1P3GA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gA00
3REIA 4NE6A 5E5AD 3WA9C 5JA4A 1P3FA 4QLCB 5KDMA 5B33A 3MNNB 2RVQD 3X1TC 2F8ND 4KUDD 4YS3C 3WAAA 3W96A 3AV1C 1KX5C 4YM6A 4J8WC 3REHA 4XUJD 3AZNC 1P3IA 4KUDB 3AFAD 1M19D 3RELA 5AV6B 1EQZA 4QLCA 3KUYC 3AZNA 2LY8A 3MGRC 1M18C 4H9NB 2NZDA 3MGSD 4J8WA 3B6GA 3AFAB 3W96B 3LZ1D 1TZYC 5BT1D 4UUZA 5JRGD 3LJAA 4J8XC 3AZKA 3O62B 5B31C 5B24D 5AV5B 3AZLD 3X1VD 3WA9A 3MVDA 5C3IB 3B0DC 3AV1B 1KX5B 5B24B 2AROA 1WWIA 1A7WA 3TU4C 5B2ID 3WKJD 5BNXB 1P3IC 4CSRA 4H9QB 4J8UB 3WA9B 2FJ7B 5B0YB 3X1UD 3W99D 1U35D 1M18A 5B33B 3WAAC 3KUYA 1P3PB 1ZLAA 5AV9D 4G92C 5AV8C 5B33C 1U35B 3W99B 4KUDA 3UTBA 4HGAC 4YM6C 3LZ0D 4E45A 3AZNB 3REHD 2CV5D 3AZIB 4WNNA 5DNNB 1ZLAD 3KUYB 1P3PA 3MGPB 3AYWD 5B0ZA 3B0BA 5GXQA 3LJAC 3AZKC 5DNNC 3AZJD 3LELB 3MGPC 3AV2B 1P3BB 3AN2B 5B32C 1P34C 1AOIC 3NQUA 5CPIC 3REIB 1KX3A 3O62A 3LZ0A 3X1TB 4J8XB 3MGRA 5GSUA 3MNNC 1Q9CA 4JJNA 3UT9A 1KX4C 3KWQD 5AVBD 5AV8B 5CP6A 5AVCC 1R4VA 2HIOD 5B40C 3NQUB 4X23D 3C1BC 1S32C 5BNXA 3X1TA 1M18B 4KHAA 1HQ3B 1P3FC 1ZLAB 4X23B 3B6GD 5AVCA 3AZJB 5B1LB 5CP6C 4ZUXB 5CPIB 4H9SA 3R45B 3V9RB 1M1AC 1P3MB 3REKC 4ZUXD 4WU8D 5DNMB 1KX3C 5GT0C 5CPJB 3MVDB 5B0YD 3X1UB 1B6WA 5GXQB 5AVCB 5B0ZB 4WU9D 3AZHA 5AV6D 3AV2A 1P3BA 3UTAD 1WWSA 5BO0B 2YFVB 4H9SC 3X1SB 1P3MA 3B0CW 5AV6C 3MGQB 2FJ7C 1P3LA 2F8NG 3W96D 5B2JA 5B0YC 1AOIB 3X1UA 1HQ3D 3AZID 5CP6B 4ZUXC 4LD9C 3UT9B 1EQZD 3AZLB 3UTAA 5CPKD 1M1AB 3REJB 1N1JA 4XUJB 4Z5TA 3REJC 5CP6D 1P3FD 5CPJD 3B0DB 2NQBD 1HQ3A 4Z66D 3C1CD 2PYOC 3NQJB 3W97A 1P3GC 2F8NK 3C1BD 2AROC 3LZ1B 3AZLA 2BYKB 1S32D 2YFWB 4G91B 5CPKA 5B1LA 4X23C 1P3AB 1H3OB 3MGQC 5B40D 3MGQD 5AY8A 4R8PA 3KWQC 2AROD 3KSYA 4CSRB 4J8VB 5CPJA 4J8XA 5DNMA 5B32G 2NQBA 5GT3B 1P3GD 4Z66C 3C1CC 2PYOD 2NQBC 5GT0B 5CPJC 5B1MB 4H9PA 3REJD 4WZSB 1HTAA 4KGCA 3WKJB 5DNND 5CPKC 2CWEA 5JRGA 3LJAD 5AV9A 3AZKD 1EQZC 4CAYB 1P3KA 1M19B 1P3FB 5AV5A 1ZLAC 4LD9D 5GT3A 3AZIC 3VH5A 1HQ3C 2CV5C 3REHC 5B1MA 1P3OA 3W96C 4YM6D 3AV1A 1KX5A 3REJA 3UTAB 1ID3B 3VH6T 1N1JB 4DRAA 3UTAC 1KX3B 5AV9C 4CAYA 4G92B 4WU9C 3RELB 3WAAD 3W99C 4H9QA 3X1UC 1BH9A 1U35C 3A6NA 5GT0D 3LZ1A 1KX3D 3REKD 4WU8C 1H3OA 3WKJC 3X1VB 2YFWA 5CPKB 1M1AD 1ID3A 1ULYA 3TU4D 2YFVA 5AY8B 1TZYA 3LJAB 3AZKB 4DRBA 4J8VA 3VH6A 3B6GC 4KHAB 5B2IB 4X23A 4H9PB 3KWQB 3AZLC 5B31D 2F8NA 1BFMA 5B24A 2HIOB 3R45A 3AZMB 2HIOC 5AVCD 2JSSA 5AVBC 1KX4D 5FUGB 4ZBJB 1M19A 1M18D 3MGRD 3AZGB 5CHLB 3MNND 1M19C 3AFAC 5F99B 1P3OB 3AZND 5CPID 2CV5B 4NE3A 1AOID 1P34D 5B32D 3MGSA 4J8WD 3B6FB 3MGPD 3AYWB 3AV1D 1KX5D 3AZJC 3AYWC 2RVQC 3X1TD 5C3IC 3WTPE 3AZEB 4WNNB 3LZ0C 3KXBA 4WU9B 5E5AC 3AZMC 3WTPB 3MGPA 4Z5TB 3W98B 5B33D 3REKA 5AV8D 3C1BB 1S32B 1P3IB 3W98C 3MGRB 5AVBA 5BS7C 1P3AC 2BYKA 5BS7A 1P3AA 2HIOA 1P3ID 3AFAA 5B2IC 1B67A 3W98A 4JJND 1P3MD 3C1BA 1S32A 4J8UD 4YS3B 3UTBD 5B40A 4XZQC 3X1VC 4ZBJC 3A6NB 2HUEC 5B24C 1P3KC 5F99A 4J8XD 1BH8A 5JRGC 3AZGC 3MNNA 3AYWA 1TZYD 5BT1C 3MGSB 5GXQD 5JRGB 5B0ZD 4G91C 3AZJA 2AROB 3LZ1C 5CPIA 3MGSC 4AWLC 3REHB 3KXBB 3KUYD 4WU9A 3W97D 3O62D 5DNMC 3AZEA 1P3PC 1BH8B 4XUJC 4J8WB 3WTPA 3KXBD 3REID 1U35A 3W99A 3MGQA 5B1MC 5B2JD 4YS3D 4KUDC 4WV4B 5BO0A 3B0CT 4H9RB 4H9OA 3VH6W 5B2JB 1F1EA 3WA9D 2FJ7D 3LELA 4XUJA 3WTPD 1TZYB 4KGCD 4J8VC 5B31B 5AV5C 4YS3A 3RELD 3WAAB 4QLCD 3AZEC 4E44A 3LZ0B 1ID3C 5GT3D 5GSUB 3NQJA 3W97B 3KWQA 5B1LD 5BNVB 4XZQB 3A6NC 3AZFC 1KU5A 2HUEB 1P3GB 3LELD 2FJ7A 3MVDC 5AY8D 4Z66A 5GSUD 4R8PD 3C1CA 3VH5W 5F99C 5B31A 4WU8B 3UT9D 5F99D 3AZHC 1P3LD 4R8PC 2PYOA 5AY8C 3AN2D 3MVDD 2BYMA 1P34B 4UUZB 3LELC 3UTBB 3AZFD 4R8PB 4AWLB 4EO5C 3A6ND 5B31G 5GT0A 4Z2MH 1P3OC 5B1LC 5BNVA 5G49B 2NZDC 2CV5A 5GT3C 3AZIA 1ID3D 3X1SD 4Z66B 3C1CB 4KGCB 1F66D 4QLCC 3AZED 3RELC 5AV5D 4ZUXA 5AV9B 4LD9A 1KX4B 4KGCC 3AN2A 3WTPC 4Z5TC 5B40B 4H9OB 5E5AB 1P3KB 5AV6A 1EQZB 4M6BA 5B32B 3B6FD 3TU4B 3AV2C 1P3BC 4NE5A 1F66A 3B6GB 2L5AA 4NFTA 5B2JC 3AZHB 5B1MD 3AZMA 1P3LB 3REIC 3KXBC 3AV2D 1TAFA 1P3BD 1BH9B 4Z2MG 3B6FC 3AZGA 1P3PD 5DNMD 3O62C 4HGAB 1P3GA 3W97C 3X1VA 4XZQA 4Z5TD 4YM6B 5GXQC 5B0ZC 2BYMB 1F66C 3V9RA 4H9RA 2PYOB 3X1SC 3AZGD 5B2IA 1P3KD 2NZDD 4J8UA 1P3OD 4EO5B 4XZQD 5G49A 3UTBC 2F8NH 5B0YA 3AN2C 2IO5C 4JJNB 4J8UC 2F8NB 3AZHD 1P3LC 4H9NA 1KX4A 3UT9C 5AV8A 3REKB 1P3MC 2NZDB 4LD9B 2IO5B 4JJNC 1JFIA 5FUGA 3X1SA 5GSUC 2NQBB 3AZFB 5AVBB 5E5AA 5JA4B 3VH5T 1P3AD 1AOIA 5B32A 5KDMB 5DNNA 3W98D 3TU4A 1F66B 3WKJA 1M1AA 4WU8A 1JFIB 4J8VD 3B6FA 1P34A 1TAFB 3AZFA 3AZMD
chains in the Genus database with same CATH superfamily
3REIA 4NE6A 5E5AD 3WA9C 5JA4A 1P3FA 4QLCB 5KDMA 5B33A 3MNNB 2RVQD 3X1TC 2F8ND 4KUDD 2Y2PA 4YS3C 3WAAA 3W96A 3AV1C 1KX5C 4YM6A 4J8WC 3REHA 4XUJD 3EPHA 3AZNC 1P3IA 4KUDB 3AFAD 1M19D 3EG5B 5AV6B 3H0LC 3RELA 4QLCA 1EQZA 2JE5A 3KUYC 3AZNA 2LY8A 3MGRC 1M18C 4H9NB 2NZDA 3MGSD 4J8WA 3B6GA 3AFAB 3W96B 3LZ1D 2BG1A 1TZYC 5BT1D 4UUZA 3KFUG 5JRGD 3LJAA 4J8XC 3AZKA 3O62B 5B31C 5B24D 5AV5B 3AZLD 3X1VD 3WA9A 3MVDA 5C3IB 3B0DC 2Y2QA 3AV1B 1KX5B 5B24B 2AROA 1WWIA 3IP4C 1A7WA 3TU4C 5B2ID 3WKJD 5BNXB 1P3IC 4CSRA 4H9QB 4J8UB 3WA9B 2J8PA 2FJ7B 5B0YB 3X1UD 3W99D 1U35D 1M18A 5B33B 3WAAC 3KUYA 1P3PB 1ZLAA 5AV9D 4G92C 5AV8C 5B33C 1U35B 3W99B 2JCHA 4KUDA 3UTBA 2XD1A 4HGAC 4YM6C 3LZ0D 4E45A 3AZNB 3REHD 2CV5D 3AZIB 4WNNA 5DNNB 1ZLAD 3KUYB 1P3PA 3MGPB 3AYWD 5B0ZA 3B0BA 5GXQA 3LJAC 3AZKC 5DNNC 3AZJD 3LELB 3MGPC 3AV2B 1P3BB 3AN2B 5B32C 1P34C 1AOIC 3NQUA 5CPIC 3REIB 1KX3A 3O62A 3LZ0A 3X1TB 4J8XB 3MGRA 5GSUA 3MNNC 1Q9CA 4JJNA 3UT9A 1KX4C 3KWQD 5AVBD 5AV8B 5CP6A 5AVCC 2Y2JA 1R4VA 2HIOD 5B40C 3NQUB 4X23D 3F6TA 3C1BC 1S32C 5BNXA 3X1TA 1M18B 4KHAA 1HQ3B 1P3FC 1ZLAB 4X23B 3B6GD 5AVCA 3AZJB 5B1LB 5CP6C 4ZUXB 5CPIB 2G5IC 4H9SA 3R45B 3V9RB 1M1AC 1P3MB 3REKC 4ZUXD 4WU8D 5DNMB 1KX3C 5GT0C 5CPJB 3MVDB 5B0YD 3X1UB 1B6WA 3P5JB 5GXQB 5AVCB 5B0ZB 4WU9D 3AZHA 5AV6D 3AV2A 1P3BA 2Y2IA 3UTAD 1WWSA 5BO0B 2YFVB 4H9SC 3X1SB 1P3MA 3B0CW 5AV6C 3MGQB 2FJ7C 1P3LA 2F8NG 3W96D 5B2JA 5B0YC 4WJ3C 1AOIB 3X1UA 1HQ3D 3AZID 5CP6B 4ZUXC 4LD9C 3UT9B 1EQZD 3AZLB 3UTAA 5CPKD 1M1AB 3REJB 1N1JA 2Y2HA 4XUJB 4Z5TA 3REJC 5CP6D 1P3FD 5CPJD 3B0DB 2G5HC 1HQ3A 4Z66D 3C1CD 2NQBD 2PYOC 3NQJB 3W97A 1P3GC 2F8NK 3C1BD 2AROC 3LZ1B 3AZLA 2BYKB 1S32D 2YFWB 4G91B 5CPKA 5B1LA 4X23C 1P3AB 1H3OB 3MGQC 5B40D 3MGQD 5AY8A 4R8PA 2UWXA 3KWQC 2AROD 3KSYA 4CSRB 4J8VB 5CPJA 4J8XA 5DNMA 5B32G 2NQBA 5GT3B 1P3GD 4Z66C 3C1CC 2PYOD 2NQBC 5GT0B 5CPJC 5B1MB 4H9PA 3REJD 2ZY3A 4WZSB 1HTAA 4KGCA 3WKJB 5DNND 5CPKC 2CWEA 5JRGA 3LJAD 5AV9A 3AZKD 1EQZC 4CAYB 1P3KA 1M19B 1P3FB 5AV5A 1ZLAC 2Y2MA 4LD9D 5GT3A 3AZIC 3VH5A 1HQ3C 3A1IA 3H0RC 2CV5C 3REHC 2Y2GA 3FDDA 5B1MA 2W8SA 1P3OA 3W96C 4YM6D 3AV1A 1KX5A 3REJA 3UTAB 1ID3B 3VH6T 1N1JB 4DRAA 3UTAC 1KX3B 5AV9C 4CAYA 4G92B 4WU9C 3RELB 3WAAD 3W99C 4H9QA 3X1UC 1BH9A 1U35C 3A6NA 5GT0D 3LZ1A 1KX3D 3REKD 4WU8C 1H3OA 3WKJC 3X1VB 2YFWA 5CPKB 1M1AD 1ID3A 1ULYA 1T3UA 3TU4D 2YFVA 5AY8B 1TZYA 3LJAB 3AZKB 4DRBA 4J8VA 3VH6A 3B6GC 2ZY5A 4KHAB 1W2EA 2ZM5A 5B2IB 3EPJA 4X23A 4H9PB 3KWQB 3AZLC 5B31D 2F8NA 1BFMA 5B24A 2HIOB 3R45A 3AZMB 2HIOC 5AVCD 2JSSA 5AVBC 1KX4D 5FUGB 4ZBJB 1M19A 1M18D 3MGRD 3AZGB 5CHLB 3MNND 1M19C 3AFAC 5F99B 1P3OB 3AZND 5CPID 2CV5B 4NE3A 1AOID 1P34D 5B32D 3MGSA 4J8WD 3B6FB 3MGPD 3EPKA 3AYWB 3AV1D 1KX5D 3AZJC 3AYWC 2RVQC 3X1TD 5C3IC 3WTPE 3AZEB 3AL0C 4WNNB 3LZ0C 3KXBA 4WU9B 5E5AC 3AZMC 2ZY2A 3WTPB 3MGPA 4Z5TB 3W98B 5B33D 3REKA 5AV8D 3C1BB 1S32B 1P3IB 3W98C 2Y2NA 3MGRB 5AVBA 5BS7C 1P3AC 2BYKA 5BS7A 1P3AA 2HIOA 1P3ID 3AFAA 5B2IC 1B67A 3W98A 4JJND 1P3MD 3C1BA 1S32A 4J8UD 4YS3B 3UTBD 5B40A 4XZQC 3X1VC 4ZBJC 3A6NB 2HUEC 5B24C 1P3KC 2DQNC 5F99A 4J8XD 1BH8A 5JRGC 3AZGC 3MNNA 3AYWA 1TZYD 5BT1C 3MGSB 5GXQD 5JRGB 5B0ZD 4G91C 3AZJA 2AROB 3LZ1C 5CPIA 3MGSC 4AWLC 3REHB 3KXBB 3KUYD 4WU9A 3W97D 3O62D 5DNMC 3AZEA 3EPLA 1P3PC 1BH8B 4XUJC 4J8WB 3WTPA 3KXBD 3REID 1U35A 3W99A 3MGQA 5B1MC 5B2JD 4YS3D 4KUDC 4WV4B 5BO0A 3B0CT 2DF4C 4H9RB 2Y2KA 4H9OA 3VH6W 5B2JB 1F1EA 3WA9D 2ZY4A 2FJ7D 3LELA 4XUJA 3WTPD 1TZYB 4KGCD 4J8VC 5B31B 5AV5C 4YS3A 3RELD 2XD5A 3WAAB 4QLCD 3AZEC 4E44A 3LZ0B 1ID3C 5GT3D 5GSUB 3NQJA 3W97B 3KWQA 5B1LD 5BNVB 4XZQB 3A6NC 3AZFC 1KU5A 2HUEB 1P3GB 3LELD 2FJ7A 3MVDC 5AY8D 4Z66A 5GSUD 4R8PD 3C1CA 3VH5W 5F99C 5B31A 2Y2LA 4WU8B 2VQRA 5F99D 3UT9D 2RIQA 3AZHC 1P3LD 4R8PC 2Y2OA 2PYOA 5AY8C 3AN2D 3MVDD 2BYMA 1P34B 4UUZB 3LELC 3UTBB 3AZFD 4R8PB 4AWLB 4EO5C 3A6ND 5B31G 1Z2CB 4Z2MH 5GT0A 1P3OC 5B1LC 5BNVA 5G49B 2NZDC 2CV5A 5GT3C 3AZIA 1ID3D 3X1SD 4Z66B 3C1CB 4KGCB 1F66D 4QLCC 3AZED 3RELC 5AV5D 4ZUXA 5AV9B 4LD9A 1KX4B 4KGCC 3AN2A 3WTPC 4Z5TC 5B40B 4H9OB 3H0MC 5E5AB 1P3KB 2F2AC 5AV6A 1EQZB 4M6BA 5B32B 3B6FD 3TU4B 3AV2C 1P3BC 4NE5A 1F66A 3B6GB 2L5AA 4NFTA 5B2JC 3AZHB 5B1MD 3AZMA 1P3LB 3REIC 3KXBC 3AV2D 1TAFA 1P3BD 1BH9B 4Z2MG 3B6FC 3AZGA 1P3PD 1PZRA 5DNMD 3O62C 4HGAB 1P3GA 3W97C 3X1VA 4XZQA 4Z5TD 4YM6B 5GXQC 5B0ZC 2BYMB 1F66C 3V9RA 4H9RA 3A1KA 2PYOB 3X1SC 3AZGD 5B2IA 1P3KD 2FFFB 2NZDD 4J8UA 1P3OD 4EO5B 4XZQD 5G49A 4DQYB 3UTBC 2F8NH 5B0YA 3AN2C 2IO5C 4JJNB 4J8UC 2F8NB 3AZHD 1P3LC 4H9NA 1KX4A 3UT9C 5AV8A 3REKB 1P3MC 2NZDB 4LD9B 2IO5B 4JJNC 1JFIA 4UPKA 5FUGA 3X1SA 5GSUC 2NQBB 3AZFB 5AVBB 5E5AA 5JA4B 3VH5T 1P3AD 1AOIA 5B32A 5KDMB 5DNNA 3W98D 3TU4A 1F66B 3WKJA 1M1AA 4WU8A 1JFIB 4J8VD 3B6FA 1P34A 1TAFB 3AZFA 3AZMD
chains in the Genus database with same CATH topology
3REIA 4NE6A 5E5AD 3WA9C 5JA4A 1P3FA 4QLCB 5KDMA 5B33A 3MNNB 2RVQD 3X1TC 2F8ND 4KUDD 2Y2PA 4YS3C 3WAAA 3W96A 3AV1C 1KX5C 4YM6A 4J8WC 3REHA 4XUJD 3EPHA 3AZNC 1P3IA 4KUDB 3AFAD 1M19D 3EG5B 5AV6B 3H0LC 3RELA 4QLCA 1EQZA 2JE5A 3KUYC 3AZNA 2LY8A 3MGRC 1M18C 4H9NB 2NZDA 3MGSD 4J8WA 3B6GA 3AFAB 3W96B 3LZ1D 2BG1A 1TZYC 5BT1D 4UUZA 3KFUG 5JRGD 3LJAA 4J8XC 3AZKA 3O62B 5B31C 5B24D 5AV5B 3AZLD 3X1VD 3WA9A 3MVDA 5C3IB 3B0DC 2Y2QA 3AV1B 1KX5B 5B24B 2AROA 1WWIA 3IP4C 1A7WA 3TU4C 5B2ID 3WKJD 5BNXB 1P3IC 4CSRA 4H9QB 4J8UB 3WA9B 2J8PA 2FJ7B 5B0YB 3X1UD 3W99D 1U35D 1M18A 5B33B 3WAAC 3KUYA 1P3PB 1ZLAA 5AV9D 4G92C 5AV8C 5B33C 1U35B 3W99B 2JCHA 4KUDA 3UTBA 2XD1A 4HGAC 4YM6C 3LZ0D 4E45A 3AZNB 3REHD 2CV5D 3AZIB 4WNNA 5DNNB 1ZLAD 3KUYB 1P3PA 3MGPB 3AYWD 5B0ZA 3B0BA 5GXQA 3LJAC 3AZKC 5DNNC 3AZJD 3LELB 3MGPC 3AV2B 1P3BB 3AN2B 5B32C 1P34C 1AOIC 3NQUA 5CPIC 3REIB 1KX3A 3O62A 3LZ0A 3X1TB 4J8XB 3MGRA 5GSUA 3MNNC 1Q9CA 4JJNA 3UT9A 1KX4C 3KWQD 5AVBD 5AV8B 5CP6A 5AVCC 2Y2JA 1R4VA 2HIOD 5B40C 3NQUB 4X23D 3F6TA 3C1BC 1S32C 5BNXA 3X1TA 1M18B 4KHAA 1HQ3B 1P3FC 1ZLAB 4X23B 3B6GD 5AVCA 3AZJB 5B1LB 5CP6C 4ZUXB 5CPIB 2G5IC 4H9SA 3R45B 3V9RB 1M1AC 1P3MB 3REKC 4ZUXD 4WU8D 5DNMB 1KX3C 5GT0C 5CPJB 3MVDB 5B0YD 3X1UB 1B6WA 3P5JB 5GXQB 5AVCB 5B0ZB 4WU9D 3AZHA 5AV6D 3AV2A 1P3BA 2Y2IA 3UTAD 1WWSA 5BO0B 2YFVB 4H9SC 3X1SB 1P3MA 3B0CW 5AV6C 3MGQB 2FJ7C 1P3LA 2F8NG 3W96D 5B2JA 5B0YC 4WJ3C 1AOIB 3X1UA 1HQ3D 3AZID 5CP6B 4ZUXC 4LD9C 3UT9B 1EQZD 3AZLB 3UTAA 5CPKD 1M1AB 3REJB 1N1JA 2Y2HA 4XUJB 4Z5TA 3REJC 5CP6D 1P3FD 5CPJD 3B0DB 2G5HC 1HQ3A 4Z66D 3C1CD 2NQBD 2PYOC 3NQJB 3W97A 1P3GC 2F8NK 3C1BD 2AROC 3LZ1B 3AZLA 2BYKB 1S32D 2YFWB 4G91B 5CPKA 5B1LA 4X23C 1P3AB 1H3OB 3MGQC 5B40D 3MGQD 5AY8A 4R8PA 2UWXA 3KWQC 2AROD 3KSYA 4CSRB 4J8VB 5CPJA 4J8XA 5DNMA 5B32G 2NQBA 5GT3B 1P3GD 4Z66C 3C1CC 2PYOD 2NQBC 5GT0B 5CPJC 5B1MB 4H9PA 3REJD 2ZY3A 4WZSB 1HTAA 4KGCA 3WKJB 5DNND 5CPKC 2CWEA 5JRGA 3LJAD 5AV9A 3AZKD 1EQZC 4CAYB 1P3KA 1M19B 1P3FB 5AV5A 1ZLAC 2Y2MA 4LD9D 5GT3A 3AZIC 3VH5A 1HQ3C 3A1IA 3H0RC 2CV5C 3REHC 2Y2GA 3FDDA 5B1MA 2W8SA 1P3OA 3W96C 4YM6D 3AV1A 1KX5A 3REJA 3UTAB 1ID3B 3VH6T 1N1JB 4DRAA 3UTAC 1KX3B 5AV9C 4CAYA 4G92B 4WU9C 3RELB 3WAAD 3W99C 4H9QA 3X1UC 1BH9A 1U35C 3A6NA 5GT0D 3LZ1A 1KX3D 3REKD 4WU8C 1H3OA 3WKJC 3X1VB 2YFWA 5CPKB 1M1AD 1ID3A 1ULYA 1T3UA 3TU4D 2YFVA 5AY8B 1TZYA 3LJAB 3AZKB 4DRBA 4J8VA 3VH6A 3B6GC 2ZY5A 4KHAB 1W2EA 2ZM5A 5B2IB 3EPJA 4X23A 4H9PB 3KWQB 3AZLC 5B31D 2F8NA 1BFMA 5B24A 2HIOB 3R45A 3AZMB 2HIOC 5AVCD 2JSSA 5AVBC 1KX4D 5FUGB 4ZBJB 1M19A 1M18D 3MGRD 3AZGB 5CHLB 3MNND 1M19C 3AFAC 5F99B 1P3OB 3AZND 5CPID 2CV5B 4NE3A 1AOID 1P34D 5B32D 3MGSA 4J8WD 3B6FB 3MGPD 3EPKA 3AYWB 3AV1D 1KX5D 3AZJC 3AYWC 2RVQC 3X1TD 5C3IC 3WTPE 3AZEB 3AL0C 4WNNB 3LZ0C 3KXBA 4WU9B 5E5AC 3AZMC 2ZY2A 3WTPB 3MGPA 4Z5TB 3W98B 5B33D 3REKA 5AV8D 3C1BB 1S32B 1P3IB 3W98C 2Y2NA 3MGRB 5AVBA 5BS7C 1P3AC 2BYKA 5BS7A 1P3AA 2HIOA 1P3ID 3AFAA 5B2IC 1B67A 3W98A 4JJND 1P3MD 3C1BA 1S32A 4J8UD 4YS3B 3UTBD 5B40A 4XZQC 3X1VC 4ZBJC 3A6NB 2HUEC 5B24C 1P3KC 2DQNC 5F99A 4J8XD 1BH8A 5JRGC 3AZGC 3MNNA 3AYWA 1TZYD 5BT1C 3MGSB 5GXQD 5JRGB 5B0ZD 4G91C 3AZJA 2AROB 3LZ1C 5CPIA 3MGSC 4AWLC 3REHB 3KXBB 3KUYD 4WU9A 3W97D 3O62D 5DNMC 3AZEA 3EPLA 1P3PC 1BH8B 4XUJC 4J8WB 3WTPA 3KXBD 3REID 1U35A 3W99A 3MGQA 5B1MC 5B2JD 4YS3D 4KUDC 4WV4B 5BO0A 3B0CT 2DF4C 4H9RB 2Y2KA 4H9OA 3VH6W 5B2JB 1F1EA 3WA9D 2ZY4A 2FJ7D 3LELA 4XUJA 3WTPD 1TZYB 4KGCD 4J8VC 5B31B 5AV5C 4YS3A 3RELD 2XD5A 3WAAB 4QLCD 3AZEC 4E44A 3LZ0B 1ID3C 5GT3D 5GSUB 3NQJA 3W97B 3KWQA 5B1LD 5BNVB 4XZQB 3A6NC 3AZFC 1KU5A 2HUEB 1P3GB 3LELD 2FJ7A 3MVDC 5AY8D 4Z66A 5GSUD 4R8PD 3C1CA 3VH5W 5F99C 5B31A 2Y2LA 4WU8B 2VQRA 5F99D 3UT9D 2RIQA 3AZHC 1P3LD 4R8PC 2Y2OA 2PYOA 5AY8C 3AN2D 3MVDD 2BYMA 1P34B 4UUZB 3LELC 3UTBB 3AZFD 4R8PB 4AWLB 4EO5C 3A6ND 5B31G 1Z2CB 4Z2MH 5GT0A 1P3OC 5B1LC 5BNVA 5G49B 2NZDC 2CV5A 5GT3C 3AZIA 1ID3D 3X1SD 4Z66B 3C1CB 4KGCB 1F66D 4QLCC 3AZED 3RELC 5AV5D 4ZUXA 5AV9B 4LD9A 1KX4B 4KGCC 3AN2A 3WTPC 4Z5TC 5B40B 4H9OB 3H0MC 5E5AB 1P3KB 2F2AC 5AV6A 1EQZB 4M6BA 5B32B 3B6FD 3TU4B 3AV2C 1P3BC 4NE5A 1F66A 3B6GB 2L5AA 4NFTA 5B2JC 3AZHB 5B1MD 3AZMA 1P3LB 3REIC 3KXBC 3AV2D 1TAFA 1P3BD 1BH9B 4Z2MG 3B6FC 3AZGA 1P3PD 1PZRA 5DNMD 3O62C 4HGAB 1P3GA 3W97C 3X1VA 4XZQA 4Z5TD 4YM6B 5GXQC 5B0ZC 2BYMB 1F66C 3V9RA 4H9RA 3A1KA 2PYOB 3X1SC 3AZGD 5B2IA 1P3KD 2FFFB 2NZDD 4J8UA 1P3OD 4EO5B 4XZQD 5G49A 4DQYB 3UTBC 2F8NH 5B0YA 3AN2C 2IO5C 4JJNB 4J8UC 2F8NB 3AZHD 1P3LC 4H9NA 1KX4A 3UT9C 5AV8A 3REKB 1P3MC 2NZDB 4LD9B 2IO5B 4JJNC 1JFIA 4UPKA 5FUGA 3X1SA 5GSUC 2NQBB 3AZFB 5AVBB 5E5AA 5JA4B 3VH5T 1P3AD 1AOIA 5B32A 5KDMB 5DNNA 3W98D 3TU4A 1F66B 3WKJA 1M1AA 4WU8A 1JFIB 4J8VD 3B6FA 1P34A 1TAFB 3AZFA 3AZMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI A;  4NE6 A;  5E5A D;  3WA9 C;  5JA4 A;  1P3F A;  4QLC B;  5KDM A;  5B33 A;  3MNN B;  2RVQ D;  3X1T C;  2F8N D;  4KUD D;  4YS3 C;  3WAA A;  3W96 A;  3AV1 C;  1KX5 C;  4YM6 A;  4J8W C;  3REH A;  4XUJ D;  3AZN C;  1P3I A;  4KUD B;  3AFA D;  1M19 D;  3REL A;  5AV6 B;  1EQZ A;  4QLC A;  3KUY C;  3AZN A;  2LY8 A;  3MGR C;  1M18 C;  4H9N B;  2NZD A;  3MGS D;  4J8W A;  3B6G A;  3AFA B;  3W96 B;  3LZ1 D;  1TZY C;  5BT1 D;  4UUZ A;  5JRG D;  3LJA A;  4J8X C;  3AZK A;  3O62 B;  5B31 C;  5B24 D;  5AV5 B;  3AZL D;  3X1V D;  3WA9 A;  3MVD A;  5C3I B;  3B0D C;  3AV1 B;  1KX5 B;  5B24 B;  2ARO A;  1WWI A;  1A7W A;  3TU4 C;  5B2I D;  3WKJ D;  5BNX B;  1P3I C;  4CSR A;  4H9Q B;  4J8U B;  3WA9 B;  2FJ7 B;  5B0Y B;  3X1U D;  3W99 D;  1U35 D;  1M18 A;  5B33 B;  3WAA C;  3KUY A;  1P3P B;  1ZLA A;  5AV9 D;  4G92 C;  5AV8 C;  5B33 C;  1U35 B;  3W99 B;  4KUD A;  3UTB A;  4HGA C;  4YM6 C;  3LZ0 D;  4E45 A;  3AZN B;  3REH D;  2CV5 D;  3AZI B;  4WNN A;  5DNN B;  1ZLA D;  3KUY B;  1P3P A;  3MGP B;  3AYW D;  5B0Z A;  3B0B A;  5GXQ A;  3LJA C;  3AZK C;  5DNN C;  3AZJ D;  3LEL B;  3MGP C;  3AV2 B;  1P3B B;  3AN2 B;  5B32 C;  1P34 C;  1AOI C;  3NQU A;  5CPI C;  3REI B;  1KX3 A;  3O62 A;  3LZ0 A;  3X1T B;  4J8X B;  3MGR A;  5GSU A;  3MNN C;  1Q9C A;  4JJN A;  3UT9 A;  1KX4 C;  3KWQ D;  5AVB D;  5AV8 B;  5CP6 A;  5AVC C;  1R4V A;  2HIO D;  5B40 C;  3NQU B;  4X23 D;  3C1B C;  1S32 C;  5BNX A;  3X1T A;  1M18 B;  4KHA A;  1HQ3 B;  1P3F C;  1ZLA B;  4X23 B;  3B6G D;  5AVC A;  3AZJ B;  5B1L B;  5CP6 C;  4ZUX B;  5CPI B;  4H9S A;  3R45 B;  3V9R B;  1M1A C;  1P3M B;  3REK C;  4ZUX D;  4WU8 D;  5DNM B;  1KX3 C;  5GT0 C;  5CPJ B;  3MVD B;  5B0Y D;  3X1U B;  1B6W A;  5GXQ B;  5AVC B;  5B0Z B;  4WU9 D;  3AZH A;  5AV6 D;  3AV2 A;  1P3B A;  3UTA D;  1WWS A;  5BO0 B;  2YFV B;  4H9S C;  3X1S B;  1P3M A;  3B0C W;  5AV6 C;  3MGQ B;  2FJ7 C;  1P3L A;  2F8N G;  3W96 D;  5B2J A;  5B0Y C;  1AOI B;  3X1U A;  1HQ3 D;  3AZI D;  5CP6 B;  4ZUX C;  4LD9 C;  3UT9 B;  1EQZ D;  3AZL B;  3UTA A;  5CPK D;  1M1A B;  3REJ B;  1N1J A;  4XUJ B;  4Z5T A;  3REJ C;  5CP6 D;  1P3F D;  5CPJ D;  3B0D B;  2NQB D;  1HQ3 A;  4Z66 D;  3C1C D;  2PYO C;  3NQJ B;  3W97 A;  1P3G C;  2F8N K;  3C1B D;  2ARO C;  3LZ1 B;  3AZL A;  2BYK B;  1S32 D;  2YFW B;  4G91 B;  5CPK A;  5B1L A;  4X23 C;  1P3A B;  1H3O B;  3MGQ C;  5B40 D;  3MGQ D;  5AY8 A;  4R8P A;  3KWQ C;  2ARO D;  3KSY A;  4CSR B;  4J8V B;  5CPJ A;  4J8X A;  5DNM A;  5B32 G;  2NQB A;  5GT3 B;  1P3G D;  4Z66 C;  3C1C C;  2PYO D;  2NQB C;  5GT0 B;  5CPJ C;  5B1M B;  4H9P A;  3REJ D;  4WZS B;  1HTA A;  4KGC A;  3WKJ B;  5DNN D;  5CPK C;  2CWE A;  5JRG A;  3LJA D;  5AV9 A;  3AZK D;  1EQZ C;  4CAY B;  1P3K A;  1M19 B;  1P3F B;  5AV5 A;  1ZLA C;  4LD9 D;  5GT3 A;  3AZI C;  3VH5 A;  1HQ3 C;  2CV5 C;  3REH C;  5B1M A;  1P3O A;  3W96 C;  4YM6 D;  3AV1 A;  1KX5 A;  3REJ A;  3UTA B;  1ID3 B;  3VH6 T;  1N1J B;  4DRA A;  3UTA C;  1KX3 B;  5AV9 C;  4CAY A;  4G92 B;  4WU9 C;  3REL B;  3WAA D;  3W99 C;  4H9Q A;  3X1U C;  1BH9 A;  1U35 C;  3A6N A;  5GT0 D;  3LZ1 A;  1KX3 D;  3REK D;  4WU8 C;  1H3O A;  3WKJ C;  3X1V B;  2YFW A;  5CPK B;  1M1A D;  1ID3 A;  1ULY A;  3TU4 D;  2YFV A;  5AY8 B;  1TZY A;  3LJA B;  3AZK B;  4DRB A;  4J8V A;  3VH6 A;  3B6G C;  4KHA B;  5B2I B;  4X23 A;  4H9P B;  3KWQ B;  3AZL C;  5B31 D;  2F8N A;  1BFM A;  5B24 A;  2HIO B;  3R45 A;  3AZM B;  2HIO C;  5AVC D;  2JSS A;  5AVB C;  1KX4 D;  5FUG B;  4ZBJ B;  1M19 A;  1M18 D;  3MGR D;  3AZG B;  5CHL B;  3MNN D;  1M19 C;  3AFA C;  5F99 B;  1P3O B;  3AZN D;  5CPI D;  2CV5 B;  4NE3 A;  1AOI D;  1P34 D;  5B32 D;  3MGS A;  4J8W D;  3B6F B;  3MGP D;  3AYW B;  3AV1 D;  1KX5 D;  3AZJ C;  3AYW C;  2RVQ C;  3X1T D;  5C3I C;  3WTP E;  3AZE B;  4WNN B;  3LZ0 C;  3KXB A;  4WU9 B;  5E5A C;  3AZM C;  3WTP B;  3MGP A;  4Z5T B;  3W98 B;  5B33 D;  3REK A;  5AV8 D;  3C1B B;  1S32 B;  1P3I B;  3W98 C;  3MGR B;  5AVB A;  5BS7 C;  1P3A C;  2BYK A;  5BS7 A;  1P3A A;  2HIO A;  1P3I D;  3AFA A;  5B2I C;  1B67 A;  3W98 A;  4JJN D;  1P3M D;  3C1B A;  1S32 A;  4J8U D;  4YS3 B;  3UTB D;  5B40 A;  4XZQ C;  3X1V C;  4ZBJ C;  3A6N B;  2HUE C;  5B24 C;  1P3K C;  5F99 A;  4J8X D;  1BH8 A;  5JRG C;  3AZG C;  3MNN A;  3AYW A;  1TZY D;  5BT1 C;  3MGS B;  5GXQ D;  5JRG B;  5B0Z D;  4G91 C;  3AZJ A;  2ARO B;  3LZ1 C;  5CPI A;  3MGS C;  4AWL C;  3REH B;  3KXB B;  3KUY D;  4WU9 A;  3W97 D;  3O62 D;  5DNM C;  3AZE A;  1P3P C;  1BH8 B;  4XUJ C;  4J8W B;  3WTP A;  3KXB D;  3REI D;  1U35 A;  3W99 A;  3MGQ A;  5B1M C;  5B2J D;  4YS3 D;  4KUD C;  4WV4 B;  5BO0 A;  3B0C T;  4H9R B;  4H9O A;  3VH6 W;  5B2J B;  1F1E A;  3WA9 D;  2FJ7 D;  3LEL A;  4XUJ A;  3WTP D;  1TZY B;  4KGC D;  4J8V C;  5B31 B;  5AV5 C;  4YS3 A;  3REL D;  3WAA B;  4QLC D;  3AZE C;  4E44 A;  3LZ0 B;  1ID3 C;  5GT3 D;  5GSU B;  3NQJ A;  3W97 B;  3KWQ A;  5B1L D;  5BNV B;  4XZQ B;  3A6N C;  3AZF C;  1KU5 A;  2HUE B;  1P3G B;  3LEL D;  2FJ7 A;  3MVD C;  5AY8 D;  4Z66 A;  5GSU D;  4R8P D;  3C1C A;  3VH5 W;  5F99 C;  5B31 A;  4WU8 B;  3UT9 D;  5F99 D;  3AZH C;  1P3L D;  4R8P C;  2PYO A;  5AY8 C;  3AN2 D;  3MVD D;  2BYM A;  1P34 B;  4UUZ B;  3LEL C;  3UTB B;  3AZF D;  4R8P B;  4AWL B;  4EO5 C;  3A6N D;  5B31 G;  5GT0 A;  4Z2M H;  1P3O C;  5B1L C;  5BNV A;  5G49 B;  2NZD C;  2CV5 A;  5GT3 C;  3AZI A;  1ID3 D;  3X1S D;  4Z66 B;  3C1C B;  4KGC B;  1F66 D;  4QLC C;  3AZE D;  3REL C;  5AV5 D;  4ZUX A;  5AV9 B;  4LD9 A;  1KX4 B;  4KGC C;  3AN2 A;  3WTP C;  4Z5T C;  5B40 B;  4H9O B;  5E5A B;  1P3K B;  5AV6 A;  1EQZ B;  4M6B A;  5B32 B;  3B6F D;  3TU4 B;  3AV2 C;  1P3B C;  4NE5 A;  1F66 A;  3B6G B;  2L5A A;  4NFT A;  5B2J C;  3AZH B;  5B1M D;  3AZM A;  1P3L B;  3REI C;  3KXB C;  3AV2 D;  1TAF A;  1P3B D;  1BH9 B;  4Z2M G;  3B6F C;  3AZG A;  1P3P D;  5DNM D;  3O62 C;  4HGA B;  1P3G A;  3W97 C;  3X1V A;  4XZQ A;  4Z5T D;  4YM6 B;  5GXQ C;  5B0Z C;  2BYM B;  1F66 C;  3V9R A;  4H9R A;  2PYO B;  3X1S C;  3AZG D;  5B2I A;  1P3K D;  2NZD D;  4J8U A;  1P3O D;  4EO5 B;  4XZQ D;  5G49 A;  3UTB C;  2F8N H;  5B0Y A;  3AN2 C;  2IO5 C;  4JJN B;  4J8U C;  2F8N B;  3AZH D;  1P3L C;  4H9N A;  1KX4 A;  3UT9 C;  5AV8 A;  3REK B;  1P3M C;  2NZD B;  4LD9 B;  2IO5 B;  4JJN C;  1JFI A;  5FUG A;  3X1S A;  5GSU C;  2NQB B;  3AZF B;  5AVB B;  5E5A A;  5JA4 B;  3VH5 T;  1P3A D;  1AOI A;  5B32 A;  5KDM B;  5DNN A;  3W98 D;  3TU4 A;  1F66 B;  3WKJ A;  1M1A A;  4WU8 A;  1JFI B;  4J8V D;  3B6F A;  1P34 A;  1TAF B;  3AZF A;  3AZM D; 
#chains in the Genus database with same CATH topology
 3REI A;  4NE6 A;  5E5A D;  3WA9 C;  5JA4 A;  1P3F A;  4QLC B;  5KDM A;  5B33 A;  3MNN B;  2RVQ D;  3X1T C;  2F8N D;  4KUD D;  2Y2P A;  4YS3 C;  3WAA A;  3W96 A;  3AV1 C;  1KX5 C;  4YM6 A;  4J8W C;  3REH A;  4XUJ D;  3EPH A;  3AZN C;  1P3I A;  4KUD B;  3AFA D;  1M19 D;  3EG5 B;  5AV6 B;  3H0L C;  3REL A;  4QLC A;  1EQZ A;  2JE5 A;  3KUY C;  3AZN A;  2LY8 A;  3MGR C;  1M18 C;  4H9N B;  2NZD A;  3MGS D;  4J8W A;  3B6G A;  3AFA B;  3W96 B;  3LZ1 D;  2BG1 A;  1TZY C;  5BT1 D;  4UUZ A;  3KFU G;  5JRG D;  3LJA A;  4J8X C;  3AZK A;  3O62 B;  5B31 C;  5B24 D;  5AV5 B;  3AZL D;  3X1V D;  3WA9 A;  3MVD A;  5C3I B;  3B0D C;  2Y2Q A;  3AV1 B;  1KX5 B;  5B24 B;  2ARO A;  1WWI A;  3IP4 C;  1A7W A;  3TU4 C;  5B2I D;  3WKJ D;  5BNX B;  1P3I C;  4CSR A;  4H9Q B;  4J8U B;  3WA9 B;  2J8P A;  2FJ7 B;  5B0Y B;  3X1U D;  3W99 D;  1U35 D;  1M18 A;  5B33 B;  3WAA C;  3KUY A;  1P3P B;  1ZLA A;  5AV9 D;  4G92 C;  5AV8 C;  5B33 C;  1U35 B;  3W99 B;  2JCH A;  4KUD A;  3UTB A;  2XD1 A;  4HGA C;  4YM6 C;  3LZ0 D;  4E45 A;  3AZN B;  3REH D;  2CV5 D;  3AZI B;  4WNN A;  5DNN B;  1ZLA D;  3KUY B;  1P3P A;  3MGP B;  3AYW D;  5B0Z A;  3B0B A;  5GXQ A;  3LJA C;  3AZK C;  5DNN C;  3AZJ D;  3LEL B;  3MGP C;  3AV2 B;  1P3B B;  3AN2 B;  5B32 C;  1P34 C;  1AOI C;  3NQU A;  5CPI C;  3REI B;  1KX3 A;  3O62 A;  3LZ0 A;  3X1T B;  4J8X B;  3MGR A;  5GSU A;  3MNN C;  1Q9C A;  4JJN A;  3UT9 A;  1KX4 C;  3KWQ D;  5AVB D;  5AV8 B;  5CP6 A;  5AVC C;  2Y2J A;  1R4V A;  2HIO D;  5B40 C;  3NQU B;  4X23 D;  3F6T A;  3C1B C;  1S32 C;  5BNX A;  3X1T A;  1M18 B;  4KHA A;  1HQ3 B;  1P3F C;  1ZLA B;  4X23 B;  3B6G D;  5AVC A;  3AZJ B;  5B1L B;  5CP6 C;  4ZUX B;  5CPI B;  2G5I C;  4H9S A;  3R45 B;  3V9R B;  1M1A C;  1P3M B;  3REK C;  4ZUX D;  4WU8 D;  5DNM B;  1KX3 C;  5GT0 C;  5CPJ B;  3MVD B;  5B0Y D;  3X1U B;  1B6W A;  3P5J B;  5GXQ B;  5AVC B;  5B0Z B;  4WU9 D;  3AZH A;  5AV6 D;  3AV2 A;  1P3B A;  2Y2I A;  3UTA D;  1WWS A;  5BO0 B;  2YFV B;  4H9S C;  3X1S B;  1P3M A;  3B0C W;  5AV6 C;  3MGQ B;  2FJ7 C;  1P3L A;  2F8N G;  3W96 D;  5B2J A;  5B0Y C;  4WJ3 C;  1AOI B;  3X1U A;  1HQ3 D;  3AZI D;  5CP6 B;  4ZUX C;  4LD9 C;  3UT9 B;  1EQZ D;  3AZL B;  3UTA A;  5CPK D;  1M1A B;  3REJ B;  1N1J A;  2Y2H A;  4XUJ B;  4Z5T A;  3REJ C;  5CP6 D;  1P3F D;  5CPJ D;  3B0D B;  2G5H C;  1HQ3 A;  4Z66 D;  3C1C D;  2NQB D;  2PYO C;  3NQJ B;  3W97 A;  1P3G C;  2F8N K;  3C1B D;  2ARO C;  3LZ1 B;  3AZL A;  2BYK B;  1S32 D;  2YFW B;  4G91 B;  5CPK A;  5B1L A;  4X23 C;  1P3A B;  1H3O B;  3MGQ C;  5B40 D;  3MGQ D;  5AY8 A;  4R8P A;  2UWX A;  3KWQ C;  2ARO D;  3KSY A;  4CSR B;  4J8V B;  5CPJ A;  4J8X A;  5DNM A;  5B32 G;  2NQB A;  5GT3 B;  1P3G D;  4Z66 C;  3C1C C;  2PYO D;  2NQB C;  5GT0 B;  5CPJ C;  5B1M B;  4H9P A;  3REJ D;  2ZY3 A;  4WZS B;  1HTA A;  4KGC A;  3WKJ B;  5DNN D;  5CPK C;  2CWE A;  5JRG A;  3LJA D;  5AV9 A;  3AZK D;  1EQZ C;  4CAY B;  1P3K A;  1M19 B;  1P3F B;  5AV5 A;  1ZLA C;  2Y2M A;  4LD9 D;  5GT3 A;  3AZI C;  3VH5 A;  1HQ3 C;  3A1I A;  3H0R C;  2CV5 C;  3REH C;  2Y2G A;  3FDD A;  5B1M A;  2W8S A;  1P3O A;  3W96 C;  4YM6 D;  3AV1 A;  1KX5 A;  3REJ A;  3UTA B;  1ID3 B;  3VH6 T;  1N1J B;  4DRA A;  3UTA C;  1KX3 B;  5AV9 C;  4CAY A;  4G92 B;  4WU9 C;  3REL B;  3WAA D;  3W99 C;  4H9Q A;  3X1U C;  1BH9 A;  1U35 C;  3A6N A;  5GT0 D;  3LZ1 A;  1KX3 D;  3REK D;  4WU8 C;  1H3O A;  3WKJ C;  3X1V B;  2YFW A;  5CPK B;  1M1A D;  1ID3 A;  1ULY A;  1T3U A;  3TU4 D;  2YFV A;  5AY8 B;  1TZY A;  3LJA B;  3AZK B;  4DRB A;  4J8V A;  3VH6 A;  3B6G C;  2ZY5 A;  4KHA B;  1W2E A;  2ZM5 A;  5B2I B;  3EPJ A;  4X23 A;  4H9P B;  3KWQ B;  3AZL C;  5B31 D;  2F8N A;  1BFM A;  5B24 A;  2HIO B;  3R45 A;  3AZM B;  2HIO C;  5AVC D;  2JSS A;  5AVB C;  1KX4 D;  5FUG B;  4ZBJ B;  1M19 A;  1M18 D;  3MGR D;  3AZG B;  5CHL B;  3MNN D;  1M19 C;  3AFA C;  5F99 B;  1P3O B;  3AZN D;  5CPI D;  2CV5 B;  4NE3 A;  1AOI D;  1P34 D;  5B32 D;  3MGS A;  4J8W D;  3B6F B;  3MGP D;  3EPK A;  3AYW B;  3AV1 D;  1KX5 D;  3AZJ C;  3AYW C;  2RVQ C;  3X1T D;  5C3I C;  3WTP E;  3AZE B;  3AL0 C;  4WNN B;  3LZ0 C;  3KXB A;  4WU9 B;  5E5A C;  3AZM C;  2ZY2 A;  3WTP B;  3MGP A;  4Z5T B;  3W98 B;  5B33 D;  3REK A;  5AV8 D;  3C1B B;  1S32 B;  1P3I B;  3W98 C;  2Y2N A;  3MGR B;  5AVB A;  5BS7 C;  1P3A C;  2BYK A;  5BS7 A;  1P3A A;  2HIO A;  1P3I D;  3AFA A;  5B2I C;  1B67 A;  3W98 A;  4JJN D;  1P3M D;  3C1B A;  1S32 A;  4J8U D;  4YS3 B;  3UTB D;  5B40 A;  4XZQ C;  3X1V C;  4ZBJ C;  3A6N B;  2HUE C;  5B24 C;  1P3K C;  2DQN C;  5F99 A;  4J8X D;  1BH8 A;  5JRG C;  3AZG C;  3MNN A;  3AYW A;  1TZY D;  5BT1 C;  3MGS B;  5GXQ D;  5JRG B;  5B0Z D;  4G91 C;  3AZJ A;  2ARO B;  3LZ1 C;  5CPI A;  3MGS C;  4AWL C;  3REH B;  3KXB B;  3KUY D;  4WU9 A;  3W97 D;  3O62 D;  5DNM C;  3AZE A;  3EPL A;  1P3P C;  1BH8 B;  4XUJ C;  4J8W B;  3WTP A;  3KXB D;  3REI D;  1U35 A;  3W99 A;  3MGQ A;  5B1M C;  5B2J D;  4YS3 D;  4KUD C;  4WV4 B;  5BO0 A;  3B0C T;  2DF4 C;  4H9R B;  2Y2K A;  4H9O A;  3VH6 W;  5B2J B;  1F1E A;  3WA9 D;  2ZY4 A;  2FJ7 D;  3LEL A;  4XUJ A;  3WTP D;  1TZY B;  4KGC D;  4J8V C;  5B31 B;  5AV5 C;  4YS3 A;  3REL D;  2XD5 A;  3WAA B;  4QLC D;  3AZE C;  4E44 A;  3LZ0 B;  1ID3 C;  5GT3 D;  5GSU B;  3NQJ A;  3W97 B;  3KWQ A;  5B1L D;  5BNV B;  4XZQ B;  3A6N C;  3AZF C;  1KU5 A;  2HUE B;  1P3G B;  3LEL D;  2FJ7 A;  3MVD C;  5AY8 D;  4Z66 A;  5GSU D;  4R8P D;  3C1C A;  3VH5 W;  5F99 C;  5B31 A;  2Y2L A;  4WU8 B;  2VQR A;  5F99 D;  3UT9 D;  2RIQ A;  3AZH C;  1P3L D;  4R8P C;  2Y2O A;  2PYO A;  5AY8 C;  3AN2 D;  3MVD D;  2BYM A;  1P34 B;  4UUZ B;  3LEL C;  3UTB B;  3AZF D;  4R8P B;  4AWL B;  4EO5 C;  3A6N D;  5B31 G;  1Z2C B;  4Z2M H;  5GT0 A;  1P3O C;  5B1L C;  5BNV A;  5G49 B;  2NZD C;  2CV5 A;  5GT3 C;  3AZI A;  1ID3 D;  3X1S D;  4Z66 B;  3C1C B;  4KGC B;  1F66 D;  4QLC C;  3AZE D;  3REL C;  5AV5 D;  4ZUX A;  5AV9 B;  4LD9 A;  1KX4 B;  4KGC C;  3AN2 A;  3WTP C;  4Z5T C;  5B40 B;  4H9O B;  3H0M C;  5E5A B;  1P3K B;  2F2A C;  5AV6 A;  1EQZ B;  4M6B A;  5B32 B;  3B6F D;  3TU4 B;  3AV2 C;  1P3B C;  4NE5 A;  1F66 A;  3B6G B;  2L5A A;  4NFT A;  5B2J C;  3AZH B;  5B1M D;  3AZM A;  1P3L B;  3REI C;  3KXB C;  3AV2 D;  1TAF A;  1P3B D;  1BH9 B;  4Z2M G;  3B6F C;  3AZG A;  1P3P D;  1PZR A;  5DNM D;  3O62 C;  4HGA B;  1P3G A;  3W97 C;  3X1V A;  4XZQ A;  4Z5T D;  4YM6 B;  5GXQ C;  5B0Z C;  2BYM B;  1F66 C;  3V9R A;  4H9R A;  3A1K A;  2PYO B;  3X1S C;  3AZG D;  5B2I A;  1P3K D;  2FFF B;  2NZD D;  4J8U A;  1P3O D;  4EO5 B;  4XZQ D;  5G49 A;  4DQY B;  3UTB C;  2F8N H;  5B0Y A;  3AN2 C;  2IO5 C;  4JJN B;  4J8U C;  2F8N B;  3AZH D;  1P3L C;  4H9N A;  1KX4 A;  3UT9 C;  5AV8 A;  3REK B;  1P3M C;  2NZD B;  4LD9 B;  2IO5 B;  4JJN C;  1JFI A;  4UPK A;  5FUG A;  3X1S A;  5GSU C;  2NQB B;  3AZF B;  5AVB B;  5E5A A;  5JA4 B;  3VH5 T;  1P3A D;  1AOI A;  5B32 A;  5KDM B;  5DNN A;  3W98 D;  3TU4 A;  1F66 B;  3WKJ A;  1M1A A;  4WU8 A;  1JFI B;  4J8V D;  3B6F A;  1P34 A;  1TAF B;  3AZF A;  3AZM D; 
#chains in the Genus database with same CATH homology
 3REI A;  4NE6 A;  5E5A D;  3WA9 C;  5JA4 A;  1P3F A;  4QLC B;  5KDM A;  5B33 A;  3MNN B;  2RVQ D;  3X1T C;  2F8N D;  4KUD D;  2Y2P A;  4YS3 C;  3WAA A;  3W96 A;  3AV1 C;  1KX5 C;  4YM6 A;  4J8W C;  3REH A;  4XUJ D;  3EPH A;  3AZN C;  1P3I A;  4KUD B;  3AFA D;  1M19 D;  3EG5 B;  5AV6 B;  3H0L C;  3REL A;  4QLC A;  1EQZ A;  2JE5 A;  3KUY C;  3AZN A;  2LY8 A;  3MGR C;  1M18 C;  4H9N B;  2NZD A;  3MGS D;  4J8W A;  3B6G A;  3AFA B;  3W96 B;  3LZ1 D;  2BG1 A;  1TZY C;  5BT1 D;  4UUZ A;  3KFU G;  5JRG D;  3LJA A;  4J8X C;  3AZK A;  3O62 B;  5B31 C;  5B24 D;  5AV5 B;  3AZL D;  3X1V D;  3WA9 A;  3MVD A;  5C3I B;  3B0D C;  2Y2Q A;  3AV1 B;  1KX5 B;  5B24 B;  2ARO A;  1WWI A;  3IP4 C;  1A7W A;  3TU4 C;  5B2I D;  3WKJ D;  5BNX B;  1P3I C;  4CSR A;  4H9Q B;  4J8U B;  3WA9 B;  2J8P A;  2FJ7 B;  5B0Y B;  3X1U D;  3W99 D;  1U35 D;  1M18 A;  5B33 B;  3WAA C;  3KUY A;  1P3P B;  1ZLA A;  5AV9 D;  4G92 C;  5AV8 C;  5B33 C;  1U35 B;  3W99 B;  2JCH A;  4KUD A;  3UTB A;  2XD1 A;  4HGA C;  4YM6 C;  3LZ0 D;  4E45 A;  3AZN B;  3REH D;  2CV5 D;  3AZI B;  4WNN A;  5DNN B;  1ZLA D;  3KUY B;  1P3P A;  3MGP B;  3AYW D;  5B0Z A;  3B0B A;  5GXQ A;  3LJA C;  3AZK C;  5DNN C;  3AZJ D;  3LEL B;  3MGP C;  3AV2 B;  1P3B B;  3AN2 B;  5B32 C;  1P34 C;  1AOI C;  3NQU A;  5CPI C;  3REI B;  1KX3 A;  3O62 A;  3LZ0 A;  3X1T B;  4J8X B;  3MGR A;  5GSU A;  3MNN C;  1Q9C A;  4JJN A;  3UT9 A;  1KX4 C;  3KWQ D;  5AVB D;  5AV8 B;  5CP6 A;  5AVC C;  2Y2J A;  1R4V A;  2HIO D;  5B40 C;  3NQU B;  4X23 D;  3F6T A;  3C1B C;  1S32 C;  5BNX A;  3X1T A;  1M18 B;  4KHA A;  1HQ3 B;  1P3F C;  1ZLA B;  4X23 B;  3B6G D;  5AVC A;  3AZJ B;  5B1L B;  5CP6 C;  4ZUX B;  5CPI B;  2G5I C;  4H9S A;  3R45 B;  3V9R B;  1M1A C;  1P3M B;  3REK C;  4ZUX D;  4WU8 D;  5DNM B;  1KX3 C;  5GT0 C;  5CPJ B;  3MVD B;  5B0Y D;  3X1U B;  1B6W A;  3P5J B;  5GXQ B;  5AVC B;  5B0Z B;  4WU9 D;  3AZH A;  5AV6 D;  3AV2 A;  1P3B A;  2Y2I A;  3UTA D;  1WWS A;  5BO0 B;  2YFV B;  4H9S C;  3X1S B;  1P3M A;  3B0C W;  5AV6 C;  3MGQ B;  2FJ7 C;  1P3L A;  2F8N G;  3W96 D;  5B2J A;  5B0Y C;  4WJ3 C;  1AOI B;  3X1U A;  1HQ3 D;  3AZI D;  5CP6 B;  4ZUX C;  4LD9 C;  3UT9 B;  1EQZ D;  3AZL B;  3UTA A;  5CPK D;  1M1A B;  3REJ B;  1N1J A;  2Y2H A;  4XUJ B;  4Z5T A;  3REJ C;  5CP6 D;  1P3F D;  5CPJ D;  3B0D B;  2G5H C;  1HQ3 A;  4Z66 D;  3C1C D;  2NQB D;  2PYO C;  3NQJ B;  3W97 A;  1P3G C;  2F8N K;  3C1B D;  2ARO C;  3LZ1 B;  3AZL A;  2BYK B;  1S32 D;  2YFW B;  4G91 B;  5CPK A;  5B1L A;  4X23 C;  1P3A B;  1H3O B;  3MGQ C;  5B40 D;  3MGQ D;  5AY8 A;  4R8P A;  2UWX A;  3KWQ C;  2ARO D;  3KSY A;  4CSR B;  4J8V B;  5CPJ A;  4J8X A;  5DNM A;  5B32 G;  2NQB A;  5GT3 B;  1P3G D;  4Z66 C;  3C1C C;  2PYO D;  2NQB C;  5GT0 B;  5CPJ C;  5B1M B;  4H9P A;  3REJ D;  2ZY3 A;  4WZS B;  1HTA A;  4KGC A;  3WKJ B;  5DNN D;  5CPK C;  2CWE A;  5JRG A;  3LJA D;  5AV9 A;  3AZK D;  1EQZ C;  4CAY B;  1P3K A;  1M19 B;  1P3F B;  5AV5 A;  1ZLA C;  2Y2M A;  4LD9 D;  5GT3 A;  3AZI C;  3VH5 A;  1HQ3 C;  3A1I A;  3H0R C;  2CV5 C;  3REH C;  2Y2G A;  3FDD A;  5B1M A;  2W8S A;  1P3O A;  3W96 C;  4YM6 D;  3AV1 A;  1KX5 A;  3REJ A;  3UTA B;  1ID3 B;  3VH6 T;  1N1J B;  4DRA A;  3UTA C;  1KX3 B;  5AV9 C;  4CAY A;  4G92 B;  4WU9 C;  3REL B;  3WAA D;  3W99 C;  4H9Q A;  3X1U C;  1BH9 A;  1U35 C;  3A6N A;  5GT0 D;  3LZ1 A;  1KX3 D;  3REK D;  4WU8 C;  1H3O A;  3WKJ C;  3X1V B;  2YFW A;  5CPK B;  1M1A D;  1ID3 A;  1ULY A;  1T3U A;  3TU4 D;  2YFV A;  5AY8 B;  1TZY A;  3LJA B;  3AZK B;  4DRB A;  4J8V A;  3VH6 A;  3B6G C;  2ZY5 A;  4KHA B;  1W2E A;  2ZM5 A;  5B2I B;  3EPJ A;  4X23 A;  4H9P B;  3KWQ B;  3AZL C;  5B31 D;  2F8N A;  1BFM A;  5B24 A;  2HIO B;  3R45 A;  3AZM B;  2HIO C;  5AVC D;  2JSS A;  5AVB C;  1KX4 D;  5FUG B;  4ZBJ B;  1M19 A;  1M18 D;  3MGR D;  3AZG B;  5CHL B;  3MNN D;  1M19 C;  3AFA C;  5F99 B;  1P3O B;  3AZN D;  5CPI D;  2CV5 B;  4NE3 A;  1AOI D;  1P34 D;  5B32 D;  3MGS A;  4J8W D;  3B6F B;  3MGP D;  3EPK A;  3AYW B;  3AV1 D;  1KX5 D;  3AZJ C;  3AYW C;  2RVQ C;  3X1T D;  5C3I C;  3WTP E;  3AZE B;  3AL0 C;  4WNN B;  3LZ0 C;  3KXB A;  4WU9 B;  5E5A C;  3AZM C;  2ZY2 A;  3WTP B;  3MGP A;  4Z5T B;  3W98 B;  5B33 D;  3REK A;  5AV8 D;  3C1B B;  1S32 B;  1P3I B;  3W98 C;  2Y2N A;  3MGR B;  5AVB A;  5BS7 C;  1P3A C;  2BYK A;  5BS7 A;  1P3A A;  2HIO A;  1P3I D;  3AFA A;  5B2I C;  1B67 A;  3W98 A;  4JJN D;  1P3M D;  3C1B A;  1S32 A;  4J8U D;  4YS3 B;  3UTB D;  5B40 A;  4XZQ C;  3X1V C;  4ZBJ C;  3A6N B;  2HUE C;  5B24 C;  1P3K C;  2DQN C;  5F99 A;  4J8X D;  1BH8 A;  5JRG C;  3AZG C;  3MNN A;  3AYW A;  1TZY D;  5BT1 C;  3MGS B;  5GXQ D;  5JRG B;  5B0Z D;  4G91 C;  3AZJ A;  2ARO B;  3LZ1 C;  5CPI A;  3MGS C;  4AWL C;  3REH B;  3KXB B;  3KUY D;  4WU9 A;  3W97 D;  3O62 D;  5DNM C;  3AZE A;  3EPL A;  1P3P C;  1BH8 B;  4XUJ C;  4J8W B;  3WTP A;  3KXB D;  3REI D;  1U35 A;  3W99 A;  3MGQ A;  5B1M C;  5B2J D;  4YS3 D;  4KUD C;  4WV4 B;  5BO0 A;  3B0C T;  2DF4 C;  4H9R B;  2Y2K A;  4H9O A;  3VH6 W;  5B2J B;  1F1E A;  3WA9 D;  2ZY4 A;  2FJ7 D;  3LEL A;  4XUJ A;  3WTP D;  1TZY B;  4KGC D;  4J8V C;  5B31 B;  5AV5 C;  4YS3 A;  3REL D;  2XD5 A;  3WAA B;  4QLC D;  3AZE C;  4E44 A;  3LZ0 B;  1ID3 C;  5GT3 D;  5GSU B;  3NQJ A;  3W97 B;  3KWQ A;  5B1L D;  5BNV B;  4XZQ B;  3A6N C;  3AZF C;  1KU5 A;  2HUE B;  1P3G B;  3LEL D;  2FJ7 A;  3MVD C;  5AY8 D;  4Z66 A;  5GSU D;  4R8P D;  3C1C A;  3VH5 W;  5F99 C;  5B31 A;  2Y2L A;  4WU8 B;  2VQR A;  5F99 D;  3UT9 D;  2RIQ A;  3AZH C;  1P3L D;  4R8P C;  2Y2O A;  2PYO A;  5AY8 C;  3AN2 D;  3MVD D;  2BYM A;  1P34 B;  4UUZ B;  3LEL C;  3UTB B;  3AZF D;  4R8P B;  4AWL B;  4EO5 C;  3A6N D;  5B31 G;  1Z2C B;  4Z2M H;  5GT0 A;  1P3O C;  5B1L C;  5BNV A;  5G49 B;  2NZD C;  2CV5 A;  5GT3 C;  3AZI A;  1ID3 D;  3X1S D;  4Z66 B;  3C1C B;  4KGC B;  1F66 D;  4QLC C;  3AZE D;  3REL C;  5AV5 D;  4ZUX A;  5AV9 B;  4LD9 A;  1KX4 B;  4KGC C;  3AN2 A;  3WTP C;  4Z5T C;  5B40 B;  4H9O B;  3H0M C;  5E5A B;  1P3K B;  2F2A C;  5AV6 A;  1EQZ B;  4M6B A;  5B32 B;  3B6F D;  3TU4 B;  3AV2 C;  1P3B C;  4NE5 A;  1F66 A;  3B6G B;  2L5A A;  4NFT A;  5B2J C;  3AZH B;  5B1M D;  3AZM A;  1P3L B;  3REI C;  3KXB C;  3AV2 D;  1TAF A;  1P3B D;  1BH9 B;  4Z2M G;  3B6F C;  3AZG A;  1P3P D;  1PZR A;  5DNM D;  3O62 C;  4HGA B;  1P3G A;  3W97 C;  3X1V A;  4XZQ A;  4Z5T D;  4YM6 B;  5GXQ C;  5B0Z C;  2BYM B;  1F66 C;  3V9R A;  4H9R A;  3A1K A;  2PYO B;  3X1S C;  3AZG D;  5B2I A;  1P3K D;  2FFF B;  2NZD D;  4J8U A;  1P3O D;  4EO5 B;  4XZQ D;  5G49 A;  4DQY B;  3UTB C;  2F8N H;  5B0Y A;  3AN2 C;  2IO5 C;  4JJN B;  4J8U C;  2F8N B;  3AZH D;  1P3L C;  4H9N A;  1KX4 A;  3UT9 C;  5AV8 A;  3REK B;  1P3M C;  2NZD B;  4LD9 B;  2IO5 B;  4JJN C;  1JFI A;  4UPK A;  5FUG A;  3X1S A;  5GSU C;  2NQB B;  3AZF B;  5AVB B;  5E5A A;  5JA4 B;  3VH5 T;  1P3A D;  1AOI A;  5B32 A;  5KDM B;  5DNN A;  3W98 D;  3TU4 A;  1F66 B;  3WKJ A;  1M1A A;  4WU8 A;  1JFI B;  4J8V D;  3B6F A;  1P34 A;  1TAF B;  3AZF A;  3AZM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...