5BT1 D;  5B2J C;  1KX4 B;  3AZK B;  3MGQ B;  4KHA B;  1P3G B;  5B40 B;  2ZY4 A;  1Q9C A;  5JRG B;  3AZN B;  4KGC A;  3WA9 A;  1P3A C;  3EG5 B;  2YFV A;  5B1M C;  3AZH B;  3KXB B;  2F8N A;  2JSS A;  3A6N C;  3AZJ A;  4J8V B;  2Y2I A;  1HQ3 B;  1ZLA D;  3X1T D;  4G91 C;  5F99 C;  5AV8 C;  3REL A;  5GT0 D;  5B31 C;  3NQU A;  3LZ0 D;  3AN2 B;  2XD1 A;  3KUY A;  4H9N A;  4ZBJ B;  4XZQ A;  4Z5T A;  4EO5 C;  4YS3 B;  3REH D;  3AZM D;  1P3L C;  1KX3 C;  1M19 D;  5DNM D;  5BO0 A;  1EQZ B;  5B0Z A;  3MVD C;  3AYW D;  3UTA B;  3W96 B;  3VH6 A;  3B0C W;  2Y2P A;  5AV5 A;  3AZL B;  3MNN B;  3AZE B;  3AV2 C;  5B1L A;  4YM6 A;  2NQB B;  2HIO A;  4JJN A;  4H9Q B;  4DRA A;  3X1V C;  3MGS C;  1S32 A;  2W8S A;  3AZI A;  3REL D;  3NQJ A;  5B2I A;  1F66 A;  3WTP E;  4AWL B;  1P3B A;  3KUY D;  4KGC B;  3EPH A;  5BNV A;  4Z66 B;  4WU8 C;  1KU5 A;  2YFV B;  4Z5T D;  5KDM A;  5AV8 D;  5AV9 C;  5C3I C;  1M18 C;  4J8U A;  3AV1 A;  3MGP C;  3C1C B;  1B6W A;  2YFW B;  1P3K A;  3B0D C;  3NQU B;  2BG1 A;  2F8N H;  2FFF B;  4WU9 D;  4JJN D;  1S32 D;  5GXQ B;  4E44 A;  3AZI D;  3W97 B;  2ARO B;  4NFT A;  5GSU C;  2Y2M A;  5BS7 C;  1WWI A;  4R8P B;  5B24 C;  5CPI A;  2NZD D;  3B6G D;  5BO0 B;  2FJ7 C;  5AV6 B;  5B0Z B;  5AV5 B;  1ULY A;  5B1L B;  3WTP C;  4YM6 B;  3REI B;  3LJA A;  3EPK A;  3REK A;  2HIO B;  3X1U A;  1KX5 A;  2RIQ A;  5E5A B;  3W99 A;  3LZ1 A;  3C1B C;  5B31 G;  5B33 A;  5B0Y C;  5DNN C;  1P3M B;  5GT3 C;  1P3B B;  4ZUX C;  1AOI A;  3B0C T;  1F1E A;  2BYK A;  3AZF A;  3UT9 A;  3AFA A;  3TU4 C;  3A1K A;  4J8U B;  2PYO A;  4QLC C;  5B32 B;  3WKJ C;  4J8W A;  1BH8 B;  3WAA A;  5CPJ D;  1BH9 B;  1TZY A;  1P3K B;  3H0M C;  3VH5 W;  3AV2 A;  4KUD B;  1M1A C;  5AVB C;  3REK D;  2LY8 A;  1P3O D;  3W98 C;  1KX4 C;  3AZK C;  3MGQ C;  1KX5 D;  1P3G C;  5B40 C;  4LD9 D;  3W99 D;  5JRG C;  3LEL A;  3AZN C;  4NE5 A;  4NE3 A;  1AOI D;  3KXB C;  3AZF D;  3REJ B;  4J8X B;  3MGR A;  4J8V C;  3B6F B;  1HQ3 C;  5B0Y D;  5DNN D;  3AZG B;  3AN2 C;  2Y2N A;  3X1T A;  3LZ1 B;  5B33 B;  5CP6 B;  3UTB B;  1ID3 D;  4ZBJ C;  4YS3 C;  3UT9 B;  3AFA B;  1EQZ C;  4J8W B;  2DF4 C;  3X1S A;  2XD5 A;  3W96 C;  3REH A;  3UTA C;  3AZM A;  4UUZ A;  1N1J A;  5BNX A;  3O62 B;  1M19 A;  3WAA B;  1TZY B;  5DNM A;  3AZK D;  5AY8 A;  4X23 A;  3MNN C;  3AZE C;  3AZL C;  2CV5 A;  4H9S A;  5AVC B;  3MGR D;  3AYW A;  1P3G D;  2NQB C;  2BYM A;  4XUJ B;  1P34 B;  1P3I B;  3LEL B;  4AWL C;  4KGC C;  1PZR A;  1TAF A;  4Z2M H;  1P3A A;  4Z66 C;  2JCH A;  1P3F B;  1U35 C;  3A6N A;  5CPK D;  1P3P B;  3VH5 T;  5F99 A;  5AV8 A;  3X1S D;  5B31 A;  1R4V A;  3C1C C;  5AY8 D;  4X23 D;  2CV5 D;  1ZLA B;  3X1T B;  3KWQ B;  4WJ3 C;  5GT0 B;  3LZ0 B;  5B2J D;  5GXQ C;  3W97 C;  3H0R C;  2ARO C;  4WU9 A;  3UTA D;  1P3L A;  1KX3 A;  4R8P C;  3AZL D;  3EPJ A;  1Z2C B;  5AV6 C;  5B0Z C;  1P3A D;  5B1M D;  3REH B;  3AZM B;  4UUZ B;  2NZD A;  5AV5 C;  3WA9 B;  3B6G A;  3A6N D;  5B1L C;  1H3O A;  4YM6 C;  3REI C;  3MGS A;  3AYW B;  5F99 D;  3F6T A;  5B31 D;  5E5A C;  5GXQ A;  2F8N B;  3AZJ B;  1U35 D;  1P3M C;  3REL B;  3R45 A;  4WU8 A;  2ZM5 A;  1P3L D;  3KUY B;  4H9N B;  1KX3 D;  4J8U C;  2ZY3 A;  5B32 C;  1A7W A;  4XZQ B;  3MVD D;  4Z5T B;  4H9R A;  1P3K C;  3A1I A;  3W97 D;  3AV2 D;  2ARO D;  3B0B A;  4KUD C;  4CSR A;  4WZS B;  5CPJ A;  3X1V D;  3MGS D;  2CWE A;  4R8P D;  1P3O A;  4WU9 B;  4JJN B;  1S32 B;  5B24 A;  3AZI B;  2FJ7 A;  3NQJ B;  4LD9 A;  5B2I B;  1F66 B;  4WU8 D;  5AV9 D;  1M18 D;  3REJ C;  2NZD B;  1WWS A;  2HUE B;  4J8X C;  3WTP A;  3B6G B;  5BNV B;  3B6F C;  1H3O B;  2ZY5 A;  4DQY B;  2F8N K;  3MGP D;  3AZG C;  5KDM B;  2G5I C;  4HGA B;  3C1B A;  3AV1 B;  3LZ1 C;  5B0Y A;  2VQR A;  5DNN A;  5GT3 A;  2JE5 A;  5CP6 C;  3UTB C;  3R45 B;  2Y2H A;  5GSU D;  3UT9 C;  3AFA C;  4QLC A;  5B24 D;  1ID3 A;  3WKJ A;  2FJ7 D;  4J8W C;  3WAA C;  3O62 C;  1W2E A;  2G5H C;  4H9R B;  1TZY C;  5CPI B;  2Y2J A;  5AVC C;  5AVB A;  3WTP D;  3W98 A;  4M6B A;  5CPJ B;  3AZH C;  1KX4 A;  3AZK A;  4XUJ C;  3V9R A;  5CHL B;  4KHA A;  1P3G A;  3C1B D;  1P34 C;  3REK B;  1P3O B;  3LJA B;  1P3I C;  3LEL C;  5GT3 D;  3X1U B;  4ZUX D;  1KX5 B;  3FDD A;  1P3F C;  4LD9 B;  3W99 B;  4H9P A;  3VH5 A;  1JFI A;  3KXB A;  1T3U A;  3TU4 D;  1P3P C;  4G92 B;  3H0L C;  4QLC D;  3WKJ D;  1AOI B;  3AN2 A;  5B32 G;  5CPK A;  2BYK B;  3AZF B;  3KFU G;  2PYO B;  1ZLA C;  1M1A D;  5AVB D;  3KWQ C;  3W98 D;  2IO5 B;  5GT0 C;  3LZ0 C;  1KX4 D;  3MGQ D;  5B40 D;  5JRG D;  3AZN D;  5B2J A;  1EQZ A;  1ID3 B;  1BFM A;  5AVC D;  3UTA A;  3AZH D;  3REH C;  3AZM C;  3AZL A;  3KXB D;  3MNN A;  3WA9 C;  2NQB A;  4J8V D;  5B1M A;  3AYW C;  1HQ3 D;  1P34 D;  3EPL A;  1P3I D;  5FUG A;  3AN2 D;  3V9R B;  3AZJ C;  3MGR B;  1P3F D;  3REL C;  1P3P D;  4Z66 A;  5JA4 A;  4H9P B;  3VH6 W;  1U35 A;  1JFI B;  5G49 A;  4YS3 D;  3KUY C;  1EQZ D;  4XZQ C;  3C1C A;  2YFW A;  4Z5T C;  3KWQ D;  3W96 D;  2UWX A;  5CPK B;  3MNN D;  3AZE D;  3MVD A;  2NQB D;  3X1S B;  3W97 A;  1N1J B;  5BNX B;  1M19 B;  4WV4 B; 
#chains in the Genus database with same CATH homology
 2ARO A;  5DNM B;  5AY8 B;  4CAY A;  4X23 B;  2CV5 B;  4Z2M G;  3X1V A;  4WU9 C;  2HIO C;  2BYM B;  4JJN C;  4R8P A;  1S32 C;  5B2J B;  4KGC D;  3AZI C;  3WA9 D;  5AV6 A;  4Z66 D;  5B2I C;  2DQN C;  1F66 C;  4NE6 A;  2F8N D;  1P3B C;  2NZD C;  2L5A A;  2HUE C;  3B6G C;  3REI A;  3AZJ D;  1TAF B;  1P3A B;  5B1M B;  5AV9 A;  1M18 A;  3C1C D;  5E5A A;  4HGA C;  5FUG B;  3A6N B;  2Y2L A;  3AV1 C;  3MGP A;  4G91 B;  1P3M A;  5F99 B;  5AV8 B;  5B31 B;  5GXQ D;  5JA4 B;  4DRB A;  4XZQ D;  1U35 B;  5G49 B;  5B32 A;  1BH8 A;  5AV6 D;  1BH9 A;  4EO5 B;  5GSU A;  5B0Z D;  5BS7 A;  1P3L B;  1KX3 B;  5AV5 D;  1HTA A;  5CPI C;  4KUD A;  5B1L D;  2Y2Q A;  4YM6 D;  3MVD B;  3REI D;  5CPJ C;  2HIO D;  5E5A D;  3AV2 B;  3VH6 T;  4CAY B;  5B2I D;  3REK C;  1F66 D;  1P3O C;  3X1V B;  3LJA C;  3MGS B;  2F8N G;  1P3M D;  3X1U C;  1P3B D;  1KX5 C;  4H9O A;  4LD9 C;  3W99 C;  5B33 C;  3REJ A;  4ZUX A;  4J8X A;  4J8U D;  4G92 C;  3P5J B;  5B32 D;  3B6F A;  3AV1 D;  1AOI C;  4WU8 B;  3AZG A;  2ZY2 A;  3KSY A;  5AV9 B;  5C3I B;  3TU4 A;  3IP4 C;  3AZF C;  1P3K D;  1M18 B;  2Y2K A;  2PYO C;  4KUD D;  3MGP B;  5CP6 A;  2IO5 C;  2RVQ C;  3UTB A;  3B0D B;  4WNN A;  3AL0 C;  1M1A A;  4CSR B;  3MGQ A;  1ID3 C;  5CPI D;  5B40 A;  5JRG A;  3AZN A;  3O62 A;  5GSU B;  5BT1 C;  5B24 B;  3REJ D;  5AVC A;  4J8X D;  2FJ7 B;  3B6F D;  3AZH A;  2Y2G A;  1B67 A;  3LJA D;  2Y2O A;  4XUJ A;  3AZG D;  3X1U D;  2J8P A;  4J8V A;  3MGR C;  1P34 A;  1HQ3 A;  3WTP B;  4E45 A;  3LZ1 D;  1P3I A;  5B33 D;  5CP6 D;  1P3F A;  3UTB D;  4H9O B;  3C1B B;  3X1T C;  5B0Y B;  5DNN B;  1P3P A;  5GT3 B;  3UT9 D;  4ZUX B;  3AFA D;  2PYO D;  4J8W D;  4YS3 A;  3WAA D;  3O62 D;  2RVQ D;  5CPK C;  3TU4 B;  1TZY D;  4QLC B;  3WKJ B;  1ZLA A;  3W96 A;  3KWQ A;  5GT0 A;  2F2A C;  3LZ0 A;  3X1S C;  4UPK A;  4XUJ D;  3AZE A;  1M19 C;  4WNN B;  5DNM C;  5AY8 C;  4X23 C;  2CV5 C;  4H9Q A;  4H9S C;  5AVB B;  1M1A B;  3W98 B;  3LEL D;  5BT1 D;  5B2J C;  1KX4 B;  3AZK B;  3MGQ B;  4KHA B;  1P3G B;  5B40 B;  2ZY4 A;  1Q9C A;  5JRG B;  3AZN B;  4KGC A;  3WA9 A;  1P3A C;  3EG5 B;  2YFV A;  5B1M C;  3AZH B;  3KXB B;  2F8N A;  2JSS A;  3A6N C;  3AZJ A;  4J8V B;  2Y2I A;  1HQ3 B;  1ZLA D;  3X1T D;  4G91 C;  5F99 C;  5AV8 C;  3REL A;  5GT0 D;  5B31 C;  3NQU A;  3LZ0 D;  3AN2 B;  2XD1 A;  3KUY A;  4H9N A;  4ZBJ B;  4XZQ A;  4Z5T A;  4EO5 C;  4YS3 B;  3REH D;  3AZM D;  1P3L C;  1KX3 C;  1M19 D;  5DNM D;  5BO0 A;  1EQZ B;  5B0Z A;  3MVD C;  3AYW D;  3UTA B;  3W96 B;  3VH6 A;  3B0C W;  2Y2P A;  5AV5 A;  3AZL B;  3MNN B;  3AZE B;  3AV2 C;  5B1L A;  4YM6 A;  2NQB B;  2HIO A;  4JJN A;  4H9Q B;  4DRA A;  3X1V C;  3MGS C;  1S32 A;  2W8S A;  3AZI A;  3REL D;  3NQJ A;  5B2I A;  1F66 A;  3WTP E;  4AWL B;  1P3B A;  3KUY D;  4KGC B;  3EPH A;  5BNV A;  4Z66 B;  4WU8 C;  1KU5 A;  2YFV B;  4Z5T D;  5KDM A;  5AV8 D;  5AV9 C;  5C3I C;  1M18 C;  4J8U A;  3AV1 A;  3MGP C;  3C1C B;  1B6W A;  2YFW B;  1P3K A;  3B0D C;  3NQU B;  2BG1 A;  2F8N H;  2FFF B;  4WU9 D;  4JJN D;  1S32 D;  5GXQ B;  4E44 A;  3AZI D;  3W97 B;  2ARO B;  4NFT A;  5GSU C;  2Y2M A;  5BS7 C;  1WWI A;  4R8P B;  5B24 C;  5CPI A;  2NZD D;  3B6G D;  5BO0 B;  2FJ7 C;  5AV6 B;  5B0Z B;  5AV5 B;  1ULY A;  5B1L B;  3WTP C;  4YM6 B;  3REI B;  3LJA A;  3EPK A;  3REK A;  2HIO B;  3X1U A;  1KX5 A;  2RIQ A;  5E5A B;  3W99 A;  3LZ1 A;  3C1B C;  5B31 G;  5B33 A;  5B0Y C;  5DNN C;  1P3M B;  5GT3 C;  1P3B B;  4ZUX C;  1AOI A;  3B0C T;  1F1E A;  2BYK A;  3AZF A;  3UT9 A;  3AFA A;  3TU4 C;  3A1K A;  4J8U B;  2PYO A;  4QLC C;  5B32 B;  3WKJ C;  4J8W A;  1BH8 B;  3WAA A;  5CPJ D;  1BH9 B;  1TZY A;  1P3K B;  3H0M C;  3VH5 W;  3AV2 A;  4KUD B;  1M1A C;  5AVB C;  3REK D;  2LY8 A;  1P3O D;  3W98 C;  1KX4 C;  3AZK C;  3MGQ C;  1KX5 D;  1P3G C;  5B40 C;  4LD9 D;  3W99 D;  5JRG C;  3LEL A;  3AZN C;  4NE5 A;  4NE3 A;  1AOI D;  3KXB C;  3AZF D;  3REJ B;  4J8X B;  3MGR A;  4J8V C;  3B6F B;  1HQ3 C;  5B0Y D;  5DNN D;  3AZG B;  3AN2 C;  2Y2N A;  3X1T A;  3LZ1 B;  5B33 B;  5CP6 B;  3UTB B;  1ID3 D;  4ZBJ C;  4YS3 C;  3UT9 B;  3AFA B;  1EQZ C;  4J8W B;  2DF4 C;  3X1S A;  2XD5 A;  3W96 C;  3REH A;  3UTA C;  3AZM A;  4UUZ A;  1N1J A;  5BNX A;  3O62 B;  1M19 A;  3WAA B;  1TZY B;  5DNM A;  3AZK D;  5AY8 A;  4X23 A;  3MNN C;  3AZE C;  3AZL C;  2CV5 A;  4H9S A;  5AVC B;  3MGR D;  3AYW A;  1P3G D;  2NQB C;  2BYM A;  4XUJ B;  1P34 B;  1P3I B;  3LEL B;  4AWL C;  4KGC C;  1PZR A;  1TAF A;  4Z2M H;  1P3A A;  4Z66 C;  2JCH A;  1P3F B;  1U35 C;  3A6N A;  5CPK D;  1P3P B;  3VH5 T;  5F99 A;  5AV8 A;  3X1S D;  5B31 A;  1R4V A;  3C1C C;  5AY8 D;  4X23 D;  2CV5 D;  1ZLA B;  3X1T B;  3KWQ B;  4WJ3 C;  5GT0 B;  3LZ0 B;  5B2J D;  5GXQ C;  3W97 C;  3H0R C;  2ARO C;  4WU9 A;  3UTA D;  1P3L A;  1KX3 A;  4R8P C;  3AZL D;  3EPJ A;  1Z2C B;  5AV6 C;  5B0Z C;  1P3A D;  5B1M D;  3REH B;  3AZM B;  4UUZ B;  2NZD A;  5AV5 C;  3WA9 B;  3B6G A;  3A6N D;  5B1L C;  1H3O A;  4YM6 C;  3REI C;  3MGS A;  3AYW B;  5F99 D;  3F6T A;  5B31 D;  5E5A C;  5GXQ A;  2F8N B;  3AZJ B;  1U35 D;  1P3M C;  3REL B;  3R45 A;  4WU8 A;  2ZM5 A;  1P3L D;  3KUY B;  4H9N B;  1KX3 D;  4J8U C;  2ZY3 A;  5B32 C;  1A7W A;  4XZQ B;  3MVD D;  4Z5T B;  4H9R A;  1P3K C;  3A1I A;  3W97 D;  3AV2 D;  2ARO D;  3B0B A;  4KUD C;  4CSR A;  4WZS B;  5CPJ A;  3X1V D;  3MGS D;  2CWE A;  4R8P D;  1P3O A;  4WU9 B;  4JJN B;  1S32 B;  5B24 A;  3AZI B;  2FJ7 A;  3NQJ B;  4LD9 A;  5B2I B;  1F66 B;  4WU8 D;  5AV9 D;  1M18 D;  3REJ C;  2NZD B;  1WWS A;  2HUE B;  4J8X C;  3WTP A;  3B6G B;  5BNV B;  3B6F C;  1H3O B;  2ZY5 A;  4DQY B;  2F8N K;  3MGP D;  3AZG C;  5KDM B;  2G5I C;  4HGA B;  3C1B A;  3AV1 B;  3LZ1 C;  5B0Y A;  2VQR A;  5DNN A;  5GT3 A;  2JE5 A;  5CP6 C;  3UTB C;  3R45 B;  2Y2H A;  5GSU D;  3UT9 C;  3AFA C;  4QLC A;  5B24 D;  1ID3 A;  3WKJ A;  2FJ7 D;  4J8W C;  3WAA C;  3O62 C;  1W2E A;  2G5H C;  4H9R B;  1TZY C;  5CPI B;  2Y2J A;  5AVC C;  5AVB A;  3WTP D;  3W98 A;  4M6B A;  5CPJ B;  3AZH C;  1KX4 A;  3AZK A;  4XUJ C;  3V9R A;  5CHL B;  4KHA A;  1P3G A;  3C1B D;  1P34 C;  3REK B;  1P3O B;  3LJA B;  1P3I C;  3LEL C;  5GT3 D;  3X1U B;  4ZUX D;  1KX5 B;  3FDD A;  1P3F C;  4LD9 B;  3W99 B;  4H9P A;  3VH5 A;  1JFI A;  3KXB A;  1T3U A;  3TU4 D;  1P3P C;  4G92 B;  3H0L C;  4QLC D;  3WKJ D;  1AOI B;  3AN2 A;  5B32 G;  5CPK A;  2BYK B;  3AZF B;  3KFU G;  2PYO B;  1ZLA C;  1M1A D;  5AVB D;  3KWQ C;  3W98 D;  2IO5 B;  5GT0 C;  3LZ0 C;  1KX4 D;  3MGQ D;  5B40 D;  5JRG D;  3AZN D;  5B2J A;  1EQZ A;  1ID3 B;  1BFM A;  5AVC D;  3UTA A;  3AZH D;  3REH C;  3AZM C;  3AZL A;  3KXB D;  3MNN A;  3WA9 C;  2NQB A;  4J8V D;  5B1M A;  3AYW C;  1HQ3 D;  1P34 D;  3EPL A;  1P3I D;  5FUG A;  3AN2 D;  3V9R B;  3AZJ C;  3MGR B;  1P3F D;  3REL C;  1P3P D;  4Z66 A;  5JA4 A;  4H9P B;  3VH6 W;  1U35 A;  1JFI B;  5G49 A;  4YS3 D;  3KUY C;  1EQZ D;  4XZQ C;  3C1C A;  2YFW A;  4Z5T C;  3KWQ D;  3W96 D;  2UWX A;  5CPK B;  3MNN D;  3AZE D;  3MVD A;  2NQB D;  3X1S B;  3W97 A;  1N1J B;  5BNX B;  1M19 B;  4WV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...