1P3GA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gA00
3C1CA 1P3ID 1B67A 5B33A 4WU9A 3B6GD 3X1TB 5CPID 5BNVA 5GT3C 3B0CW 4X23C 3R45A 5CPKD 3W97C 3MGSA 5JRGA 3LELA 4Z5TC 2F8NG 3A6NA 5C3IB 5CP6D 1P3KA 2NZDD 3AZMC 2LY8A 4ZBJC 5AV9B 3LZ1C 1P3MB 1HQ3C 3UT9B 3AZFB 5DNMD 5B24D 4LD9D 4CSRB 2PYOC 3KWQD 5B32C 3AFAA 5B0YB 4DRBA 4QLCB 1P3OA 3MNNB 4CAYA 3B0DB 1KX5D 3MGRB 2YFWB 3AYWC 3W99C 1AOIB 3AZGD 3AZJC 3MGQC 5B0ZB 3AZED 5E5AB 5AV6C 5B1LB 5CPJB 3KXBD 3C1CD 4XUJA 5B0YA 4QLCA 5F99C 5B33D 4WU9D 1P3AA 2BYKB 4XZQC 3MVDC 2HIOA 1P3LC 3MGRA 3X1VB 1AOIA 5GXQC 5B0ZA 3RELB 5KDMA 3MGSD 5JRGD 3LELD 4R8PC 3O62B 1P3BB 3A6ND 5CPJA 4ZUXC 1P3KD 3AV2C 3MGPB 3AN2C 1M19C 1F66B 4H9RA 4YS3B 3C1BB 3AZNC 1Q9CA 3WKJC 4G92B 1M1AA 3VH6W 4E45A 3AZIC 2NQBB 4G91C 3WAAB 4Z66B 1P3BA 1TZYB 3B6FA 3UTAC 3AFAD 5DNNB 1P3OD 1P3PA 3WA9C 2L5AA 3C1BA 2RVQD 5AVCA 3B6GB 5B2JB 5CPIB 1KX4B 4HGAC 1P34C 2NQBA 3WAAA 5CPKB 1TZYA 1EQZA 4XUJD 5B0YD 4QLCD 3AZLC 4WV4B 4KUDC 5CP6B 4NE3A 1P3AD 2NZDB 2HIOD 1S32B 3MGRD 4KGCB 1AOID 5B2JA 1KX4A 3B0BA 5B0ZD 4H9OB 2CWEA 5GSUC 5B24B 1P3IC 4LD9B 5CPJD 4H9NB 4KHAB 5B1MA 3X1UA 2FJ7A 3REIA 1S32A 3LJAB 4KGCA 3AV1C 4J8XA 1M1AD 4H9OA 4WU8A 3AZGB 1P3BD 3B6FD 4H9NA 5DNMC 1P3FC 1KX3B 2IO5C 3KXBB 1P3PD 5AV8A 1P3GC 3C1BD 5AY8C 3LJAA 3KWQC 5B33B 3LZ0B 5AVCD 4J8VC 3AZKA 2NQBD 3R45B 3WAAD 1BH9B 4Z66D 2CV5A 1TZYD 1KX5C 1EQZD 3KUYB 1KX3A 5BO0A 3LELB 3AZHA 3UTBC 2BYMA 1ID3B 5GT0C 3LZ0A 5B40A 3C1CC 5B2JD 1KX4D 5BT1C 1TAFB 3REJA 4WU9C 1BH9A 4H9SC 1N1JA 3KUYA 5B1MD 3TU4B 3X1UD 2AROC 5AV5C 4JJNA 2FJ7D 3REID 3MGSC 3AFAB 5JRGC 1ID3A 1S32D 1P3OB 4CAYB 3A6NC 1P3KC 4KGCD 4J8XD 1TAFA 4WU8D 3VH5W 3X1TC 5GT3A 1HTAA 3W97A 3TU4A 1M18B 5AV8D 5B31B 4XUJB 3LJAD 1P3AB 4YM6B 5C3IC 2HIOB 3AZKD 5AV9C 2CV5D 1HQ3A 1P3MC 3AZFC 3REHB 5KDMB 3UT9C 1KX3D 5BS7C 3X1SB 4NFTA 3AZHD 1M18A 2PYOA 5B31A 3REKB 4H9RB 3LZ0D 5B40D 4YM6A 3W98B 5B0YC 4QLCC 3REJD 3MNNC 3B0DC 1M1AB 3AYWA 3MGRC 3REHA 3W99A 3KUYD 3AZJA 3X1SA 1BH8B 1AOIC 1BFMA 4JJND 3B6FB 5B0ZC 5G49A 5AV6A 4M6BA 1ID3D 5E5AC 3REKA 5B1LC 3W98A 5CPJC 3VH6A 1P3PB 2F8NB 1F1EA 4EO5C 5AVCB 3MVDA 1P3LA 5GT3D 3X1VC 3WKJB 1BH8A 2HUEB 3W97D 5GXQA 3TU4D 1EQZB 3RELC 3O62C 4ZUXA 1P3BC 5BNXA 3AV2A 2F8NA 1M19A 3AN2A 3MGPC 1F66C 4YS3C 1U35C 1HQ3D 4H9PA 3AZNA 3WKJA 4G92C 3AZIA 1M18D 2PYOD 2NQBC 5B31D 5B1MB 3X1UB 4Z66C 2FJ7B 3REIB 3UTAA 4YM6D 5DNNC 3WA9A 4J8XB 1WWIA 3AYWD 4H9QB 3W99D 4WU8B 3REHD 3AZJD 3X1SD 1ZLAB 3B0CT 3B6GC 1B6WA 5CPIC 1KX4C 1P34A 5AV6D 3REKD 5CPKC 3W98D 5AV8B 1H3OA 4KUDA 1A7WA 5CP6C 2NZDC 1P3LD 1S32C 4H9QA 3AZKB 1ZLAA 4KGCC 2CV5B 5GXQD 4AWLC 5GSUA 5B24C 4LD9C 5BO0B 1P3KB 3AZHB 4E44A 4J8WB 4ZUXD 2BYMB 3AV2D 2F8ND 1M19D 3AN2D 3W96B 5B40B 5FUGB 3LJAC 1ULYA 3REJB 3AZND 3AV1A 3WKJD 5AVBB 3AZID 5B2IB 1N1JB 4J8UB 3AZGC 3WTPB 4JJNB 4J8WA 3AZEC 3UTAD 1P3FA 3W96A 5B31G 3UTBB 3WA9D 3KXBC 1P3GA 5AY8A 5FUGA 5B33C 3LZ0C 4J8VA 5AVBA 5GT3B 4X23B 1P34D 5B2IA 4J8UA 4WNNA 3W97B 3WTPA 4Z5TB 3VH5A 4KUDD 3LELC 3UTBA 1KU5A 3AZMB 5GT0A 1ID3C 4ZBJB 3LZ1B 1ZLAD 1HQ3B 4X23A 5GSUD 3VH6T 4H9SA 2PYOB 4Z5TA 2AROA 2YFVA 5AV5A 5B32B 3TU4C 3AZMA 3AFAC 1JFIA 1P3OC 3LZ1A 3AV1D 2RVQC 3AYWB 3W99B 3AZJB 3NQUB 3X1TA 4Z2MH 3MGQB 2JSSA 4J8WD 1P3FD 5G49B 5AV6B 3W96D 5B32A 1P3GD 1M18C 5AY8D 5B31C 5F99B 4XUJC 4XZQB 3MVDB 4YM6C 4J8VD 1P3AC 5AVBD 1P3LB 2HIOC 5B2ID 3NQUA 5AV9A 4J8UD 5GXQB 3WTPD 3MGQA 1P3MA 3AZFA 3UT9A 3REHC 4CSRA 5BS7A 4R8PB 3X1SC 4NE6A 3UTBD 4ZUXB 3NQJB 5BNXB 3AV2B 1M19B 3AN2B 5F99A 5GT0D 3REKC 4XZQA 3W98C 4EO5B 5BT1D 4X23D 3MNNA 4H9PB 3AZNB 1M1AC 2YFWA 3AZIB 4G91B 4R8PA 4Z5TD 2AROD 5AV5D 3NQJA 3UTAB 3B6FC 3AZMD 3V9RB 5E5AA 1WWSA 5B1LA 3LZ1D 3WA9B 1P3PC 3WTPE 3C1BC 5AVCC 2BYKA 3X1TD 1U35B 4HGAB 1P34B 3X1VA 3WAAC 2HUEC 5B32D 1TZYC 1EQZC 3RELA 1H3OB 3V9RA 3AZLB 4KUDB 3O62A 4DRAA 3KSYA 3MGPA 2F8NH 1F66A 5AV9D 4YS3A 1U35A 5B2JC 3MGQD 1P3IB 3AZFD 3UT9D 5GSUB 1P3MD 2F8NK 3AZLA 4Z66A 5B1MC 5F99D 5CHLB 3X1UC 2FJ7C 4NE5A 3REIC 4XZQD 3MVDD 5DNNA 4UUZB 3MNND 3AV1B 4Z2MG 3VH5T 4J8XC 1R4VA 1P3IA 4WU8C 3B6GA 4R8PD 1ZLAC 5CPIA 4AWLB 5JA4B 5DNMB 1P3FB 5E5AD 5CPKA 5B1LD 2IO5B 1P3GB 5AV8C 5AY8B 3KWQB 4UUZA 5CP6A 4J8VB 2NZDA 3AZKC 3X1VD 4WNNB 1KX5B 2CV5C 5JA4A 5DNMA 5B24A 3RELD 4LD9A 1KX3C 3AZHC 3O62D 4J8WC 3AZEB 5B32G 4KHAA 3MGPD 3KWQA 5GT0B 3W96C 1F66D 3C1CB 5B40C 4WZSB 4YS3D 1U35D 4WU9B 3REJC 5BNVB 5AVBC 1KX5A 5B2IC 3KUYC 3AZGA 4J8UC 3AZLD 2AROB 2YFVB 5AV5B 3WTPC 4JJNC 3AZEA 3MGSB 5JRGB 5DNND 1JFIB 3A6NB 3KXBA
chains in the Genus database with same CATH superfamily
3C1CA 1P3ID 1B67A 5B33A 4WU9A 3B6GD 3X1TB 5CPID 5BNVA 3EPLA 5GT3C 3B0CW 4X23C 3R45A 5CPKD 3W97C 3MGSA 5JRGA 3LELA 4Z5TC 2F8NG 3A6NA 5C3IB 5CP6D 1P3KA 2NZDD 3AZMC 2LY8A 4ZBJC 5AV9B 3LZ1C 1P3MB 1HQ3C 3UT9B 3AZFB 5DNMD 5B24D 4LD9D 4CSRB 2PYOC 3KWQD 5B32C 3AFAA 5B0YB 4DRBA 4QLCB 1P3OA 3MNNB 4CAYA 3B0DB 1KX5D 3MGRB 2Y2HA 2XD5A 2YFWB 3AYWC 3W99C 1AOIB 3AZGD 3AZJC 3EPJA 3MGQC 5B0ZB 3AZED 5E5AB 5AV6C 5B1LB 5CPJB 3KXBD 3C1CD 4XUJA 5B0YA 4QLCA 5F99C 5B33D 4WU9D 1P3AA 2BYKB 4XZQC 2DF4C 2HIOA 3MVDC 1P3LC 3MGRA 3X1VB 1AOIA 5GXQC 5B0ZA 3RELB 5KDMA 3MGSD 5JRGD 3LELD 4R8PC 3O62B 1P3BB 2ZY2A 3A6ND 5CPJA 4ZUXC 1P3KD 3AV2C 3MGPB 3AN2C 1M19C 3H0MC 1F66B 4H9RA 4YS3B 3C1BB 3AZNC 1Q9CA 3WKJC 4G92B 1M1AA 3VH6W 4E45A 3AZIC 2NQBB 4G91C 3WAAB 4Z66B 1P3BA 1TZYB 3B6FA 3UTAC 3AFAD 5DNNB 2FFFB 1P3OD 1P3PA 3WA9C 2L5AA 3C1BA 2RVQD 5AVCA 3B6GB 5B2JB 5CPIB 1KX4B 4HGAC 1P34C 2NQBA 3WAAA 5CPKB 1TZYA 1EQZA 4XUJD 5B0YD 4QLCD 3AZLC 4WV4B 4KUDC 5CP6B 4NE3A 1P3AD 2NZDB 2UWXA 2HIOD 1S32B 3MGRD 4KGCB 1AOID 5B2JA 1KX4A 2VQRA 3B0BA 4H9OB 5B0ZD 2CWEA 5GSUC 5B24B 1P3IC 4LD9B 5CPJD 4H9NB 4KHAB 5B1MA 3X1UA 2FJ7A 3REIA 1S32A 3LJAB 2ZY4A 4KGCA 3AV1C 4J8XA 1M1AD 4H9OA 4WU8A 2G5IC 3AZGB 1P3BD 2Y2LA 3B6FD 4H9NA 5DNMC 1P3FC 1KX3B 3EPKA 3FDDA 2IO5C 3KXBB 1P3PD 5AV8A 1P3GC 3C1BD 5AY8C 3LJAA 3KWQC 5B33B 3LZ0B 5AVCD 1PZRA 3A1IA 4J8VC 3AZKA 2NQBD 3R45B 3WAAD 1BH9B 2ZY3A 4Z66D 2CV5A 1TZYD 1KX5C 1EQZD 3KUYB 1KX3A 5BO0A 3LELB 3AZHA 3UTBC 2BYMA 1ID3B 5GT0C 3LZ0A 5B40A 3C1CC 5B2JD 1KX4D 1T3UA 5BT1C 1TAFB 3REJA 4WU9C 1BH9A 4H9SC 1N1JA 3KUYA 5B1MD 3TU4B 3X1UD 2AROC 5AV5C 4JJNA 2FJ7D 3REID 3MGSC 3AFAB 5JRGC 1ID3A 1Z2CB 1S32D 1P3OB 4CAYB 3A6NC 1P3KC 4KGCD 4J8XD 1TAFA 4WU8D 3VH5W 3X1TC 1W2EA 5GT3A 1HTAA 3W97A 3TU4A 1M18B 5AV8D 5B31B 4XUJB 3LJAD 1P3AB 4YM6B 5C3IC 2HIOB 3EPHA 3AZKD 5AV9C 2CV5D 1HQ3A 1P3MC 3AZFC 3REHB 5KDMB 3UT9C 1KX3D 5BS7C 3X1SB 4NFTA 3AZHD 1M18A 2PYOA 5B31A 3REKB 4H9RB 3LZ0D 5B40D 4YM6A 3W98B 5B0YC 4QLCC 2Y2JA 3REJD 3MNNC 3B0DC 1M1AB 3AYWA 3MGRC 3REHA 3W99A 3KUYD 3AZJA 3X1SA 1BH8B 1AOIC 1BFMA 4JJND 3B6FB 3A1KA 2Y2KA 5B0ZC 5G49A 2Y2MA 5AV6A 4M6BA 1ID3D 5E5AC 3REKA 5B1LC 3W98A 5CPJC 3VH6A 1P3PB 2F8NB 1F1EA 4EO5C 5AVCB 3MVDA 1P3LA 5GT3D 3X1VC 3WKJB 1BH8A 2HUEB 3W97D 5GXQA 3TU4D 1EQZB 3RELC 2BG1A 3O62C 4ZUXA 1P3BC 5BNXA 3AV2A 2F8NA 1M19A 3AN2A 3MGPC 1F66C 4YS3C 1U35C 1HQ3D 3IP4C 4H9PA 3AZNA 3WKJA 4G92C 3AZIA 1M18D 2PYOD 2NQBC 5B31D 3P5JB 5B1MB 3X1UB 4Z66C 2FJ7B 3REIB 3UTAA 4YM6D 5DNNC 3WA9A 4J8XB 1WWIA 3AYWD 4H9QB 3W99D 4WU8B 3REHD 3AZJD 3X1SD 1ZLAB 3B0CT 3B6GC 1B6WA 5CPIC 2XD1A 1KX4C 1P34A 2JCHA 2DQNC 5AV6D 3REKD 5CPKC 3W98D 5AV8B 3H0LC 1H3OA 4KUDA 4UPKA 1A7WA 5CP6C 2Y2GA 2NZDC 1P3LD 1S32C 4H9QA 3AZKB 1ZLAA 4KGCC 2CV5B 5GXQD 4AWLC 5GSUA 5B24C 4LD9C 5BO0B 1P3KB 3AZHB 4E44A 4J8WB 4ZUXD 2BYMB 3AV2D 2F8ND 1M19D 3AN2D 2Y2PA 3W96B 5B40B 2J8PA 5FUGB 3LJAC 1ULYA 3REJB 3AZND 3AV1A 3WKJD 5AVBB 3AZID 5B2IB 1N1JB 4J8UB 3AZGC 3WTPB 4JJNB 4J8WA 3AZEC 3UTAD 1P3FA 2W8SA 3W96A 5B31G 3UTBB 3WA9D 3KXBC 1P3GA 5AY8A 3KFUG 5FUGA 5B33C 3LZ0C 4J8VA 3H0RC 5AVBA 5GT3B 4X23B 1P34D 5B2IA 4J8UA 4WNNA 3W97B 3WTPA 4Z5TB 3VH5A 4KUDD 3LELC 3UTBA 1KU5A 3AZMB 5GT0A 1ID3C 4ZBJB 3LZ1B 1ZLAD 1HQ3B 4X23A 5GSUD 2Y2IA 3VH6T 4H9SA 2PYOB 4Z5TA 2AROA 2YFVA 5AV5A 5B32B 3TU4C 3AZMA 3AFAC 1JFIA 1P3OC 3LZ1A 3AV1D 2JE5A 2RVQC 3AYWB 3W99B 2RIQA 3AZJB 3NQUB 3X1TA 4Z2MH 3MGQB 2JSSA 4J8WD 1P3FD 5G49B 5AV6B 3W96D 5B32A 1P3GD 1M18C 5AY8D 5B31C 5F99B 4XUJC 4XZQB 3MVDB 4YM6C 4J8VD 1P3AC 5AVBD 1P3LB 2HIOC 5B2ID 3NQUA 5AV9A 4J8UD 5GXQB 3WTPD 3MGQA 1P3MA 3AZFA 3UT9A 2Y2NA 3REHC 4CSRA 5BS7A 4R8PB 3X1SC 4NE6A 3UTBD 2Y2QA 4ZUXB 3NQJB 5BNXB 3AV2B 1M19B 3AN2B 2Y2OA 5F99A 5GT0D 2F2AC 3REKC 4XZQA 2ZM5A 3W98C 4EO5B 5BT1D 3AL0C 4X23D 3EG5B 3MNNA 4H9PB 3AZNB 1M1AC 2YFWA 3AZIB 4G91B 4R8PA 4Z5TD 2AROD 2ZY5A 5AV5D 3NQJA 3UTAB 3B6FC 3AZMD 3V9RB 5E5AA 1WWSA 5B1LA 3LZ1D 3WA9B 1P3PC 3WTPE 3C1BC 5AVCC 2BYKA 3X1TD 1U35B 4HGAB 1P34B 3X1VA 3WAAC 2HUEC 2G5HC 5B32D 1TZYC 1EQZC 3RELA 1H3OB 3V9RA 3AZLB 4KUDB 4WJ3C 3O62A 4DRAA 3KSYA 3MGPA 2F8NH 1F66A 5AV9D 4YS3A 1U35A 5B2JC 3MGQD 1P3IB 3AZFD 3UT9D 5GSUB 1P3MD 2F8NK 3AZLA 5B1MC 5F99D 5CHLB 4Z66A 3X1UC 2FJ7C 4NE5A 3F6TA 4XZQD 3MVDD 3REIC 5DNNA 4UUZB 3MNND 3AV1B 4Z2MG 3VH5T 4J8XC 1R4VA 1P3IA 4WU8C 3B6GA 4R8PD 1ZLAC 5CPIA 4DQYB 4AWLB 5JA4B 5DNMB 1P3FB 5E5AD 5CPKA 5B1LD 2IO5B 1P3GB 5AV8C 5AY8B 3KWQB 4UUZA 5CP6A 4J8VB 2NZDA 3AZKC 3X1VD 4WNNB 1KX5B 2CV5C 5JA4A 5DNMA 5B24A 3RELD 4LD9A 1KX3C 3AZHC 3O62D 4J8WC 3AZEB 5B32G 4KHAA 3MGPD 3KWQA 5GT0B 3W96C 1F66D 3C1CB 5B40C 4WZSB 4YS3D 1U35D 4WU9B 3REJC 5BNVB 5AVBC 1KX5A 5B2IC 3KUYC 3AZGA 4J8UC 3AZLD 2AROB 2YFVB 5AV5B 3WTPC 4JJNC 3AZEA 3MGSB 5JRGB 5DNND 1JFIB 3A6NB 3KXBA
chains in the Genus database with same CATH topology
3C1CA 1P3ID 1B67A 5B33A 4WU9A 3B6GD 3X1TB 5CPID 5BNVA 3EPLA 5GT3C 3B0CW 4X23C 3R45A 5CPKD 3W97C 3MGSA 5JRGA 3LELA 4Z5TC 2F8NG 3A6NA 5C3IB 5CP6D 1P3KA 2NZDD 3AZMC 2LY8A 4ZBJC 5AV9B 3LZ1C 1P3MB 1HQ3C 3UT9B 3AZFB 5DNMD 5B24D 4LD9D 4CSRB 2PYOC 3KWQD 5B32C 3AFAA 5B0YB 4DRBA 4QLCB 1P3OA 3MNNB 4CAYA 3B0DB 1KX5D 3MGRB 2Y2HA 2XD5A 2YFWB 3AYWC 3W99C 1AOIB 3AZGD 3AZJC 3EPJA 3MGQC 5B0ZB 3AZED 5E5AB 5AV6C 5B1LB 5CPJB 3KXBD 3C1CD 4XUJA 5B0YA 4QLCA 5F99C 5B33D 4WU9D 1P3AA 2BYKB 4XZQC 2DF4C 2HIOA 3MVDC 1P3LC 3MGRA 3X1VB 1AOIA 5GXQC 5B0ZA 3RELB 5KDMA 3MGSD 5JRGD 3LELD 4R8PC 3O62B 1P3BB 2ZY2A 3A6ND 5CPJA 4ZUXC 1P3KD 3AV2C 3MGPB 3AN2C 1M19C 3H0MC 1F66B 4H9RA 4YS3B 3C1BB 3AZNC 1Q9CA 3WKJC 4G92B 1M1AA 3VH6W 4E45A 3AZIC 2NQBB 4G91C 3WAAB 4Z66B 1P3BA 1TZYB 3B6FA 3UTAC 3AFAD 5DNNB 2FFFB 1P3OD 1P3PA 3WA9C 2L5AA 3C1BA 2RVQD 5AVCA 3B6GB 5B2JB 5CPIB 1KX4B 4HGAC 1P34C 2NQBA 3WAAA 5CPKB 1TZYA 1EQZA 4XUJD 5B0YD 4QLCD 3AZLC 4WV4B 4KUDC 5CP6B 4NE3A 1P3AD 2NZDB 2UWXA 2HIOD 1S32B 3MGRD 4KGCB 1AOID 5B2JA 1KX4A 2VQRA 3B0BA 4H9OB 5B0ZD 2CWEA 5GSUC 5B24B 1P3IC 4LD9B 5CPJD 4H9NB 4KHAB 5B1MA 3X1UA 2FJ7A 3REIA 1S32A 3LJAB 2ZY4A 4KGCA 3AV1C 4J8XA 1M1AD 4H9OA 4WU8A 2G5IC 3AZGB 1P3BD 2Y2LA 3B6FD 4H9NA 5DNMC 1P3FC 1KX3B 3EPKA 3FDDA 2IO5C 3KXBB 1P3PD 5AV8A 1P3GC 3C1BD 5AY8C 3LJAA 3KWQC 5B33B 3LZ0B 5AVCD 1PZRA 3A1IA 4J8VC 3AZKA 2NQBD 3R45B 3WAAD 1BH9B 2ZY3A 4Z66D 2CV5A 1TZYD 1KX5C 1EQZD 3KUYB 1KX3A 5BO0A 3LELB 3AZHA 3UTBC 2BYMA 1ID3B 5GT0C 3LZ0A 5B40A 3C1CC 5B2JD 1KX4D 1T3UA 5BT1C 1TAFB 3REJA 4WU9C 1BH9A 4H9SC 1N1JA 3KUYA 5B1MD 3TU4B 3X1UD 2AROC 5AV5C 4JJNA 2FJ7D 3REID 3MGSC 3AFAB 5JRGC 1ID3A 1Z2CB 1S32D 1P3OB 4CAYB 3A6NC 1P3KC 4KGCD 4J8XD 1TAFA 4WU8D 3VH5W 3X1TC 1W2EA 5GT3A 1HTAA 3W97A 3TU4A 1M18B 5AV8D 5B31B 4XUJB 3LJAD 1P3AB 4YM6B 5C3IC 2HIOB 3EPHA 3AZKD 5AV9C 2CV5D 1HQ3A 1P3MC 3AZFC 3REHB 5KDMB 3UT9C 1KX3D 5BS7C 3X1SB 4NFTA 3AZHD 1M18A 2PYOA 5B31A 3REKB 4H9RB 3LZ0D 5B40D 4YM6A 3W98B 5B0YC 4QLCC 2Y2JA 3REJD 3MNNC 3B0DC 1M1AB 3AYWA 3MGRC 3REHA 3W99A 3KUYD 3AZJA 3X1SA 1BH8B 1AOIC 1BFMA 4JJND 3B6FB 3A1KA 2Y2KA 5B0ZC 5G49A 2Y2MA 5AV6A 4M6BA 1ID3D 5E5AC 3REKA 5B1LC 3W98A 5CPJC 3VH6A 1P3PB 2F8NB 1F1EA 4EO5C 5AVCB 3MVDA 1P3LA 5GT3D 3X1VC 3WKJB 1BH8A 2HUEB 3W97D 5GXQA 3TU4D 1EQZB 3RELC 2BG1A 3O62C 4ZUXA 1P3BC 5BNXA 3AV2A 2F8NA 1M19A 3AN2A 3MGPC 1F66C 4YS3C 1U35C 1HQ3D 3IP4C 4H9PA 3AZNA 3WKJA 4G92C 3AZIA 1M18D 2PYOD 2NQBC 5B31D 3P5JB 5B1MB 3X1UB 4Z66C 2FJ7B 3REIB 3UTAA 4YM6D 5DNNC 3WA9A 4J8XB 1WWIA 3AYWD 4H9QB 3W99D 4WU8B 3REHD 3AZJD 3X1SD 1ZLAB 3B0CT 3B6GC 1B6WA 5CPIC 2XD1A 1KX4C 1P34A 2JCHA 2DQNC 5AV6D 3REKD 5CPKC 3W98D 5AV8B 3H0LC 1H3OA 4KUDA 4UPKA 1A7WA 5CP6C 2Y2GA 2NZDC 1P3LD 1S32C 4H9QA 3AZKB 1ZLAA 4KGCC 2CV5B 5GXQD 4AWLC 5GSUA 5B24C 4LD9C 5BO0B 1P3KB 3AZHB 4E44A 4J8WB 4ZUXD 2BYMB 3AV2D 2F8ND 1M19D 3AN2D 2Y2PA 3W96B 5B40B 2J8PA 5FUGB 3LJAC 1ULYA 3REJB 3AZND 3AV1A 3WKJD 5AVBB 3AZID 5B2IB 1N1JB 4J8UB 3AZGC 3WTPB 4JJNB 4J8WA 3AZEC 3UTAD 1P3FA 2W8SA 3W96A 5B31G 3UTBB 3WA9D 3KXBC 1P3GA 5AY8A 3KFUG 5FUGA 5B33C 3LZ0C 4J8VA 3H0RC 5AVBA 5GT3B 4X23B 1P34D 5B2IA 4J8UA 4WNNA 3W97B 3WTPA 4Z5TB 3VH5A 4KUDD 3LELC 3UTBA 1KU5A 3AZMB 5GT0A 1ID3C 4ZBJB 3LZ1B 1ZLAD 1HQ3B 4X23A 5GSUD 2Y2IA 3VH6T 4H9SA 2PYOB 4Z5TA 2AROA 2YFVA 5AV5A 5B32B 3TU4C 3AZMA 3AFAC 1JFIA 1P3OC 3LZ1A 3AV1D 2JE5A 2RVQC 3AYWB 3W99B 2RIQA 3AZJB 3NQUB 3X1TA 4Z2MH 3MGQB 2JSSA 4J8WD 1P3FD 5G49B 5AV6B 3W96D 5B32A 1P3GD 1M18C 5AY8D 5B31C 5F99B 4XUJC 4XZQB 3MVDB 4YM6C 4J8VD 1P3AC 5AVBD 1P3LB 2HIOC 5B2ID 3NQUA 5AV9A 4J8UD 5GXQB 3WTPD 3MGQA 1P3MA 3AZFA 3UT9A 2Y2NA 3REHC 4CSRA 5BS7A 4R8PB 3X1SC 4NE6A 3UTBD 2Y2QA 4ZUXB 3NQJB 5BNXB 3AV2B 1M19B 3AN2B 2Y2OA 5F99A 5GT0D 2F2AC 3REKC 4XZQA 2ZM5A 3W98C 4EO5B 5BT1D 3AL0C 4X23D 3EG5B 3MNNA 4H9PB 3AZNB 1M1AC 2YFWA 3AZIB 4G91B 4R8PA 4Z5TD 2AROD 2ZY5A 5AV5D 3NQJA 3UTAB 3B6FC 3AZMD 3V9RB 5E5AA 1WWSA 5B1LA 3LZ1D 3WA9B 1P3PC 3WTPE 3C1BC 5AVCC 2BYKA 3X1TD 1U35B 4HGAB 1P34B 3X1VA 3WAAC 2HUEC 2G5HC 5B32D 1TZYC 1EQZC 3RELA 1H3OB 3V9RA 3AZLB 4KUDB 4WJ3C 3O62A 4DRAA 3KSYA 3MGPA 2F8NH 1F66A 5AV9D 4YS3A 1U35A 5B2JC 3MGQD 1P3IB 3AZFD 3UT9D 5GSUB 1P3MD 2F8NK 3AZLA 5B1MC 5F99D 5CHLB 4Z66A 3X1UC 2FJ7C 4NE5A 3F6TA 4XZQD 3MVDD 3REIC 5DNNA 4UUZB 3MNND 3AV1B 4Z2MG 3VH5T 4J8XC 1R4VA 1P3IA 4WU8C 3B6GA 4R8PD 1ZLAC 5CPIA 4DQYB 4AWLB 5JA4B 5DNMB 1P3FB 5E5AD 5CPKA 5B1LD 2IO5B 1P3GB 5AV8C 5AY8B 3KWQB 4UUZA 5CP6A 4J8VB 2NZDA 3AZKC 3X1VD 4WNNB 1KX5B 2CV5C 5JA4A 5DNMA 5B24A 3RELD 4LD9A 1KX3C 3AZHC 3O62D 4J8WC 3AZEB 5B32G 4KHAA 3MGPD 3KWQA 5GT0B 3W96C 1F66D 3C1CB 5B40C 4WZSB 4YS3D 1U35D 4WU9B 3REJC 5BNVB 5AVBC 1KX5A 5B2IC 3KUYC 3AZGA 4J8UC 3AZLD 2AROB 2YFVB 5AV5B 3WTPC 4JJNC 3AZEA 3MGSB 5JRGB 5DNND 1JFIB 3A6NB 3KXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C A;  1P3I D;  1B67 A;  5B33 A;  4WU9 A;  3B6G D;  3X1T B;  5CPI D;  5BNV A;  5GT3 C;  3B0C W;  4X23 C;  3R45 A;  5CPK D;  3W97 C;  3MGS A;  5JRG A;  3LEL A;  4Z5T C;  2F8N G;  3A6N A;  5C3I B;  5CP6 D;  1P3K A;  2NZD D;  3AZM C;  2LY8 A;  4ZBJ C;  5AV9 B;  3LZ1 C;  1P3M B;  1HQ3 C;  3UT9 B;  3AZF B;  5DNM D;  5B24 D;  4LD9 D;  4CSR B;  2PYO C;  3KWQ D;  5B32 C;  3AFA A;  5B0Y B;  4DRB A;  4QLC B;  1P3O A;  3MNN B;  4CAY A;  3B0D B;  1KX5 D;  3MGR B;  2YFW B;  3AYW C;  3W99 C;  1AOI B;  3AZG D;  3AZJ C;  3MGQ C;  5B0Z B;  3AZE D;  5E5A B;  5AV6 C;  5B1L B;  5CPJ B;  3KXB D;  3C1C D;  4XUJ A;  5B0Y A;  4QLC A;  5F99 C;  5B33 D;  4WU9 D;  1P3A A;  2BYK B;  4XZQ C;  3MVD C;  2HIO A;  1P3L C;  3MGR A;  3X1V B;  1AOI A;  5GXQ C;  5B0Z A;  3REL B;  5KDM A;  3MGS D;  5JRG D;  3LEL D;  4R8P C;  3O62 B;  1P3B B;  3A6N D;  5CPJ A;  4ZUX C;  1P3K D;  3AV2 C;  3MGP B;  3AN2 C;  1M19 C;  1F66 B;  4H9R A;  4YS3 B;  3C1B B;  3AZN C;  1Q9C A;  3WKJ C;  4G92 B;  1M1A A;  3VH6 W;  4E45 A;  3AZI C;  2NQB B;  4G91 C;  3WAA B;  4Z66 B;  1P3B A;  1TZY B;  3B6F A;  3UTA C;  3AFA D;  5DNN B;  1P3O D;  1P3P A;  3WA9 C;  2L5A A;  3C1B A;  2RVQ D;  5AVC A;  3B6G B;  5B2J B;  5CPI B;  1KX4 B;  4HGA C;  1P34 C;  2NQB A;  3WAA A;  5CPK B;  1TZY A;  1EQZ A;  4XUJ D;  5B0Y D;  4QLC D;  3AZL C;  4WV4 B;  4KUD C;  5CP6 B;  4NE3 A;  1P3A D;  2NZD B;  2HIO D;  1S32 B;  3MGR D;  4KGC B;  1AOI D;  5B2J A;  1KX4 A;  3B0B A;  5B0Z D;  4H9O B;  2CWE A;  5GSU C;  5B24 B;  1P3I C;  4LD9 B;  5CPJ D;  4H9N B;  4KHA B;  5B1M A;  3X1U A;  2FJ7 A;  3REI A;  1S32 A;  3LJA B;  4KGC A;  3AV1 C;  4J8X A;  1M1A D;  4H9O A;  4WU8 A;  3AZG B;  1P3B D;  3B6F D;  4H9N A;  5DNM C;  1P3F C;  1KX3 B;  2IO5 C;  3KXB B;  1P3P D;  5AV8 A;  1P3G C;  3C1B D;  5AY8 C;  3LJA A;  3KWQ C;  5B33 B;  3LZ0 B;  5AVC D;  4J8V C;  3AZK A;  2NQB D;  3R45 B;  3WAA D;  1BH9 B;  4Z66 D;  2CV5 A;  1TZY D;  1KX5 C;  1EQZ D;  3KUY B;  1KX3 A;  5BO0 A;  3LEL B;  3AZH A;  3UTB C;  2BYM A;  1ID3 B;  5GT0 C;  3LZ0 A;  5B40 A;  3C1C C;  5B2J D;  1KX4 D;  5BT1 C;  1TAF B;  3REJ A;  4WU9 C;  1BH9 A;  4H9S C;  1N1J A;  3KUY A;  5B1M D;  3TU4 B;  3X1U D;  2ARO C;  5AV5 C;  4JJN A;  2FJ7 D;  3REI D;  3MGS C;  3AFA B;  5JRG C;  1ID3 A;  1S32 D;  1P3O B;  4CAY B;  3A6N C;  1P3K C;  4KGC D;  4J8X D;  1TAF A;  4WU8 D;  3VH5 W;  3X1T C;  5GT3 A;  1HTA A;  3W97 A;  3TU4 A;  1M18 B;  5AV8 D;  5B31 B;  4XUJ B;  3LJA D;  1P3A B;  4YM6 B;  5C3I C;  2HIO B;  3AZK D;  5AV9 C;  2CV5 D;  1HQ3 A;  1P3M C;  3AZF C;  3REH B;  5KDM B;  3UT9 C;  1KX3 D;  5BS7 C;  3X1S B;  4NFT A;  3AZH D;  1M18 A;  2PYO A;  5B31 A;  3REK B;  4H9R B;  3LZ0 D;  5B40 D;  4YM6 A;  3W98 B;  5B0Y C;  4QLC C;  3REJ D;  3MNN C;  3B0D C;  1M1A B;  3AYW A;  3MGR C;  3REH A;  3W99 A;  3KUY D;  3AZJ A;  3X1S A;  1BH8 B;  1AOI C;  1BFM A;  4JJN D;  3B6F B;  5B0Z C;  5G49 A;  5AV6 A;  4M6B A;  1ID3 D;  5E5A C;  3REK A;  5B1L C;  3W98 A;  5CPJ C;  3VH6 A;  1P3P B;  2F8N B;  1F1E A;  4EO5 C;  5AVC B;  3MVD A;  1P3L A;  5GT3 D;  3X1V C;  3WKJ B;  1BH8 A;  2HUE B;  3W97 D;  5GXQ A;  3TU4 D;  1EQZ B;  3REL C;  3O62 C;  4ZUX A;  1P3B C;  5BNX A;  3AV2 A;  2F8N A;  1M19 A;  3AN2 A;  3MGP C;  1F66 C;  4YS3 C;  1U35 C;  1HQ3 D;  4H9P A;  3AZN A;  3WKJ A;  4G92 C;  3AZI A;  1M18 D;  2PYO D;  2NQB C;  5B31 D;  5B1M B;  3X1U B;  4Z66 C;  2FJ7 B;  3REI B;  3UTA A;  4YM6 D;  5DNN C;  3WA9 A;  4J8X B;  1WWI A;  3AYW D;  4H9Q B;  3W99 D;  4WU8 B;  3REH D;  3AZJ D;  3X1S D;  1ZLA B;  3B0C T;  3B6G C;  1B6W A;  5CPI C;  1KX4 C;  1P34 A;  5AV6 D;  3REK D;  5CPK C;  3W98 D;  5AV8 B;  1H3O A;  4KUD A;  1A7W A;  5CP6 C;  2NZD C;  1P3L D;  1S32 C;  4H9Q A;  3AZK B;  1ZLA A;  4KGC C;  2CV5 B;  5GXQ D;  4AWL C;  5GSU A;  5B24 C;  4LD9 C;  5BO0 B;  1P3K B;  3AZH B;  4E44 A;  4J8W B;  4ZUX D;  2BYM B;  3AV2 D;  2F8N D;  1M19 D;  3AN2 D;  3W96 B;  5B40 B;  5FUG B;  3LJA C;  1ULY A;  3REJ B;  3AZN D;  3AV1 A;  3WKJ D;  5AVB B;  3AZI D;  5B2I B;  1N1J B;  4J8U B;  3AZG C;  3WTP B;  4JJN B;  4J8W A;  3AZE C;  3UTA D;  1P3F A;  3W96 A;  5B31 G;  3UTB B;  3WA9 D;  3KXB C;  1P3G A;  5AY8 A;  5FUG A;  5B33 C;  3LZ0 C;  4J8V A;  5AVB A;  5GT3 B;  4X23 B;  1P34 D;  5B2I A;  4J8U A;  4WNN A;  3W97 B;  3WTP A;  4Z5T B;  3VH5 A;  4KUD D;  3LEL C;  3UTB A;  1KU5 A;  3AZM B;  5GT0 A;  1ID3 C;  4ZBJ B;  3LZ1 B;  1ZLA D;  1HQ3 B;  4X23 A;  5GSU D;  3VH6 T;  4H9S A;  2PYO B;  4Z5T A;  2ARO A;  2YFV A;  5AV5 A;  5B32 B;  3TU4 C;  3AZM A;  3AFA C;  1JFI A;  1P3O C;  3LZ1 A;  3AV1 D;  2RVQ C;  3AYW B;  3W99 B;  3AZJ B;  3NQU B;  3X1T A;  4Z2M H;  3MGQ B;  2JSS A;  4J8W D;  1P3F D;  5G49 B;  5AV6 B;  3W96 D;  5B32 A;  1P3G D;  1M18 C;  5AY8 D;  5B31 C;  5F99 B;  4XUJ C;  4XZQ B;  3MVD B;  4YM6 C;  4J8V D;  1P3A C;  5AVB D;  1P3L B;  2HIO C;  5B2I D;  3NQU A;  5AV9 A;  4J8U D;  5GXQ B;  3WTP D;  3MGQ A;  1P3M A;  3AZF A;  3UT9 A;  3REH C;  4CSR A;  5BS7 A;  4R8P B;  3X1S C;  4NE6 A;  3UTB D;  4ZUX B;  3NQJ B;  5BNX B;  3AV2 B;  1M19 B;  3AN2 B;  5F99 A;  5GT0 D;  3REK C;  4XZQ A;  3W98 C;  4EO5 B;  5BT1 D;  4X23 D;  3MNN A;  4H9P B;  3AZN B;  1M1A C;  2YFW A;  3AZI B;  4G91 B;  4R8P A;  4Z5T D;  2ARO D;  5AV5 D;  3NQJ A;  3UTA B;  3B6F C;  3AZM D;  3V9R B;  5E5A A;  1WWS A;  5B1L A;  3LZ1 D;  3WA9 B;  1P3P C;  3WTP E;  3C1B C;  5AVC C;  2BYK A;  3X1T D;  1U35 B;  4HGA B;  1P34 B;  3X1V A;  3WAA C;  2HUE C;  5B32 D;  1TZY C;  1EQZ C;  3REL A;  1H3O B;  3V9R A;  3AZL B;  4KUD B;  3O62 A;  4DRA A;  3KSY A;  3MGP A;  2F8N H;  1F66 A;  5AV9 D;  4YS3 A;  1U35 A;  5B2J C;  3MGQ D;  1P3I B;  3AZF D;  3UT9 D;  5GSU B;  1P3M D;  2F8N K;  3AZL A;  4Z66 A;  5B1M C;  5F99 D;  5CHL B;  3X1U C;  2FJ7 C;  4NE5 A;  3REI C;  4XZQ D;  3MVD D;  5DNN A;  4UUZ B;  3MNN D;  3AV1 B;  4Z2M G;  3VH5 T;  4J8X C;  1R4V A;  1P3I A;  4WU8 C;  3B6G A;  4R8P D;  1ZLA C;  5CPI A;  4AWL B;  5JA4 B;  5DNM B;  1P3F B;  5E5A D;  5CPK A;  5B1L D;  2IO5 B;  1P3G B;  5AV8 C;  5AY8 B;  3KWQ B;  4UUZ A;  5CP6 A;  4J8V B;  2NZD A;  3AZK C;  3X1V D;  4WNN B;  1KX5 B;  2CV5 C;  5JA4 A;  5DNM A;  5B24 A;  3REL D;  4LD9 A;  1KX3 C;  3AZH C;  3O62 D;  4J8W C;  3AZE B;  5B32 G;  4KHA A;  3MGP D;  3KWQ A;  5GT0 B;  3W96 C;  1F66 D;  3C1C B;  5B40 C;  4WZS B;  4YS3 D;  1U35 D;  4WU9 B;  3REJ C;  5BNV B;  5AVB C;  1KX5 A;  5B2I C;  3KUY C;  3AZG A;  4J8U C;  3AZL D;  2ARO B;  2YFV B;  5AV5 B;  3WTP C;  4JJN C;  3AZE A;  3MGS B;  5JRG B;  5DNN D;  1JFI B;  3A6N B;  3KXB A; 
#chains in the Genus database with same CATH topology
 3C1C A;  1P3I D;  1B67 A;  5B33 A;  4WU9 A;  3B6G D;  3X1T B;  5CPI D;  5BNV A;  3EPL A;  5GT3 C;  3B0C W;  4X23 C;  3R45 A;  5CPK D;  3W97 C;  3MGS A;  5JRG A;  3LEL A;  4Z5T C;  2F8N G;  3A6N A;  5C3I B;  5CP6 D;  1P3K A;  2NZD D;  3AZM C;  2LY8 A;  4ZBJ C;  5AV9 B;  3LZ1 C;  1P3M B;  1HQ3 C;  3UT9 B;  3AZF B;  5DNM D;  5B24 D;  4LD9 D;  4CSR B;  2PYO C;  3KWQ D;  5B32 C;  3AFA A;  5B0Y B;  4DRB A;  4QLC B;  1P3O A;  3MNN B;  4CAY A;  3B0D B;  1KX5 D;  3MGR B;  2Y2H A;  2XD5 A;  2YFW B;  3AYW C;  3W99 C;  1AOI B;  3AZG D;  3AZJ C;  3EPJ A;  3MGQ C;  5B0Z B;  3AZE D;  5E5A B;  5AV6 C;  5B1L B;  5CPJ B;  3KXB D;  3C1C D;  4XUJ A;  5B0Y A;  4QLC A;  5F99 C;  5B33 D;  4WU9 D;  1P3A A;  2BYK B;  4XZQ C;  2DF4 C;  2HIO A;  3MVD C;  1P3L C;  3MGR A;  3X1V B;  1AOI A;  5GXQ C;  5B0Z A;  3REL B;  5KDM A;  3MGS D;  5JRG D;  3LEL D;  4R8P C;  3O62 B;  1P3B B;  2ZY2 A;  3A6N D;  5CPJ A;  4ZUX C;  1P3K D;  3AV2 C;  3MGP B;  3AN2 C;  1M19 C;  3H0M C;  1F66 B;  4H9R A;  4YS3 B;  3C1B B;  3AZN C;  1Q9C A;  3WKJ C;  4G92 B;  1M1A A;  3VH6 W;  4E45 A;  3AZI C;  2NQB B;  4G91 C;  3WAA B;  4Z66 B;  1P3B A;  1TZY B;  3B6F A;  3UTA C;  3AFA D;  5DNN B;  2FFF B;  1P3O D;  1P3P A;  3WA9 C;  2L5A A;  3C1B A;  2RVQ D;  5AVC A;  3B6G B;  5B2J B;  5CPI B;  1KX4 B;  4HGA C;  1P34 C;  2NQB A;  3WAA A;  5CPK B;  1TZY A;  1EQZ A;  4XUJ D;  5B0Y D;  4QLC D;  3AZL C;  4WV4 B;  4KUD C;  5CP6 B;  4NE3 A;  1P3A D;  2NZD B;  2UWX A;  2HIO D;  1S32 B;  3MGR D;  4KGC B;  1AOI D;  5B2J A;  1KX4 A;  2VQR A;  3B0B A;  4H9O B;  5B0Z D;  2CWE A;  5GSU C;  5B24 B;  1P3I C;  4LD9 B;  5CPJ D;  4H9N B;  4KHA B;  5B1M A;  3X1U A;  2FJ7 A;  3REI A;  1S32 A;  3LJA B;  2ZY4 A;  4KGC A;  3AV1 C;  4J8X A;  1M1A D;  4H9O A;  4WU8 A;  2G5I C;  3AZG B;  1P3B D;  2Y2L A;  3B6F D;  4H9N A;  5DNM C;  1P3F C;  1KX3 B;  3EPK A;  3FDD A;  2IO5 C;  3KXB B;  1P3P D;  5AV8 A;  1P3G C;  3C1B D;  5AY8 C;  3LJA A;  3KWQ C;  5B33 B;  3LZ0 B;  5AVC D;  1PZR A;  3A1I A;  4J8V C;  3AZK A;  2NQB D;  3R45 B;  3WAA D;  1BH9 B;  2ZY3 A;  4Z66 D;  2CV5 A;  1TZY D;  1KX5 C;  1EQZ D;  3KUY B;  1KX3 A;  5BO0 A;  3LEL B;  3AZH A;  3UTB C;  2BYM A;  1ID3 B;  5GT0 C;  3LZ0 A;  5B40 A;  3C1C C;  5B2J D;  1KX4 D;  1T3U A;  5BT1 C;  1TAF B;  3REJ A;  4WU9 C;  1BH9 A;  4H9S C;  1N1J A;  3KUY A;  5B1M D;  3TU4 B;  3X1U D;  2ARO C;  5AV5 C;  4JJN A;  2FJ7 D;  3REI D;  3MGS C;  3AFA B;  5JRG C;  1ID3 A;  1Z2C B;  1S32 D;  1P3O B;  4CAY B;  3A6N C;  1P3K C;  4KGC D;  4J8X D;  1TAF A;  4WU8 D;  3VH5 W;  3X1T C;  1W2E A;  5GT3 A;  1HTA A;  3W97 A;  3TU4 A;  1M18 B;  5AV8 D;  5B31 B;  4XUJ B;  3LJA D;  1P3A B;  4YM6 B;  5C3I C;  2HIO B;  3EPH A;  3AZK D;  5AV9 C;  2CV5 D;  1HQ3 A;  1P3M C;  3AZF C;  3REH B;  5KDM B;  3UT9 C;  1KX3 D;  5BS7 C;  3X1S B;  4NFT A;  3AZH D;  1M18 A;  2PYO A;  5B31 A;  3REK B;  4H9R B;  3LZ0 D;  5B40 D;  4YM6 A;  3W98 B;  5B0Y C;  4QLC C;  2Y2J A;  3REJ D;  3MNN C;  3B0D C;  1M1A B;  3AYW A;  3MGR C;  3REH A;  3W99 A;  3KUY D;  3AZJ A;  3X1S A;  1BH8 B;  1AOI C;  1BFM A;  4JJN D;  3B6F B;  3A1K A;  2Y2K A;  5B0Z C;  5G49 A;  2Y2M A;  5AV6 A;  4M6B A;  1ID3 D;  5E5A C;  3REK A;  5B1L C;  3W98 A;  5CPJ C;  3VH6 A;  1P3P B;  2F8N B;  1F1E A;  4EO5 C;  5AVC B;  3MVD A;  1P3L A;  5GT3 D;  3X1V C;  3WKJ B;  1BH8 A;  2HUE B;  3W97 D;  5GXQ A;  3TU4 D;  1EQZ B;  3REL C;  2BG1 A;  3O62 C;  4ZUX A;  1P3B C;  5BNX A;  3AV2 A;  2F8N A;  1M19 A;  3AN2 A;  3MGP C;  1F66 C;  4YS3 C;  1U35 C;  1HQ3 D;  3IP4 C;  4H9P A;  3AZN A;  3WKJ A;  4G92 C;  3AZI A;  1M18 D;  2PYO D;  2NQB C;  5B31 D;  3P5J B;  5B1M B;  3X1U B;  4Z66 C;  2FJ7 B;  3REI B;  3UTA A;  4YM6 D;  5DNN C;  3WA9 A;  4J8X B;  1WWI A;  3AYW D;  4H9Q B;  3W99 D;  4WU8 B;  3REH D;  3AZJ D;  3X1S D;  1ZLA B;  3B0C T;  3B6G C;  1B6W A;  5CPI C;  2XD1 A;  1KX4 C;  1P34 A;  2JCH A;  2DQN C;  5AV6 D;  3REK D;  5CPK C;  3W98 D;  5AV8 B;  3H0L C;  1H3O A;  4KUD A;  4UPK A;  1A7W A;  5CP6 C;  2Y2G A;  2NZD C;  1P3L D;  1S32 C;  4H9Q A;  3AZK B;  1ZLA A;  4KGC C;  2CV5 B;  5GXQ D;  4AWL C;  5GSU A;  5B24 C;  4LD9 C;  5BO0 B;  1P3K B;  3AZH B;  4E44 A;  4J8W B;  4ZUX D;  2BYM B;  3AV2 D;  2F8N D;  1M19 D;  3AN2 D;  2Y2P A;  3W96 B;  5B40 B;  2J8P A;  5FUG B;  3LJA C;  1ULY A;  3REJ B;  3AZN D;  3AV1 A;  3WKJ D;  5AVB B;  3AZI D;  5B2I B;  1N1J B;  4J8U B;  3AZG C;  3WTP B;  4JJN B;  4J8W A;  3AZE C;  3UTA D;  1P3F A;  2W8S A;  3W96 A;  5B31 G;  3UTB B;  3WA9 D;  3KXB C;  1P3G A;  5AY8 A;  3KFU G;  5FUG A;  5B33 C;  3LZ0 C;  4J8V A;  3H0R C;  5AVB A;  5GT3 B;  4X23 B;  1P34 D;  5B2I A;  4J8U A;  4WNN A;  3W97 B;  3WTP A;  4Z5T B;  3VH5 A;  4KUD D;  3LEL C;  3UTB A;  1KU5 A;  3AZM B;  5GT0 A;  1ID3 C;  4ZBJ B;  3LZ1 B;  1ZLA D;  1HQ3 B;  4X23 A;  5GSU D;  2Y2I A;  3VH6 T;  4H9S A;  2PYO B;  4Z5T A;  2ARO A;  2YFV A;  5AV5 A;  5B32 B;  3TU4 C;  3AZM A;  3AFA C;  1JFI A;  1P3O C;  3LZ1 A;  3AV1 D;  2JE5 A;  2RVQ C;  3AYW B;  3W99 B;  2RIQ A;  3AZJ B;  3NQU B;  3X1T A;  4Z2M H;  3MGQ B;  2JSS A;  4J8W D;  1P3F D;  5G49 B;  5AV6 B;  3W96 D;  5B32 A;  1P3G D;  1M18 C;  5AY8 D;  5B31 C;  5F99 B;  4XUJ C;  4XZQ B;  3MVD B;  4YM6 C;  4J8V D;  1P3A C;  5AVB D;  1P3L B;  2HIO C;  5B2I D;  3NQU A;  5AV9 A;  4J8U D;  5GXQ B;  3WTP D;  3MGQ A;  1P3M A;  3AZF A;  3UT9 A;  2Y2N A;  3REH C;  4CSR A;  5BS7 A;  4R8P B;  3X1S C;  4NE6 A;  3UTB D;  2Y2Q A;  4ZUX B;  3NQJ B;  5BNX B;  3AV2 B;  1M19 B;  3AN2 B;  2Y2O A;  5F99 A;  5GT0 D;  2F2A C;  3REK C;  4XZQ A;  2ZM5 A;  3W98 C;  4EO5 B;  5BT1 D;  3AL0 C;  4X23 D;  3EG5 B;  3MNN A;  4H9P B;  3AZN B;  1M1A C;  2YFW A;  3AZI B;  4G91 B;  4R8P A;  4Z5T D;  2ARO D;  2ZY5 A;  5AV5 D;  3NQJ A;  3UTA B;  3B6F C;  3AZM D;  3V9R B;  5E5A A;  1WWS A;  5B1L A;  3LZ1 D;  3WA9 B;  1P3P C;  3WTP E;  3C1B C;  5AVC C;  2BYK A;  3X1T D;  1U35 B;  4HGA B;  1P34 B;  3X1V A;  3WAA C;  2HUE C;  2G5H C;  5B32 D;  1TZY C;  1EQZ C;  3REL A;  1H3O B;  3V9R A;  3AZL B;  4KUD B;  4WJ3 C;  3O62 A;  4DRA A;  3KSY A;  3MGP A;  2F8N H;  1F66 A;  5AV9 D;  4YS3 A;  1U35 A;  5B2J C;  3MGQ D;  1P3I B;  3AZF D;  3UT9 D;  5GSU B;  1P3M D;  2F8N K;  3AZL A;  5B1M C;  5F99 D;  5CHL B;  4Z66 A;  3X1U C;  2FJ7 C;  4NE5 A;  3F6T A;  4XZQ D;  3MVD D;  3REI C;  5DNN A;  4UUZ B;  3MNN D;  3AV1 B;  4Z2M G;  3VH5 T;  4J8X C;  1R4V A;  1P3I A;  4WU8 C;  3B6G A;  4R8P D;  1ZLA C;  5CPI A;  4DQY B;  4AWL B;  5JA4 B;  5DNM B;  1P3F B;  5E5A D;  5CPK A;  5B1L D;  2IO5 B;  1P3G B;  5AV8 C;  5AY8 B;  3KWQ B;  4UUZ A;  5CP6 A;  4J8V B;  2NZD A;  3AZK C;  3X1V D;  4WNN B;  1KX5 B;  2CV5 C;  5JA4 A;  5DNM A;  5B24 A;  3REL D;  4LD9 A;  1KX3 C;  3AZH C;  3O62 D;  4J8W C;  3AZE B;  5B32 G;  4KHA A;  3MGP D;  3KWQ A;  5GT0 B;  3W96 C;  1F66 D;  3C1C B;  5B40 C;  4WZS B;  4YS3 D;  1U35 D;  4WU9 B;  3REJ C;  5BNV B;  5AVB C;  1KX5 A;  5B2I C;  3KUY C;  3AZG A;  4J8U C;  3AZL D;  2ARO B;  2YFV B;  5AV5 B;  3WTP C;  4JJN C;  3AZE A;  3MGS B;  5JRG B;  5DNN D;  1JFI B;  3A6N B;  3KXB A; 
#chains in the Genus database with same CATH homology
 3C1C A;  1P3I D;  1B67 A;  5B33 A;  4WU9 A;  3B6G D;  3X1T B;  5CPI D;  5BNV A;  3EPL A;  5GT3 C;  3B0C W;  4X23 C;  3R45 A;  5CPK D;  3W97 C;  3MGS A;  5JRG A;  3LEL A;  4Z5T C;  2F8N G;  3A6N A;  5C3I B;  5CP6 D;  1P3K A;  2NZD D;  3AZM C;  2LY8 A;  4ZBJ C;  5AV9 B;  3LZ1 C;  1P3M B;  1HQ3 C;  3UT9 B;  3AZF B;  5DNM D;  5B24 D;  4LD9 D;  4CSR B;  2PYO C;  3KWQ D;  5B32 C;  3AFA A;  5B0Y B;  4DRB A;  4QLC B;  1P3O A;  3MNN B;  4CAY A;  3B0D B;  1KX5 D;  3MGR B;  2Y2H A;  2XD5 A;  2YFW B;  3AYW C;  3W99 C;  1AOI B;  3AZG D;  3AZJ C;  3EPJ A;  3MGQ C;  5B0Z B;  3AZE D;  5E5A B;  5AV6 C;  5B1L B;  5CPJ B;  3KXB D;  3C1C D;  4XUJ A;  5B0Y A;  4QLC A;  5F99 C;  5B33 D;  4WU9 D;  1P3A A;  2BYK B;  4XZQ C;  2DF4 C;  2HIO A;  3MVD C;  1P3L C;  3MGR A;  3X1V B;  1AOI A;  5GXQ C;  5B0Z A;  3REL B;  5KDM A;  3MGS D;  5JRG D;  3LEL D;  4R8P C;  3O62 B;  1P3B B;  2ZY2 A;  3A6N D;  5CPJ A;  4ZUX C;  1P3K D;  3AV2 C;  3MGP B;  3AN2 C;  1M19 C;  3H0M C;  1F66 B;  4H9R A;  4YS3 B;  3C1B B;  3AZN C;  1Q9C A;  3WKJ C;  4G92 B;  1M1A A;  3VH6 W;  4E45 A;  3AZI C;  2NQB B;  4G91 C;  3WAA B;  4Z66 B;  1P3B A;  1TZY B;  3B6F A;  3UTA C;  3AFA D;  5DNN B;  2FFF B;  1P3O D;  1P3P A;  3WA9 C;  2L5A A;  3C1B A;  2RVQ D;  5AVC A;  3B6G B;  5B2J B;  5CPI B;  1KX4 B;  4HGA C;  1P34 C;  2NQB A;  3WAA A;  5CPK B;  1TZY A;  1EQZ A;  4XUJ D;  5B0Y D;  4QLC D;  3AZL C;  4WV4 B;  4KUD C;  5CP6 B;  4NE3 A;  1P3A D;  2NZD B;  2UWX A;  2HIO D;  1S32 B;  3MGR D;  4KGC B;  1AOI D;  5B2J A;  1KX4 A;  2VQR A;  3B0B A;  4H9O B;  5B0Z D;  2CWE A;  5GSU C;  5B24 B;  1P3I C;  4LD9 B;  5CPJ D;  4H9N B;  4KHA B;  5B1M A;  3X1U A;  2FJ7 A;  3REI A;  1S32 A;  3LJA B;  2ZY4 A;  4KGC A;  3AV1 C;  4J8X A;  1M1A D;  4H9O A;  4WU8 A;  2G5I C;  3AZG B;  1P3B D;  2Y2L A;  3B6F D;  4H9N A;  5DNM C;  1P3F C;  1KX3 B;  3EPK A;  3FDD A;  2IO5 C;  3KXB B;  1P3P D;  5AV8 A;  1P3G C;  3C1B D;  5AY8 C;  3LJA A;  3KWQ C;  5B33 B;  3LZ0 B;  5AVC D;  1PZR A;  3A1I A;  4J8V C;  3AZK A;  2NQB D;  3R45 B;  3WAA D;  1BH9 B;  2ZY3 A;  4Z66 D;  2CV5 A;  1TZY D;  1KX5 C;  1EQZ D;  3KUY B;  1KX3 A;  5BO0 A;  3LEL B;  3AZH A;  3UTB C;  2BYM A;  1ID3 B;  5GT0 C;  3LZ0 A;  5B40 A;  3C1C C;  5B2J D;  1KX4 D;  1T3U A;  5BT1 C;  1TAF B;  3REJ A;  4WU9 C;  1BH9 A;  4H9S C;  1N1J A;  3KUY A;  5B1M D;  3TU4 B;  3X1U D;  2ARO C;  5AV5 C;  4JJN A;  2FJ7 D;  3REI D;  3MGS C;  3AFA B;  5JRG C;  1ID3 A;  1Z2C B;  1S32 D;  1P3O B;  4CAY B;  3A6N C;  1P3K C;  4KGC D;  4J8X D;  1TAF A;  4WU8 D;  3VH5 W;  3X1T C;  1W2E A;  5GT3 A;  1HTA A;  3W97 A;  3TU4 A;  1M18 B;  5AV8 D;  5B31 B;  4XUJ B;  3LJA D;  1P3A B;  4YM6 B;  5C3I C;  2HIO B;  3EPH A;  3AZK D;  5AV9 C;  2CV5 D;  1HQ3 A;  1P3M C;  3AZF C;  3REH B;  5KDM B;  3UT9 C;  1KX3 D;  5BS7 C;  3X1S B;  4NFT A;  3AZH D;  1M18 A;  2PYO A;  5B31 A;  3REK B;  4H9R B;  3LZ0 D;  5B40 D;  4YM6 A;  3W98 B;  5B0Y C;  4QLC C;  2Y2J A;  3REJ D;  3MNN C;  3B0D C;  1M1A B;  3AYW A;  3MGR C;  3REH A;  3W99 A;  3KUY D;  3AZJ A;  3X1S A;  1BH8 B;  1AOI C;  1BFM A;  4JJN D;  3B6F B;  3A1K A;  2Y2K A;  5B0Z C;  5G49 A;  2Y2M A;  5AV6 A;  4M6B A;  1ID3 D;  5E5A C;  3REK A;  5B1L C;  3W98 A;  5CPJ C;  3VH6 A;  1P3P B;  2F8N B;  1F1E A;  4EO5 C;  5AVC B;  3MVD A;  1P3L A;  5GT3 D;  3X1V C;  3WKJ B;  1BH8 A;  2HUE B;  3W97 D;  5GXQ A;  3TU4 D;  1EQZ B;  3REL C;  2BG1 A;  3O62 C;  4ZUX A;  1P3B C;  5BNX A;  3AV2 A;  2F8N A;  1M19 A;  3AN2 A;  3MGP C;  1F66 C;  4YS3 C;  1U35 C;  1HQ3 D;  3IP4 C;  4H9P A;  3AZN A;  3WKJ A;  4G92 C;  3AZI A;  1M18 D;  2PYO D;  2NQB C;  5B31 D;  3P5J B;  5B1M B;  3X1U B;  4Z66 C;  2FJ7 B;  3REI B;  3UTA A;  4YM6 D;  5DNN C;  3WA9 A;  4J8X B;  1WWI A;  3AYW D;  4H9Q B;  3W99 D;  4WU8 B;  3REH D;  3AZJ D;  3X1S D;  1ZLA B;  3B0C T;  3B6G C;  1B6W A;  5CPI C;  2XD1 A;  1KX4 C;  1P34 A;  2JCH A;  2DQN C;  5AV6 D;  3REK D;  5CPK C;  3W98 D;  5AV8 B;  3H0L C;  1H3O A;  4KUD A;  4UPK A;  1A7W A;  5CP6 C;  2Y2G A;  2NZD C;  1P3L D;  1S32 C;  4H9Q A;  3AZK B;  1ZLA A;  4KGC C;  2CV5 B;  5GXQ D;  4AWL C;  5GSU A;  5B24 C;  4LD9 C;  5BO0 B;  1P3K B;  3AZH B;  4E44 A;  4J8W B;  4ZUX D;  2BYM B;  3AV2 D;  2F8N D;  1M19 D;  3AN2 D;  2Y2P A;  3W96 B;  5B40 B;  2J8P A;  5FUG B;  3LJA C;  1ULY A;  3REJ B;  3AZN D;  3AV1 A;  3WKJ D;  5AVB B;  3AZI D;  5B2I B;  1N1J B;  4J8U B;  3AZG C;  3WTP B;  4JJN B;  4J8W A;  3AZE C;  3UTA D;  1P3F A;  2W8S A;  3W96 A;  5B31 G;  3UTB B;  3WA9 D;  3KXB C;  1P3G A;  5AY8 A;  3KFU G;  5FUG A;  5B33 C;  3LZ0 C;  4J8V A;  3H0R C;  5AVB A;  5GT3 B;  4X23 B;  1P34 D;  5B2I A;  4J8U A;  4WNN A;  3W97 B;  3WTP A;  4Z5T B;  3VH5 A;  4KUD D;  3LEL C;  3UTB A;  1KU5 A;  3AZM B;  5GT0 A;  1ID3 C;  4ZBJ B;  3LZ1 B;  1ZLA D;  1HQ3 B;  4X23 A;  5GSU D;  2Y2I A;  3VH6 T;  4H9S A;  2PYO B;  4Z5T A;  2ARO A;  2YFV A;  5AV5 A;  5B32 B;  3TU4 C;  3AZM A;  3AFA C;  1JFI A;  1P3O C;  3LZ1 A;  3AV1 D;  2JE5 A;  2RVQ C;  3AYW B;  3W99 B;  2RIQ A;  3AZJ B;  3NQU B;  3X1T A;  4Z2M H;  3MGQ B;  2JSS A;  4J8W D;  1P3F D;  5G49 B;  5AV6 B;  3W96 D;  5B32 A;  1P3G D;  1M18 C;  5AY8 D;  5B31 C;  5F99 B;  4XUJ C;  4XZQ B;  3MVD B;  4YM6 C;  4J8V D;  1P3A C;  5AVB D;  1P3L B;  2HIO C;  5B2I D;  3NQU A;  5AV9 A;  4J8U D;  5GXQ B;  3WTP D;  3MGQ A;  1P3M A;  3AZF A;  3UT9 A;  2Y2N A;  3REH C;  4CSR A;  5BS7 A;  4R8P B;  3X1S C;  4NE6 A;  3UTB D;  2Y2Q A;  4ZUX B;  3NQJ B;  5BNX B;  3AV2 B;  1M19 B;  3AN2 B;  2Y2O A;  5F99 A;  5GT0 D;  2F2A C;  3REK C;  4XZQ A;  2ZM5 A;  3W98 C;  4EO5 B;  5BT1 D;  3AL0 C;  4X23 D;  3EG5 B;  3MNN A;  4H9P B;  3AZN B;  1M1A C;  2YFW A;  3AZI B;  4G91 B;  4R8P A;  4Z5T D;  2ARO D;  2ZY5 A;  5AV5 D;  3NQJ A;  3UTA B;  3B6F C;  3AZM D;  3V9R B;  5E5A A;  1WWS A;  5B1L A;  3LZ1 D;  3WA9 B;  1P3P C;  3WTP E;  3C1B C;  5AVC C;  2BYK A;  3X1T D;  1U35 B;  4HGA B;  1P34 B;  3X1V A;  3WAA C;  2HUE C;  2G5H C;  5B32 D;  1TZY C;  1EQZ C;  3REL A;  1H3O B;  3V9R A;  3AZL B;  4KUD B;  4WJ3 C;  3O62 A;  4DRA A;  3KSY A;  3MGP A;  2F8N H;  1F66 A;  5AV9 D;  4YS3 A;  1U35 A;  5B2J C;  3MGQ D;  1P3I B;  3AZF D;  3UT9 D;  5GSU B;  1P3M D;  2F8N K;  3AZL A;  5B1M C;  5F99 D;  5CHL B;  4Z66 A;  3X1U C;  2FJ7 C;  4NE5 A;  3F6T A;  4XZQ D;  3MVD D;  3REI C;  5DNN A;  4UUZ B;  3MNN D;  3AV1 B;  4Z2M G;  3VH5 T;  4J8X C;  1R4V A;  1P3I A;  4WU8 C;  3B6G A;  4R8P D;  1ZLA C;  5CPI A;  4DQY B;  4AWL B;  5JA4 B;  5DNM B;  1P3F B;  5E5A D;  5CPK A;  5B1L D;  2IO5 B;  1P3G B;  5AV8 C;  5AY8 B;  3KWQ B;  4UUZ A;  5CP6 A;  4J8V B;  2NZD A;  3AZK C;  3X1V D;  4WNN B;  1KX5 B;  2CV5 C;  5JA4 A;  5DNM A;  5B24 A;  3REL D;  4LD9 A;  1KX3 C;  3AZH C;  3O62 D;  4J8W C;  3AZE B;  5B32 G;  4KHA A;  3MGP D;  3KWQ A;  5GT0 B;  3W96 C;  1F66 D;  3C1C B;  5B40 C;  4WZS B;  4YS3 D;  1U35 D;  4WU9 B;  3REJ C;  5BNV B;  5AVB C;  1KX5 A;  5B2I C;  3KUY C;  3AZG A;  4J8U C;  3AZL D;  2ARO B;  2YFV B;  5AV5 B;  3WTP C;  4JJN C;  3AZE A;  3MGS B;  5JRG B;  5DNN D;  1JFI B;  3A6N B;  3KXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...