1P3GA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gA00
3WA9D 2BYKA 5FUGB 3MNNC 3UTBB 5GT0B 2NQBB 4UUZB 5GXQD 4J8VD 5CPJA 1P3AB 5BO0B 4AWLC 3AZLC 1KX3C 3TU4D 5F99C 1ZLAA 3AV1C 4LD9B 1TAFB 1BH8B 4Z5TA 4G91B 3WTPD 1ID3D 4XUJC 2AROD 3B0BA 3R45B 4H9SC 5GSUD 3AZIA 4QLCA 1S32B 3MGSD 2FJ7B 1AOIC 3C1CA 3REHB 4YM6D 1M18B 4E45A 3NQUA 5AV6D 5B31D 5AV9C 3X1VC 5B1LB 3MGPD 3AYWA 3LZ0B 3LELA 1KX4C 2BYKB 2PYOC 5CP6D 1P3IC 1M1AC 5CPJB 3X1UA 2HUEB 3AZFC 4ZUXC 3C1BA 3WA9C 1ZLAB 1P3PB 5GT0D 4Z5TB 5GXQC 1P3AD 1WWIA 5G49A 3WAAC 3TU4C 5CPIA 3AZIB 4QLCB 2IO5B 3RELA 1Q9CA 3B0CW 3C1CB 1M19A 4LD9D 5B40A 4WU9C 3WTPC 5B2JA 1ID3C 3O62A 4EO5B 2AROC 5GSUC 3REKB 3NQUB 1S32D 3MGSC 1P34A 3AYWB 3REHD 2L5AA 4YM6C 1F1EA 1M18D 4NE6A 3X1UB 5AV6C 3MGPC 5B1LD 3MVDA 4CSRA 1KX5A 3C1BB 4YS3A 4WU8A 5CP6C 4G92C 1EQZC 4J8WA 5G49B 5CPIB 4WV4B 3RELB 3X1TC 3VH6W 5BT1D 1ZLAD 1P3PD 1M19B 4Z5TD 5B40B 1P3AC 5B2JB 2F8NA 2F8NH 1P3FC 3AZID 4QLCD 1F66A 3W99A 1P34B 3AZEA 4LD9C 4G91C 5B0YD 3W97A 3REKD 1S32C 3MVDB 4CSRB 3KWQD 3AYWD 1KX5B 3B6FA 3REHC 4Z2MG 4YS3B 4WU8B 3AZMA 3X1SC 3X1UD 4J8WB 5B1LC 3C1BD 4H9PA 5B33A 5AVBC 3MGRA 1BH9A 2F8NB 1HQ3A 5CPID 4Z66A 3KXBA 3RELD 1F66B 5BT1C 1ZLAC 1P3PC 3W99B 1M19D 3AZEB 5B40D 5AV5B 5B2JD 3UT9A 5B0ZA 4X23A 4H9NA 3REIA 1U35A 3W97B 3AZIC 4QLCC 4CAYA 1P34D 1BFMA 3B6FB 5B0YC 3AZMB 4EO5C 3AZKA 5B32A 3REKC 5AY8A 3MVDD 3AFAC 1KX5D 3KWQC 3AYWC 5AV8C 3B6GA 5DNNA 4H9PB 3REJA 5B33B 4YS3D 4WU8D 3LZ1D 3X1UC 3MGRB 4J8WD 1BH9B 4R8PA 1HQ3B 4Z66B 3KXBB 4J8XA 3C1BC 4KUDA 3UT9B 5B0ZB 4X23B 4H9NB 3REIB 2F8ND 4J8UA 1U35B 5CPIC 5C3IB 5GT3A 3RELC 1F66D 3W99D 4CAYB 4HGAB 3AZED 1M19C 5B40C 5AV5D 4JJNA 4H9QA 3AZKB 3W97D 5B32B 3B0DB 5AY8B 1R4VA 3VH5T 3VH5A 3B6FD 5BNVA 2CV5C 3V9RA 3B6GB 5DNNB 3REJB 3AZMD 3WTPE 5B2IC 1P3MA 4KGCA 4R8PB 3MVDC 1P3KA 4WZSB 3UTBD 1KX5C 4E44A 4J8XB 2NQBD 5B33D 4NE5A 4KUDB 4YS3C 4WU8C 4J8VC 3LZ1C 3MGRD 4J8WC 1HQ3D 5JRGA 4J8UB 5GT3B 3KXBD 3AZJA 4H9RA 1P3BA 3MNNA 4ZBJC 3UT9D 4JJNB 5B0ZD 4X23D 3REID 1U35D 4H9QB 2FJ7D 3W99C 3LELB 5BNVB 3V9RB 3AZEC 3W96A 5AV5C 1B67A 5AVCA 3AZKD 5B31C 3AZHA 5B32D 1P3MB 3W97C 5AY8D 3UTAA 1HTAA 3LZ0D 1P3KB 5B1MA 3B6GD 5BS7C 3REJD 2F8NK 1P3GA 3AZMC 4M6BA 5CPJD 1TZYA 4NE3A 4R8PD 5JRGB 5AV9A 1P3LA 1P3OA 3AZGA 3UTBC 4J8XD 1B6WA 3AN2A 3AZJB 5GT0C 4KUDD 5B33C 4H9RB 1P3BB 2NQBC 3MNNB 3O62B 3MGRC 4H9OA 3W98A 4J8UD 3KXBC 3C1CD 4ZUXA 3AZFA 3W96B 4JJND 3UT9C 5GXQA 5AVCB 4X23C 3REIC 1KU5A 1U35C 5C3IC 3AZHB 5BNXA 2FJ7C 3WAAA 3UTAB 3LELD 5CPKA 5B1MB 1M18C 1P3GB 4WU9A 1TZYB 3AZKC 1P3MD 5B32C 3AZNA 3LZ0C 5AV9B 1P3KD 1P3LB 1P3OB 3B0CT 3MGQA 3AZGB 3AN2B 2RVQD 4YM6A 5CPJC 2BYMA 2HUEC 2NZDA 4H9OB 4R8PC 5JRGD 5AV6A 3W98B 5DNMA 4J8XC 3AZFB 4ZUXB 4KUDC 2HIOA 2JSSA 4Z5TC 3MNND 3A6NA 3O62D 5GXQB 1EQZA 2IO5C 4J8UC 5E5AA 5BNXB 3WAAB 3X1TA 3C1CC 5CPKB 3VH5W 3W96D 4JJNC 5AVCD 4WU9B 3AZHD 1P3FA 3AZNB 3UTAD 3LELC 5B1MD 3MGQB 4NFTA 1P3GD 4YM6B 1TZYD 1P3MC 2BYMB 4XZQA 2NZDB 5AV6B 5AV9D 5DNMB 1P3LD 3AZGD 1P3OD 3AN2D 3LJAA 2HIOB 3A6NB 4DRBA 2RVQC 3AV2A 3X1SA 3W98D 1EQZB 5JA4A 5E5AB 3AZFD 4ZUXD 3KUYA 3X1TB 5B2JC 3O62C 4Z2MH 5AVBA 1JFIA 2YFVA 5B24A 1P3FB 1ULYA 3WAAD 1P34C 5CPKD 1P3PA 3W96C 4WU9D 5AVCC 3AZHC 3AZND 4XZQB 3UTAC 4DRAA 5B1MC 3MGQD 3LJAB 1P3GC 2F8NG 5B0YA 1TZYC 3AV2B 3X1SB 2NZDD 3WKJA 3REKA 4Z66D 5DNMD 1P3LC 1P3OC 5JA4B 3AFAA 3AZGC 3AN2C 3KWQA 5AV8A 3KUYB 2HIOD 3A6ND 3KSYA 5B31G 5AVBB 3AZLA 1KX3A 1JFIB 1F66C 1EQZD 3W98C 5F99A 2YFVB 5E5AD 5B24B 3X1TD 3AV1A 4XUJA 4H9SA 4KGCB 1P3FD 3B6FC 1AOIA 5DNND 5CPKC 5B0YB 3NQJA 3AZNC 4XZQD 3X1VA 3WKJB 3AFAB 3MGQC 1KX4A 3KWQB 2CV5A 5AV8B 2PYOA 3LJAD 1P3IA 4WNNA 5B2IA 1M1AA 3AV2D 1HQ3C 3X1SD 2NZDC 4AWLB 1A7WA 5GT3D 4Z66C 3AZLB 1KX3B 5DNMC 5F99B 3WA9A 2YFWA 3KUYD 3AV1B 2HIOC 3A6NC 5B0ZC 4J8VA 5B32G 4XUJB 5AVBD 3LZ1A 3TU4A 5B24D 5E5AC 4HGAC 1AOIB 5KDMA 3WTPA 4KHAA 1ID3A 2AROA 3B0DC 3NQJB 5AY8C 5GSUA 4KGCD 3MGSA 3X1VB 1N1JA 3B6GC 5DNNC 3REJC 1KX4B 2CV5B 2PYOB 5AV5A 1P3IB 4WNNB 5B2IB 1M1AB 5CHLB 5B31A 3MGPA 4XZQC 3WKJD 3AZJD 3AFAD 1H3OA 1P3BD 5AV8D 3WA9B 2YFWB 5BS7A 3LJAC 5CP6A 4J8VB 3AV2C 3AZLD 5GT3C 3LZ1B 1KX3D 3TU4B 5F99D 5FUGA 3UTBA 3KUYC 3AV1D 5GT0A 2NQBA 4UUZA 5KDMB 1WWSA 3WTPB 4KHAB 1P3AA 4XUJD 4ZBJB 1ID3B 5BO0A 2AROB 3VH6A 3VH6T 5GSUB 5B24C 3MGSB 1N1JB 1AOID 2LY8A 4LD9A 1TAFA 1BH8A 3R45A 4KGCC 1S32A 5B31B 3MGPB 3X1VD 1P3KC 2FJ7A 1H3OB 1KX4D 3REHA 2CV5D 2CWEA 2PYOD 5CP6B 1M18A 1P3ID 4G92B 5B2ID 1M1AD 5JRGC 3WKJC 5B1LA 3AZJC 3LZ0A 1P3BC
chains in the Genus database with same CATH superfamily
2XD5A 3WA9D 2BYKA 5FUGB 3MNNC 3UTBB 5GT0B 2NQBB 2Y2NA 4UUZB 5GXQD 4J8VD 5CPJA 1P3AB 5BO0B 4AWLC 3AZLC 1KX3C 3TU4D 5F99C 1ZLAA 3AV1C 4LD9B 1TAFB 1BH8B 4Z5TA 4G91B 3WTPD 1ID3D 4XUJC 2AROD 3B0BA 3R45B 4H9SC 5GSUD 3AZIA 4QLCA 1S32B 3MGSD 2FJ7B 1AOIC 3C1CA 3REHB 4YM6D 1M18B 4DQYB 4E45A 3NQUA 5AV6D 5B31D 5AV9C 3X1VC 5B1LB 1T3UA 3MGPD 3AYWA 3LZ0B 3LELA 1KX4C 2BYKB 3EPLA 2PYOC 2VQRA 5CP6D 1P3IC 1M1AC 5CPJB 3X1UA 2HUEB 3EPKA 3AZFC 4ZUXC 3C1BA 2BG1A 3WA9C 1ZLAB 1P3PB 5GT0D 4Z5TB 5GXQC 1P3AD 1WWIA 3KFUG 5G49A 3WAAC 3TU4C 5CPIA 3AZIB 2JE5A 2IO5B 4QLCB 3RELA 1Q9CA 3B0CW 3C1CB 1M19A 4LD9D 5B40A 4WU9C 3WTPC 5B2JA 2JCHA 3O62A 4EO5B 1ID3C 2AROC 5GSUC 3REKB 3NQUB 1S32D 3MGSC 1P34A 3AYWB 3REHD 2L5AA 4YM6C 1F1EA 1M18D 4NE6A 3X1UB 5AV6C 3MGPC 5B1LD 3MVDA 4CSRA 1KX5A 3C1BB 4YS3A 4WU8A 5CP6C 4G92C 1EQZC 4J8WA 5G49B 5CPIB 4WV4B 3RELB 3X1TC 3VH6W 5BT1D 1ZLAD 1P3PD 1M19B 4Z5TD 5B40B 1P3AC 5B2JB 2F8NA 2F8NH 1P3FC 3AZID 4QLCD 1F66A 2DQNC 3W99A 1P34B 3AZEA 4LD9C 4G91C 5B0YD 3FDDA 3W97A 3REKD 1S32C 3H0LC 3MVDB 4CSRB 3KWQD 3AYWD 1KX5B 2Y2PA 3B6FA 3REHC 2ZY5A 4Z2MG 4YS3B 4WU8B 3AZMA 3X1SC 3X1UD 4J8WB 2Y2IA 5B1LC 2Y2MA 3C1BD 4H9PA 5B33A 5AVBC 3MGRA 1BH9A 2F8NB 1HQ3A 5CPID 4Z66A 3KXBA 3RELD 1F66B 5BT1C 1ZLAC 1P3PC 3W99B 1M19D 3AZEB 5B40D 5AV5B 5B2JD 3UT9A 5B0ZA 4X23A 4H9NA 3REIA 1U35A 2Y2JA 3W97B 3AZIC 4QLCC 4CAYA 1P34D 1BFMA 3B6FB 5B0YC 3AZMB 4EO5C 3AZKA 5B32A 3REKC 5AY8A 3A1IA 3MVDD 3AFAC 1KX5D 3KWQC 3AYWC 5AV8C 3B6GA 5DNNA 4H9PB 3REJA 5B33B 4YS3D 4WU8D 3AL0C 3H0MC 3LZ1D 3X1UC 3MGRB 4J8WD 1BH9B 4R8PA 1HQ3B 2Y2KA 4Z66B 3KXBB 4J8XA 3C1BC 4KUDA 2J8PA 2Y2LA 3UT9B 5B0ZB 4X23B 4H9NB 3REIB 2F8ND 4J8UA 1U35B 5CPIC 5C3IB 1W2EA 5GT3A 3RELC 1F66D 3W99D 4CAYB 4HGAB 3AZED 1M19C 5B40C 5AV5D 4JJNA 4H9QA 3AZKB 3W97D 5B32B 3B0DB 5AY8B 1R4VA 3VH5T 3VH5A 3B6FD 5BNVA 2CV5C 2W8SA 3V9RA 3B6GB 5DNNB 3REJB 3AZMD 3WTPE 5B2IC 1P3MA 4KGCA 4R8PB 3MVDC 1P3KA 4WZSB 3UTBD 2DF4C 1KX5C 4E44A 4J8XB 3EPHA 2NQBD 5B33D 4NE5A 4KUDB 4YS3C 4WU8C 4J8VC 3LZ1C 3MGRD 4J8WC 1HQ3D 5JRGA 4J8UB 5GT3B 3KXBD 3AZJA 4H9RA 1P3BA 3MNNA 2XD1A 4ZBJC 3UT9D 4JJNB 5B0ZD 4X23D 3REID 1U35D 4H9QB 3H0RC 2FJ7D 3W99C 3LELB 5BNVB 3V9RB 3AZEC 3W96A 5AV5C 1B67A 5AVCA 3AZKD 5B31C 3AZHA 5B32D 1P3MB 3W97C 5AY8D 3UTAA 1HTAA 3LZ0D 1P3KB 4WJ3C 2G5HC 5B1MA 3B6GD 5BS7C 3REJD 2F8NK 1P3GA 3AZMC 4M6BA 5CPJD 1TZYA 4NE3A 4R8PD 5JRGB 5AV9A 1P3LA 1P3OA 3AZGA 3UTBC 4J8XD 1B6WA 3AN2A 3AZJB 5GT0C 4KUDD 5B33C 4H9RB 1P3BB 2NQBC 3MNNB 3P5JB 3O62B 3MGRC 4H9OA 3W98A 4J8UD 3KXBC 3C1CD 4ZUXA 3AZFA 3W96B 4JJND 3UT9C 5GXQA 5AVCB 4X23C 3REIC 1KU5A 1U35C 5C3IC 3AZHB 5BNXA 2FJ7C 3WAAA 3UTAB 2G5IC 2RIQA 3LELD 5CPKA 5B1MB 1M18C 1P3GB 4WU9A 1TZYB 3AZKC 1P3MD 5B32C 3AZNA 3LZ0C 5AV9B 1P3KD 1P3LB 1P3OB 3B0CT 3MGQA 3AZGB 3AN2B 2RVQD 4YM6A 5CPJC 2ZY3A 2BYMA 2HUEC 2NZDA 4H9OB 4R8PC 5JRGD 5AV6A 3W98B 3A1KA 5DNMA 4J8XC 3AZFB 4ZUXB 4KUDC 2HIOA 2JSSA 4Z5TC 3MNND 3A6NA 2F2AC 2ZY2A 3O62D 5GXQB 1EQZA 2IO5C 4J8UC 5E5AA 5BNXB 3WAAB 3X1TA 3C1CC 5CPKB 3VH5W 2ZM5A 3W96D 4JJNC 5AVCD 4WU9B 3AZHD 1P3FA 3AZNB 3UTAD 3LELC 5B1MD 3MGQB 4NFTA 1P3GD 4YM6B 1TZYD 1P3MC 2BYMB 4XZQA 2NZDB 5AV6B 5AV9D 5DNMB 1P3LD 3AZGD 1P3OD 3AN2D 3LJAA 2HIOB 3A6NB 4DRBA 2RVQC 3AV2A 3X1SA 3W98D 1EQZB 5JA4A 5E5AB 3AZFD 4ZUXD 3KUYA 3X1TB 5B2JC 3O62C 4Z2MH 5AVBA 1JFIA 2YFVA 5B24A 1P3FB 1ULYA 3WAAD 1P34C 5CPKD 1P3PA 3W96C 2Y2GA 4WU9D 5AVCC 2UWXA 2Y2QA 3AZHC 3AZND 4XZQB 3UTAC 4DRAA 5B1MC 3MGQD 3LJAB 1P3GC 2F8NG 5B0YA 1TZYC 3AV2B 3X1SB 2NZDD 3WKJA 3REKA 4Z66D 5DNMD 1Z2CB 1P3LC 1P3OC 5JA4B 2ZY4A 3AFAA 3AZGC 3AN2C 3KWQA 5AV8A 3KUYB 2HIOD 3A6ND 4UPKA 3KSYA 5B31G 5AVBB 3AZLA 1KX3A 1JFIB 1F66C 1EQZD 3W98C 5F99A 2YFVB 5E5AD 5B24B 3X1TD 3AV1A 4XUJA 4H9SA 4KGCB 1P3FD 3B6FC 1AOIA 5DNND 5CPKC 5B0YB 3NQJA 3AZNC 4XZQD 3X1VA 3WKJB 3AFAB 3MGQC 1KX4A 3KWQB 2CV5A 5AV8B 2PYOA 3LJAD 1P3IA 4WNNA 5B2IA 1M1AA 3AV2D 1HQ3C 3X1SD 2NZDC 4AWLB 1A7WA 5GT3D 4Z66C 3AZLB 1KX3B 5DNMC 5F99B 3WA9A 2YFWA 3KUYD 3AV1B 2HIOC 3A6NC 5B0ZC 4J8VA 5B32G 4XUJB 5AVBD 3LZ1A 3TU4A 5B24D 5E5AC 4HGAC 1AOIB 5KDMA 3WTPA 4KHAA 1ID3A 2AROA 3B0DC 3NQJB 5AY8C 5GSUA 4KGCD 3MGSA 3X1VB 1N1JA 3B6GC 5DNNC 3REJC 1KX4B 2CV5B 2PYOB 3F6TA 5AV5A 2FFFB 1P3IB 4WNNB 5B2IB 1M1AB 5CHLB 5B31A 3MGPA 4XZQC 3WKJD 3AZJD 3AFAD 1H3OA 1P3BD 5AV8D 3WA9B 2YFWB 5BS7A 3LJAC 5CP6A 4J8VB 3AV2C 3AZLD 5GT3C 3LZ1B 1KX3D 3TU4B 5F99D 1PZRA 5FUGA 3UTBA 3EG5B 3KUYC 3AV1D 5GT0A 2NQBA 4UUZA 5KDMB 1WWSA 3WTPB 4KHAB 1P3AA 4XUJD 4ZBJB 1ID3B 5BO0A 2AROB 2Y2OA 3VH6A 3VH6T 5GSUB 5B24C 3MGSB 1N1JB 1AOID 2LY8A 4LD9A 1TAFA 1BH8A 3R45A 4KGCC 1S32A 5B31B 3MGPB 3X1VD 1P3KC 2FJ7A 1H3OB 1KX4D 3REHA 2CV5D 2CWEA 2PYOD 3EPJA 5CP6B 1M18A 1P3ID 4G92B 5B2ID 1M1AD 5JRGC 3WKJC 5B1LA 3AZJC 3IP4C 2Y2HA 3LZ0A 1P3BC
chains in the Genus database with same CATH topology
2XD5A 3WA9D 2BYKA 5FUGB 3MNNC 3UTBB 5GT0B 2NQBB 2Y2NA 4UUZB 5GXQD 4J8VD 5CPJA 1P3AB 5BO0B 4AWLC 3AZLC 1KX3C 3TU4D 5F99C 1ZLAA 3AV1C 4LD9B 1TAFB 1BH8B 4Z5TA 4G91B 3WTPD 1ID3D 4XUJC 2AROD 3B0BA 3R45B 4H9SC 5GSUD 3AZIA 4QLCA 1S32B 3MGSD 2FJ7B 1AOIC 3C1CA 3REHB 4YM6D 1M18B 4DQYB 4E45A 3NQUA 5AV6D 5B31D 5AV9C 3X1VC 5B1LB 1T3UA 3MGPD 3AYWA 3LZ0B 3LELA 1KX4C 2BYKB 3EPLA 2PYOC 2VQRA 5CP6D 1P3IC 1M1AC 5CPJB 3X1UA 2HUEB 3EPKA 3AZFC 4ZUXC 3C1BA 2BG1A 3WA9C 1ZLAB 1P3PB 5GT0D 4Z5TB 5GXQC 1P3AD 1WWIA 3KFUG 5G49A 3WAAC 3TU4C 5CPIA 3AZIB 2JE5A 2IO5B 4QLCB 3RELA 1Q9CA 3B0CW 3C1CB 1M19A 4LD9D 5B40A 4WU9C 3WTPC 5B2JA 2JCHA 3O62A 4EO5B 1ID3C 2AROC 5GSUC 3REKB 3NQUB 1S32D 3MGSC 1P34A 3AYWB 3REHD 2L5AA 4YM6C 1F1EA 1M18D 4NE6A 3X1UB 5AV6C 3MGPC 5B1LD 3MVDA 4CSRA 1KX5A 3C1BB 4YS3A 4WU8A 5CP6C 4G92C 1EQZC 4J8WA 5G49B 5CPIB 4WV4B 3RELB 3X1TC 3VH6W 5BT1D 1ZLAD 1P3PD 1M19B 4Z5TD 5B40B 1P3AC 5B2JB 2F8NA 2F8NH 1P3FC 3AZID 4QLCD 1F66A 2DQNC 3W99A 1P34B 3AZEA 4LD9C 4G91C 5B0YD 3FDDA 3W97A 3REKD 1S32C 3H0LC 3MVDB 4CSRB 3KWQD 3AYWD 1KX5B 2Y2PA 3B6FA 3REHC 2ZY5A 4Z2MG 4YS3B 4WU8B 3AZMA 3X1SC 3X1UD 4J8WB 2Y2IA 5B1LC 2Y2MA 3C1BD 4H9PA 5B33A 5AVBC 3MGRA 1BH9A 2F8NB 1HQ3A 5CPID 4Z66A 3KXBA 3RELD 1F66B 5BT1C 1ZLAC 1P3PC 3W99B 1M19D 3AZEB 5B40D 5AV5B 5B2JD 3UT9A 5B0ZA 4X23A 4H9NA 3REIA 1U35A 2Y2JA 3W97B 3AZIC 4QLCC 4CAYA 1P34D 1BFMA 3B6FB 5B0YC 3AZMB 4EO5C 3AZKA 5B32A 3REKC 5AY8A 3A1IA 3MVDD 3AFAC 1KX5D 3KWQC 3AYWC 5AV8C 3B6GA 5DNNA 4H9PB 3REJA 5B33B 4YS3D 4WU8D 3AL0C 3H0MC 3LZ1D 3X1UC 3MGRB 4J8WD 1BH9B 4R8PA 1HQ3B 2Y2KA 4Z66B 3KXBB 4J8XA 3C1BC 4KUDA 2J8PA 2Y2LA 3UT9B 5B0ZB 4X23B 4H9NB 3REIB 2F8ND 4J8UA 1U35B 5CPIC 5C3IB 1W2EA 5GT3A 3RELC 1F66D 3W99D 4CAYB 4HGAB 3AZED 1M19C 5B40C 5AV5D 4JJNA 4H9QA 3AZKB 3W97D 5B32B 3B0DB 5AY8B 1R4VA 3VH5T 3VH5A 3B6FD 5BNVA 2CV5C 2W8SA 3V9RA 3B6GB 5DNNB 3REJB 3AZMD 3WTPE 5B2IC 1P3MA 4KGCA 4R8PB 3MVDC 1P3KA 4WZSB 3UTBD 2DF4C 1KX5C 4E44A 4J8XB 3EPHA 2NQBD 5B33D 4NE5A 4KUDB 4YS3C 4WU8C 4J8VC 3LZ1C 3MGRD 4J8WC 1HQ3D 5JRGA 4J8UB 5GT3B 3KXBD 3AZJA 4H9RA 1P3BA 3MNNA 2XD1A 4ZBJC 3UT9D 4JJNB 5B0ZD 4X23D 3REID 1U35D 4H9QB 3H0RC 2FJ7D 3W99C 3LELB 5BNVB 3V9RB 3AZEC 3W96A 5AV5C 1B67A 5AVCA 3AZKD 5B31C 3AZHA 5B32D 1P3MB 3W97C 5AY8D 3UTAA 1HTAA 3LZ0D 1P3KB 4WJ3C 2G5HC 5B1MA 3B6GD 5BS7C 3REJD 2F8NK 1P3GA 3AZMC 4M6BA 5CPJD 1TZYA 4NE3A 4R8PD 5JRGB 5AV9A 1P3LA 1P3OA 3AZGA 3UTBC 4J8XD 1B6WA 3AN2A 3AZJB 5GT0C 4KUDD 5B33C 4H9RB 1P3BB 2NQBC 3MNNB 3P5JB 3O62B 3MGRC 4H9OA 3W98A 4J8UD 3KXBC 3C1CD 4ZUXA 3AZFA 3W96B 4JJND 3UT9C 5GXQA 5AVCB 4X23C 3REIC 1KU5A 1U35C 5C3IC 3AZHB 5BNXA 2FJ7C 3WAAA 3UTAB 2G5IC 2RIQA 3LELD 5CPKA 5B1MB 1M18C 1P3GB 4WU9A 1TZYB 3AZKC 1P3MD 5B32C 3AZNA 3LZ0C 5AV9B 1P3KD 1P3LB 1P3OB 3B0CT 3MGQA 3AZGB 3AN2B 2RVQD 4YM6A 5CPJC 2ZY3A 2BYMA 2HUEC 2NZDA 4H9OB 4R8PC 5JRGD 5AV6A 3W98B 3A1KA 5DNMA 4J8XC 3AZFB 4ZUXB 4KUDC 2HIOA 2JSSA 4Z5TC 3MNND 3A6NA 2F2AC 2ZY2A 3O62D 5GXQB 1EQZA 2IO5C 4J8UC 5E5AA 5BNXB 3WAAB 3X1TA 3C1CC 5CPKB 3VH5W 2ZM5A 3W96D 4JJNC 5AVCD 4WU9B 3AZHD 1P3FA 3AZNB 3UTAD 3LELC 5B1MD 3MGQB 4NFTA 1P3GD 4YM6B 1TZYD 1P3MC 2BYMB 4XZQA 2NZDB 5AV6B 5AV9D 5DNMB 1P3LD 3AZGD 1P3OD 3AN2D 3LJAA 2HIOB 3A6NB 4DRBA 2RVQC 3AV2A 3X1SA 3W98D 1EQZB 5JA4A 5E5AB 3AZFD 4ZUXD 3KUYA 3X1TB 5B2JC 3O62C 4Z2MH 5AVBA 1JFIA 2YFVA 5B24A 1P3FB 1ULYA 3WAAD 1P34C 5CPKD 1P3PA 3W96C 2Y2GA 4WU9D 5AVCC 2UWXA 2Y2QA 3AZHC 3AZND 4XZQB 3UTAC 4DRAA 5B1MC 3MGQD 3LJAB 1P3GC 2F8NG 5B0YA 1TZYC 3AV2B 3X1SB 2NZDD 3WKJA 3REKA 4Z66D 5DNMD 1Z2CB 1P3LC 1P3OC 5JA4B 2ZY4A 3AFAA 3AZGC 3AN2C 3KWQA 5AV8A 3KUYB 2HIOD 3A6ND 4UPKA 3KSYA 5B31G 5AVBB 3AZLA 1KX3A 1JFIB 1F66C 1EQZD 3W98C 5F99A 2YFVB 5E5AD 5B24B 3X1TD 3AV1A 4XUJA 4H9SA 4KGCB 1P3FD 3B6FC 1AOIA 5DNND 5CPKC 5B0YB 3NQJA 3AZNC 4XZQD 3X1VA 3WKJB 3AFAB 3MGQC 1KX4A 3KWQB 2CV5A 5AV8B 2PYOA 3LJAD 1P3IA 4WNNA 5B2IA 1M1AA 3AV2D 1HQ3C 3X1SD 2NZDC 4AWLB 1A7WA 5GT3D 4Z66C 3AZLB 1KX3B 5DNMC 5F99B 3WA9A 2YFWA 3KUYD 3AV1B 2HIOC 3A6NC 5B0ZC 4J8VA 5B32G 4XUJB 5AVBD 3LZ1A 3TU4A 5B24D 5E5AC 4HGAC 1AOIB 5KDMA 3WTPA 4KHAA 1ID3A 2AROA 3B0DC 3NQJB 5AY8C 5GSUA 4KGCD 3MGSA 3X1VB 1N1JA 3B6GC 5DNNC 3REJC 1KX4B 2CV5B 2PYOB 3F6TA 5AV5A 2FFFB 1P3IB 4WNNB 5B2IB 1M1AB 5CHLB 5B31A 3MGPA 4XZQC 3WKJD 3AZJD 3AFAD 1H3OA 1P3BD 5AV8D 3WA9B 2YFWB 5BS7A 3LJAC 5CP6A 4J8VB 3AV2C 3AZLD 5GT3C 3LZ1B 1KX3D 3TU4B 5F99D 1PZRA 5FUGA 3UTBA 3EG5B 3KUYC 3AV1D 5GT0A 2NQBA 4UUZA 5KDMB 1WWSA 3WTPB 4KHAB 1P3AA 4XUJD 4ZBJB 1ID3B 5BO0A 2AROB 2Y2OA 3VH6A 3VH6T 5GSUB 5B24C 3MGSB 1N1JB 1AOID 2LY8A 4LD9A 1TAFA 1BH8A 3R45A 4KGCC 1S32A 5B31B 3MGPB 3X1VD 1P3KC 2FJ7A 1H3OB 1KX4D 3REHA 2CV5D 2CWEA 2PYOD 3EPJA 5CP6B 1M18A 1P3ID 4G92B 5B2ID 1M1AD 5JRGC 3WKJC 5B1LA 3AZJC 3IP4C 2Y2HA 3LZ0A 1P3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 D;  2BYK A;  5FUG B;  3MNN C;  3UTB B;  5GT0 B;  2NQB B;  4UUZ B;  5GXQ D;  4J8V D;  5CPJ A;  1P3A B;  5BO0 B;  4AWL C;  3AZL C;  1KX3 C;  3TU4 D;  5F99 C;  1ZLA A;  3AV1 C;  4LD9 B;  1TAF B;  1BH8 B;  4Z5T A;  4G91 B;  3WTP D;  1ID3 D;  4XUJ C;  2ARO D;  3B0B A;  3R45 B;  4H9S C;  5GSU D;  3AZI A;  4QLC A;  1S32 B;  3MGS D;  2FJ7 B;  1AOI C;  3C1C A;  3REH B;  4YM6 D;  1M18 B;  4E45 A;  3NQU A;  5AV6 D;  5B31 D;  5AV9 C;  3X1V C;  5B1L B;  3MGP D;  3AYW A;  3LZ0 B;  3LEL A;  1KX4 C;  2BYK B;  2PYO C;  5CP6 D;  1P3I C;  1M1A C;  5CPJ B;  3X1U A;  2HUE B;  3AZF C;  4ZUX C;  3C1B A;  3WA9 C;  1ZLA B;  1P3P B;  5GT0 D;  4Z5T B;  5GXQ C;  1P3A D;  1WWI A;  5G49 A;  3WAA C;  3TU4 C;  5CPI A;  3AZI B;  4QLC B;  2IO5 B;  3REL A;  1Q9C A;  3B0C W;  3C1C B;  1M19 A;  4LD9 D;  5B40 A;  4WU9 C;  3WTP C;  5B2J A;  1ID3 C;  3O62 A;  4EO5 B;  2ARO C;  5GSU C;  3REK B;  3NQU B;  1S32 D;  3MGS C;  1P34 A;  3AYW B;  3REH D;  2L5A A;  4YM6 C;  1F1E A;  1M18 D;  4NE6 A;  3X1U B;  5AV6 C;  3MGP C;  5B1L D;  3MVD A;  4CSR A;  1KX5 A;  3C1B B;  4YS3 A;  4WU8 A;  5CP6 C;  4G92 C;  1EQZ C;  4J8W A;  5G49 B;  5CPI B;  4WV4 B;  3REL B;  3X1T C;  3VH6 W;  5BT1 D;  1ZLA D;  1P3P D;  1M19 B;  4Z5T D;  5B40 B;  1P3A C;  5B2J B;  2F8N A;  2F8N H;  1P3F C;  3AZI D;  4QLC D;  1F66 A;  3W99 A;  1P34 B;  3AZE A;  4LD9 C;  4G91 C;  5B0Y D;  3W97 A;  3REK D;  1S32 C;  3MVD B;  4CSR B;  3KWQ D;  3AYW D;  1KX5 B;  3B6F A;  3REH C;  4Z2M G;  4YS3 B;  4WU8 B;  3AZM A;  3X1S C;  3X1U D;  4J8W B;  5B1L C;  3C1B D;  4H9P A;  5B33 A;  5AVB C;  3MGR A;  1BH9 A;  2F8N B;  1HQ3 A;  5CPI D;  4Z66 A;  3KXB A;  3REL D;  1F66 B;  5BT1 C;  1ZLA C;  1P3P C;  3W99 B;  1M19 D;  3AZE B;  5B40 D;  5AV5 B;  5B2J D;  3UT9 A;  5B0Z A;  4X23 A;  4H9N A;  3REI A;  1U35 A;  3W97 B;  3AZI C;  4QLC C;  4CAY A;  1P34 D;  1BFM A;  3B6F B;  5B0Y C;  3AZM B;  4EO5 C;  3AZK A;  5B32 A;  3REK C;  5AY8 A;  3MVD D;  3AFA C;  1KX5 D;  3KWQ C;  3AYW C;  5AV8 C;  3B6G A;  5DNN A;  4H9P B;  3REJ A;  5B33 B;  4YS3 D;  4WU8 D;  3LZ1 D;  3X1U C;  3MGR B;  4J8W D;  1BH9 B;  4R8P A;  1HQ3 B;  4Z66 B;  3KXB B;  4J8X A;  3C1B C;  4KUD A;  3UT9 B;  5B0Z B;  4X23 B;  4H9N B;  3REI B;  2F8N D;  4J8U A;  1U35 B;  5CPI C;  5C3I B;  5GT3 A;  3REL C;  1F66 D;  3W99 D;  4CAY B;  4HGA B;  3AZE D;  1M19 C;  5B40 C;  5AV5 D;  4JJN A;  4H9Q A;  3AZK B;  3W97 D;  5B32 B;  3B0D B;  5AY8 B;  1R4V A;  3VH5 T;  3VH5 A;  3B6F D;  5BNV A;  2CV5 C;  3V9R A;  3B6G B;  5DNN B;  3REJ B;  3AZM D;  3WTP E;  5B2I C;  1P3M A;  4KGC A;  4R8P B;  3MVD C;  1P3K A;  4WZS B;  3UTB D;  1KX5 C;  4E44 A;  4J8X B;  2NQB D;  5B33 D;  4NE5 A;  4KUD B;  4YS3 C;  4WU8 C;  4J8V C;  3LZ1 C;  3MGR D;  4J8W C;  1HQ3 D;  5JRG A;  4J8U B;  5GT3 B;  3KXB D;  3AZJ A;  4H9R A;  1P3B A;  3MNN A;  4ZBJ C;  3UT9 D;  4JJN B;  5B0Z D;  4X23 D;  3REI D;  1U35 D;  4H9Q B;  2FJ7 D;  3W99 C;  3LEL B;  5BNV B;  3V9R B;  3AZE C;  3W96 A;  5AV5 C;  1B67 A;  5AVC A;  3AZK D;  5B31 C;  3AZH A;  5B32 D;  1P3M B;  3W97 C;  5AY8 D;  3UTA A;  1HTA A;  3LZ0 D;  1P3K B;  5B1M A;  3B6G D;  5BS7 C;  3REJ D;  2F8N K;  1P3G A;  3AZM C;  4M6B A;  5CPJ D;  1TZY A;  4NE3 A;  4R8P D;  5JRG B;  5AV9 A;  1P3L A;  1P3O A;  3AZG A;  3UTB C;  4J8X D;  1B6W A;  3AN2 A;  3AZJ B;  5GT0 C;  4KUD D;  5B33 C;  4H9R B;  1P3B B;  2NQB C;  3MNN B;  3O62 B;  3MGR C;  4H9O A;  3W98 A;  4J8U D;  3KXB C;  3C1C D;  4ZUX A;  3AZF A;  3W96 B;  4JJN D;  3UT9 C;  5GXQ A;  5AVC B;  4X23 C;  3REI C;  1KU5 A;  1U35 C;  5C3I C;  3AZH B;  5BNX A;  2FJ7 C;  3WAA A;  3UTA B;  3LEL D;  5CPK A;  5B1M B;  1M18 C;  1P3G B;  4WU9 A;  1TZY B;  3AZK C;  1P3M D;  5B32 C;  3AZN A;  3LZ0 C;  5AV9 B;  1P3K D;  1P3L B;  1P3O B;  3B0C T;  3MGQ A;  3AZG B;  3AN2 B;  2RVQ D;  4YM6 A;  5CPJ C;  2BYM A;  2HUE C;  2NZD A;  4H9O B;  4R8P C;  5JRG D;  5AV6 A;  3W98 B;  5DNM A;  4J8X C;  3AZF B;  4ZUX B;  4KUD C;  2HIO A;  2JSS A;  4Z5T C;  3MNN D;  3A6N A;  3O62 D;  5GXQ B;  1EQZ A;  2IO5 C;  4J8U C;  5E5A A;  5BNX B;  3WAA B;  3X1T A;  3C1C C;  5CPK B;  3VH5 W;  3W96 D;  4JJN C;  5AVC D;  4WU9 B;  3AZH D;  1P3F A;  3AZN B;  3UTA D;  3LEL C;  5B1M D;  3MGQ B;  4NFT A;  1P3G D;  4YM6 B;  1TZY D;  1P3M C;  2BYM B;  4XZQ A;  2NZD B;  5AV6 B;  5AV9 D;  5DNM B;  1P3L D;  3AZG D;  1P3O D;  3AN2 D;  3LJA A;  2HIO B;  3A6N B;  4DRB A;  2RVQ C;  3AV2 A;  3X1S A;  3W98 D;  1EQZ B;  5JA4 A;  5E5A B;  3AZF D;  4ZUX D;  3KUY A;  3X1T B;  5B2J C;  3O62 C;  4Z2M H;  5AVB A;  1JFI A;  2YFV A;  5B24 A;  1P3F B;  1ULY A;  3WAA D;  1P34 C;  5CPK D;  1P3P A;  3W96 C;  4WU9 D;  5AVC C;  3AZH C;  3AZN D;  4XZQ B;  3UTA C;  4DRA A;  5B1M C;  3MGQ D;  3LJA B;  1P3G C;  2F8N G;  5B0Y A;  1TZY C;  3AV2 B;  3X1S B;  2NZD D;  3WKJ A;  3REK A;  4Z66 D;  5DNM D;  1P3L C;  1P3O C;  5JA4 B;  3AFA A;  3AZG C;  3AN2 C;  3KWQ A;  5AV8 A;  3KUY B;  2HIO D;  3A6N D;  3KSY A;  5B31 G;  5AVB B;  3AZL A;  1KX3 A;  1JFI B;  1F66 C;  1EQZ D;  3W98 C;  5F99 A;  2YFV B;  5E5A D;  5B24 B;  3X1T D;  3AV1 A;  4XUJ A;  4H9S A;  4KGC B;  1P3F D;  3B6F C;  1AOI A;  5DNN D;  5CPK C;  5B0Y B;  3NQJ A;  3AZN C;  4XZQ D;  3X1V A;  3WKJ B;  3AFA B;  3MGQ C;  1KX4 A;  3KWQ B;  2CV5 A;  5AV8 B;  2PYO A;  3LJA D;  1P3I A;  4WNN A;  5B2I A;  1M1A A;  3AV2 D;  1HQ3 C;  3X1S D;  2NZD C;  4AWL B;  1A7W A;  5GT3 D;  4Z66 C;  3AZL B;  1KX3 B;  5DNM C;  5F99 B;  3WA9 A;  2YFW A;  3KUY D;  3AV1 B;  2HIO C;  3A6N C;  5B0Z C;  4J8V A;  5B32 G;  4XUJ B;  5AVB D;  3LZ1 A;  3TU4 A;  5B24 D;  5E5A C;  4HGA C;  1AOI B;  5KDM A;  3WTP A;  4KHA A;  1ID3 A;  2ARO A;  3B0D C;  3NQJ B;  5AY8 C;  5GSU A;  4KGC D;  3MGS A;  3X1V B;  1N1J A;  3B6G C;  5DNN C;  3REJ C;  1KX4 B;  2CV5 B;  2PYO B;  5AV5 A;  1P3I B;  4WNN B;  5B2I B;  1M1A B;  5CHL B;  5B31 A;  3MGP A;  4XZQ C;  3WKJ D;  3AZJ D;  3AFA D;  1H3O A;  1P3B D;  5AV8 D;  3WA9 B;  2YFW B;  5BS7 A;  3LJA C;  5CP6 A;  4J8V B;  3AV2 C;  3AZL D;  5GT3 C;  3LZ1 B;  1KX3 D;  3TU4 B;  5F99 D;  5FUG A;  3UTB A;  3KUY C;  3AV1 D;  5GT0 A;  2NQB A;  4UUZ A;  5KDM B;  1WWS A;  3WTP B;  4KHA B;  1P3A A;  4XUJ D;  4ZBJ B;  1ID3 B;  5BO0 A;  2ARO B;  3VH6 A;  3VH6 T;  5GSU B;  5B24 C;  3MGS B;  1N1J B;  1AOI D;  2LY8 A;  4LD9 A;  1TAF A;  1BH8 A;  3R45 A;  4KGC C;  1S32 A;  5B31 B;  3MGP B;  3X1V D;  1P3K C;  2FJ7 A;  1H3O B;  1KX4 D;  3REH A;  2CV5 D;  2CWE A;  2PYO D;  5CP6 B;  1M18 A;  1P3I D;  4G92 B;  5B2I D;  1M1A D;  5JRG C;  3WKJ C;  5B1L A;  3AZJ C;  3LZ0 A;  1P3B C; 
#chains in the Genus database with same CATH topology
 2XD5 A;  3WA9 D;  2BYK A;  5FUG B;  3MNN C;  3UTB B;  5GT0 B;  2NQB B;  2Y2N A;  4UUZ B;  5GXQ D;  4J8V D;  5CPJ A;  1P3A B;  5BO0 B;  4AWL C;  3AZL C;  1KX3 C;  3TU4 D;  5F99 C;  1ZLA A;  3AV1 C;  4LD9 B;  1TAF B;  1BH8 B;  4Z5T A;  4G91 B;  3WTP D;  1ID3 D;  4XUJ C;  2ARO D;  3B0B A;  3R45 B;  4H9S C;  5GSU D;  3AZI A;  4QLC A;  1S32 B;  3MGS D;  2FJ7 B;  1AOI C;  3C1C A;  3REH B;  4YM6 D;  1M18 B;  4DQY B;  4E45 A;  3NQU A;  5AV6 D;  5B31 D;  5AV9 C;  3X1V C;  5B1L B;  1T3U A;  3MGP D;  3AYW A;  3LZ0 B;  3LEL A;  1KX4 C;  2BYK B;  3EPL A;  2PYO C;  2VQR A;  5CP6 D;  1P3I C;  1M1A C;  5CPJ B;  3X1U A;  2HUE B;  3EPK A;  3AZF C;  4ZUX C;  3C1B A;  2BG1 A;  3WA9 C;  1ZLA B;  1P3P B;  5GT0 D;  4Z5T B;  5GXQ C;  1P3A D;  1WWI A;  3KFU G;  5G49 A;  3WAA C;  3TU4 C;  5CPI A;  3AZI B;  2JE5 A;  2IO5 B;  4QLC B;  3REL A;  1Q9C A;  3B0C W;  3C1C B;  1M19 A;  4LD9 D;  5B40 A;  4WU9 C;  3WTP C;  5B2J A;  2JCH A;  3O62 A;  4EO5 B;  1ID3 C;  2ARO C;  5GSU C;  3REK B;  3NQU B;  1S32 D;  3MGS C;  1P34 A;  3AYW B;  3REH D;  2L5A A;  4YM6 C;  1F1E A;  1M18 D;  4NE6 A;  3X1U B;  5AV6 C;  3MGP C;  5B1L D;  3MVD A;  4CSR A;  1KX5 A;  3C1B B;  4YS3 A;  4WU8 A;  5CP6 C;  4G92 C;  1EQZ C;  4J8W A;  5G49 B;  5CPI B;  4WV4 B;  3REL B;  3X1T C;  3VH6 W;  5BT1 D;  1ZLA D;  1P3P D;  1M19 B;  4Z5T D;  5B40 B;  1P3A C;  5B2J B;  2F8N A;  2F8N H;  1P3F C;  3AZI D;  4QLC D;  1F66 A;  2DQN C;  3W99 A;  1P34 B;  3AZE A;  4LD9 C;  4G91 C;  5B0Y D;  3FDD A;  3W97 A;  3REK D;  1S32 C;  3H0L C;  3MVD B;  4CSR B;  3KWQ D;  3AYW D;  1KX5 B;  2Y2P A;  3B6F A;  3REH C;  2ZY5 A;  4Z2M G;  4YS3 B;  4WU8 B;  3AZM A;  3X1S C;  3X1U D;  4J8W B;  2Y2I A;  5B1L C;  2Y2M A;  3C1B D;  4H9P A;  5B33 A;  5AVB C;  3MGR A;  1BH9 A;  2F8N B;  1HQ3 A;  5CPI D;  4Z66 A;  3KXB A;  3REL D;  1F66 B;  5BT1 C;  1ZLA C;  1P3P C;  3W99 B;  1M19 D;  3AZE B;  5B40 D;  5AV5 B;  5B2J D;  3UT9 A;  5B0Z A;  4X23 A;  4H9N A;  3REI A;  1U35 A;  2Y2J A;  3W97 B;  3AZI C;  4QLC C;  4CAY A;  1P34 D;  1BFM A;  3B6F B;  5B0Y C;  3AZM B;  4EO5 C;  3AZK A;  5B32 A;  3REK C;  5AY8 A;  3A1I A;  3MVD D;  3AFA C;  1KX5 D;  3KWQ C;  3AYW C;  5AV8 C;  3B6G A;  5DNN A;  4H9P B;  3REJ A;  5B33 B;  4YS3 D;  4WU8 D;  3AL0 C;  3H0M C;  3LZ1 D;  3X1U C;  3MGR B;  4J8W D;  1BH9 B;  4R8P A;  1HQ3 B;  2Y2K A;  4Z66 B;  3KXB B;  4J8X A;  3C1B C;  4KUD A;  2J8P A;  2Y2L A;  3UT9 B;  5B0Z B;  4X23 B;  4H9N B;  3REI B;  2F8N D;  4J8U A;  1U35 B;  5CPI C;  5C3I B;  1W2E A;  5GT3 A;  3REL C;  1F66 D;  3W99 D;  4CAY B;  4HGA B;  3AZE D;  1M19 C;  5B40 C;  5AV5 D;  4JJN A;  4H9Q A;  3AZK B;  3W97 D;  5B32 B;  3B0D B;  5AY8 B;  1R4V A;  3VH5 T;  3VH5 A;  3B6F D;  5BNV A;  2CV5 C;  2W8S A;  3V9R A;  3B6G B;  5DNN B;  3REJ B;  3AZM D;  3WTP E;  5B2I C;  1P3M A;  4KGC A;  4R8P B;  3MVD C;  1P3K A;  4WZS B;  3UTB D;  2DF4 C;  1KX5 C;  4E44 A;  4J8X B;  3EPH A;  2NQB D;  5B33 D;  4NE5 A;  4KUD B;  4YS3 C;  4WU8 C;  4J8V C;  3LZ1 C;  3MGR D;  4J8W C;  1HQ3 D;  5JRG A;  4J8U B;  5GT3 B;  3KXB D;  3AZJ A;  4H9R A;  1P3B A;  3MNN A;  2XD1 A;  4ZBJ C;  3UT9 D;  4JJN B;  5B0Z D;  4X23 D;  3REI D;  1U35 D;  4H9Q B;  3H0R C;  2FJ7 D;  3W99 C;  3LEL B;  5BNV B;  3V9R B;  3AZE C;  3W96 A;  5AV5 C;  1B67 A;  5AVC A;  3AZK D;  5B31 C;  3AZH A;  5B32 D;  1P3M B;  3W97 C;  5AY8 D;  3UTA A;  1HTA A;  3LZ0 D;  1P3K B;  4WJ3 C;  2G5H C;  5B1M A;  3B6G D;  5BS7 C;  3REJ D;  2F8N K;  1P3G A;  3AZM C;  4M6B A;  5CPJ D;  1TZY A;  4NE3 A;  4R8P D;  5JRG B;  5AV9 A;  1P3L A;  1P3O A;  3AZG A;  3UTB C;  4J8X D;  1B6W A;  3AN2 A;  3AZJ B;  5GT0 C;  4KUD D;  5B33 C;  4H9R B;  1P3B B;  2NQB C;  3MNN B;  3P5J B;  3O62 B;  3MGR C;  4H9O A;  3W98 A;  4J8U D;  3KXB C;  3C1C D;  4ZUX A;  3AZF A;  3W96 B;  4JJN D;  3UT9 C;  5GXQ A;  5AVC B;  4X23 C;  3REI C;  1KU5 A;  1U35 C;  5C3I C;  3AZH B;  5BNX A;  2FJ7 C;  3WAA A;  3UTA B;  2G5I C;  2RIQ A;  3LEL D;  5CPK A;  5B1M B;  1M18 C;  1P3G B;  4WU9 A;  1TZY B;  3AZK C;  1P3M D;  5B32 C;  3AZN A;  3LZ0 C;  5AV9 B;  1P3K D;  1P3L B;  1P3O B;  3B0C T;  3MGQ A;  3AZG B;  3AN2 B;  2RVQ D;  4YM6 A;  5CPJ C;  2ZY3 A;  2BYM A;  2HUE C;  2NZD A;  4H9O B;  4R8P C;  5JRG D;  5AV6 A;  3W98 B;  3A1K A;  5DNM A;  4J8X C;  3AZF B;  4ZUX B;  4KUD C;  2HIO A;  2JSS A;  4Z5T C;  3MNN D;  3A6N A;  2F2A C;  2ZY2 A;  3O62 D;  5GXQ B;  1EQZ A;  2IO5 C;  4J8U C;  5E5A A;  5BNX B;  3WAA B;  3X1T A;  3C1C C;  5CPK B;  3VH5 W;  2ZM5 A;  3W96 D;  4JJN C;  5AVC D;  4WU9 B;  3AZH D;  1P3F A;  3AZN B;  3UTA D;  3LEL C;  5B1M D;  3MGQ B;  4NFT A;  1P3G D;  4YM6 B;  1TZY D;  1P3M C;  2BYM B;  4XZQ A;  2NZD B;  5AV6 B;  5AV9 D;  5DNM B;  1P3L D;  3AZG D;  1P3O D;  3AN2 D;  3LJA A;  2HIO B;  3A6N B;  4DRB A;  2RVQ C;  3AV2 A;  3X1S A;  3W98 D;  1EQZ B;  5JA4 A;  5E5A B;  3AZF D;  4ZUX D;  3KUY A;  3X1T B;  5B2J C;  3O62 C;  4Z2M H;  5AVB A;  1JFI A;  2YFV A;  5B24 A;  1P3F B;  1ULY A;  3WAA D;  1P34 C;  5CPK D;  1P3P A;  3W96 C;  2Y2G A;  4WU9 D;  5AVC C;  2UWX A;  2Y2Q A;  3AZH C;  3AZN D;  4XZQ B;  3UTA C;  4DRA A;  5B1M C;  3MGQ D;  3LJA B;  1P3G C;  2F8N G;  5B0Y A;  1TZY C;  3AV2 B;  3X1S B;  2NZD D;  3WKJ A;  3REK A;  4Z66 D;  5DNM D;  1Z2C B;  1P3L C;  1P3O C;  5JA4 B;  2ZY4 A;  3AFA A;  3AZG C;  3AN2 C;  3KWQ A;  5AV8 A;  3KUY B;  2HIO D;  3A6N D;  4UPK A;  3KSY A;  5B31 G;  5AVB B;  3AZL A;  1KX3 A;  1JFI B;  1F66 C;  1EQZ D;  3W98 C;  5F99 A;  2YFV B;  5E5A D;  5B24 B;  3X1T D;  3AV1 A;  4XUJ A;  4H9S A;  4KGC B;  1P3F D;  3B6F C;  1AOI A;  5DNN D;  5CPK C;  5B0Y B;  3NQJ A;  3AZN C;  4XZQ D;  3X1V A;  3WKJ B;  3AFA B;  3MGQ C;  1KX4 A;  3KWQ B;  2CV5 A;  5AV8 B;  2PYO A;  3LJA D;  1P3I A;  4WNN A;  5B2I A;  1M1A A;  3AV2 D;  1HQ3 C;  3X1S D;  2NZD C;  4AWL B;  1A7W A;  5GT3 D;  4Z66 C;  3AZL B;  1KX3 B;  5DNM C;  5F99 B;  3WA9 A;  2YFW A;  3KUY D;  3AV1 B;  2HIO C;  3A6N C;  5B0Z C;  4J8V A;  5B32 G;  4XUJ B;  5AVB D;  3LZ1 A;  3TU4 A;  5B24 D;  5E5A C;  4HGA C;  1AOI B;  5KDM A;  3WTP A;  4KHA A;  1ID3 A;  2ARO A;  3B0D C;  3NQJ B;  5AY8 C;  5GSU A;  4KGC D;  3MGS A;  3X1V B;  1N1J A;  3B6G C;  5DNN C;  3REJ C;  1KX4 B;  2CV5 B;  2PYO B;  3F6T A;  5AV5 A;  2FFF B;  1P3I B;  4WNN B;  5B2I B;  1M1A B;  5CHL B;  5B31 A;  3MGP A;  4XZQ C;  3WKJ D;  3AZJ D;  3AFA D;  1H3O A;  1P3B D;  5AV8 D;  3WA9 B;  2YFW B;  5BS7 A;  3LJA C;  5CP6 A;  4J8V B;  3AV2 C;  3AZL D;  5GT3 C;  3LZ1 B;  1KX3 D;  3TU4 B;  5F99 D;  1PZR A;  5FUG A;  3UTB A;  3EG5 B;  3KUY C;  3AV1 D;  5GT0 A;  2NQB A;  4UUZ A;  5KDM B;  1WWS A;  3WTP B;  4KHA B;  1P3A A;  4XUJ D;  4ZBJ B;  1ID3 B;  5BO0 A;  2ARO B;  2Y2O A;  3VH6 A;  3VH6 T;  5GSU B;  5B24 C;  3MGS B;  1N1J B;  1AOI D;  2LY8 A;  4LD9 A;  1TAF A;  1BH8 A;  3R45 A;  4KGC C;  1S32 A;  5B31 B;  3MGP B;  3X1V D;  1P3K C;  2FJ7 A;  1H3O B;  1KX4 D;  3REH A;  2CV5 D;  2CWE A;  2PYO D;  3EPJ A;  5CP6 B;  1M18 A;  1P3I D;  4G92 B;  5B2I D;  1M1A D;  5JRG C;  3WKJ C;  5B1L A;  3AZJ C;  3IP4 C;  2Y2H A;  3LZ0 A;  1P3B C; 
#chains in the Genus database with same CATH homology
 2XD5 A;  3WA9 D;  2BYK A;  5FUG B;  3MNN C;  3UTB B;  5GT0 B;  2NQB B;  2Y2N A;  4UUZ B;  5GXQ D;  4J8V D;  5CPJ A;  1P3A B;  5BO0 B;  4AWL C;  3AZL C;  1KX3 C;  3TU4 D;  5F99 C;  1ZLA A;  3AV1 C;  4LD9 B;  1TAF B;  1BH8 B;  4Z5T A;  4G91 B;  3WTP D;  1ID3 D;  4XUJ C;  2ARO D;  3B0B A;  3R45 B;  4H9S C;  5GSU D;  3AZI A;  4QLC A;  1S32 B;  3MGS D;  2FJ7 B;  1AOI C;  3C1C A;  3REH B;  4YM6 D;  1M18 B;  4DQY B;  4E45 A;  3NQU A;  5AV6 D;  5B31 D;  5AV9 C;  3X1V C;  5B1L B;  1T3U A;  3MGP D;  3AYW A;  3LZ0 B;  3LEL A;  1KX4 C;  2BYK B;  3EPL A;  2PYO C;  2VQR A;  5CP6 D;  1P3I C;  1M1A C;  5CPJ B;  3X1U A;  2HUE B;  3EPK A;  3AZF C;  4ZUX C;  3C1B A;  2BG1 A;  3WA9 C;  1ZLA B;  1P3P B;  5GT0 D;  4Z5T B;  5GXQ C;  1P3A D;  1WWI A;  3KFU G;  5G49 A;  3WAA C;  3TU4 C;  5CPI A;  3AZI B;  2JE5 A;  2IO5 B;  4QLC B;  3REL A;  1Q9C A;  3B0C W;  3C1C B;  1M19 A;  4LD9 D;  5B40 A;  4WU9 C;  3WTP C;  5B2J A;  2JCH A;  3O62 A;  4EO5 B;  1ID3 C;  2ARO C;  5GSU C;  3REK B;  3NQU B;  1S32 D;  3MGS C;  1P34 A;  3AYW B;  3REH D;  2L5A A;  4YM6 C;  1F1E A;  1M18 D;  4NE6 A;  3X1U B;  5AV6 C;  3MGP C;  5B1L D;  3MVD A;  4CSR A;  1KX5 A;  3C1B B;  4YS3 A;  4WU8 A;  5CP6 C;  4G92 C;  1EQZ C;  4J8W A;  5G49 B;  5CPI B;  4WV4 B;  3REL B;  3X1T C;  3VH6 W;  5BT1 D;  1ZLA D;  1P3P D;  1M19 B;  4Z5T D;  5B40 B;  1P3A C;  5B2J B;  2F8N A;  2F8N H;  1P3F C;  3AZI D;  4QLC D;  1F66 A;  2DQN C;  3W99 A;  1P34 B;  3AZE A;  4LD9 C;  4G91 C;  5B0Y D;  3FDD A;  3W97 A;  3REK D;  1S32 C;  3H0L C;  3MVD B;  4CSR B;  3KWQ D;  3AYW D;  1KX5 B;  2Y2P A;  3B6F A;  3REH C;  2ZY5 A;  4Z2M G;  4YS3 B;  4WU8 B;  3AZM A;  3X1S C;  3X1U D;  4J8W B;  2Y2I A;  5B1L C;  2Y2M A;  3C1B D;  4H9P A;  5B33 A;  5AVB C;  3MGR A;  1BH9 A;  2F8N B;  1HQ3 A;  5CPI D;  4Z66 A;  3KXB A;  3REL D;  1F66 B;  5BT1 C;  1ZLA C;  1P3P C;  3W99 B;  1M19 D;  3AZE B;  5B40 D;  5AV5 B;  5B2J D;  3UT9 A;  5B0Z A;  4X23 A;  4H9N A;  3REI A;  1U35 A;  2Y2J A;  3W97 B;  3AZI C;  4QLC C;  4CAY A;  1P34 D;  1BFM A;  3B6F B;  5B0Y C;  3AZM B;  4EO5 C;  3AZK A;  5B32 A;  3REK C;  5AY8 A;  3A1I A;  3MVD D;  3AFA C;  1KX5 D;  3KWQ C;  3AYW C;  5AV8 C;  3B6G A;  5DNN A;  4H9P B;  3REJ A;  5B33 B;  4YS3 D;  4WU8 D;  3AL0 C;  3H0M C;  3LZ1 D;  3X1U C;  3MGR B;  4J8W D;  1BH9 B;  4R8P A;  1HQ3 B;  2Y2K A;  4Z66 B;  3KXB B;  4J8X A;  3C1B C;  4KUD A;  2J8P A;  2Y2L A;  3UT9 B;  5B0Z B;  4X23 B;  4H9N B;  3REI B;  2F8N D;  4J8U A;  1U35 B;  5CPI C;  5C3I B;  1W2E A;  5GT3 A;  3REL C;  1F66 D;  3W99 D;  4CAY B;  4HGA B;  3AZE D;  1M19 C;  5B40 C;  5AV5 D;  4JJN A;  4H9Q A;  3AZK B;  3W97 D;  5B32 B;  3B0D B;  5AY8 B;  1R4V A;  3VH5 T;  3VH5 A;  3B6F D;  5BNV A;  2CV5 C;  2W8S A;  3V9R A;  3B6G B;  5DNN B;  3REJ B;  3AZM D;  3WTP E;  5B2I C;  1P3M A;  4KGC A;  4R8P B;  3MVD C;  1P3K A;  4WZS B;  3UTB D;  2DF4 C;  1KX5 C;  4E44 A;  4J8X B;  3EPH A;  2NQB D;  5B33 D;  4NE5 A;  4KUD B;  4YS3 C;  4WU8 C;  4J8V C;  3LZ1 C;  3MGR D;  4J8W C;  1HQ3 D;  5JRG A;  4J8U B;  5GT3 B;  3KXB D;  3AZJ A;  4H9R A;  1P3B A;  3MNN A;  2XD1 A;  4ZBJ C;  3UT9 D;  4JJN B;  5B0Z D;  4X23 D;  3REI D;  1U35 D;  4H9Q B;  3H0R C;  2FJ7 D;  3W99 C;  3LEL B;  5BNV B;  3V9R B;  3AZE C;  3W96 A;  5AV5 C;  1B67 A;  5AVC A;  3AZK D;  5B31 C;  3AZH A;  5B32 D;  1P3M B;  3W97 C;  5AY8 D;  3UTA A;  1HTA A;  3LZ0 D;  1P3K B;  4WJ3 C;  2G5H C;  5B1M A;  3B6G D;  5BS7 C;  3REJ D;  2F8N K;  1P3G A;  3AZM C;  4M6B A;  5CPJ D;  1TZY A;  4NE3 A;  4R8P D;  5JRG B;  5AV9 A;  1P3L A;  1P3O A;  3AZG A;  3UTB C;  4J8X D;  1B6W A;  3AN2 A;  3AZJ B;  5GT0 C;  4KUD D;  5B33 C;  4H9R B;  1P3B B;  2NQB C;  3MNN B;  3P5J B;  3O62 B;  3MGR C;  4H9O A;  3W98 A;  4J8U D;  3KXB C;  3C1C D;  4ZUX A;  3AZF A;  3W96 B;  4JJN D;  3UT9 C;  5GXQ A;  5AVC B;  4X23 C;  3REI C;  1KU5 A;  1U35 C;  5C3I C;  3AZH B;  5BNX A;  2FJ7 C;  3WAA A;  3UTA B;  2G5I C;  2RIQ A;  3LEL D;  5CPK A;  5B1M B;  1M18 C;  1P3G B;  4WU9 A;  1TZY B;  3AZK C;  1P3M D;  5B32 C;  3AZN A;  3LZ0 C;  5AV9 B;  1P3K D;  1P3L B;  1P3O B;  3B0C T;  3MGQ A;  3AZG B;  3AN2 B;  2RVQ D;  4YM6 A;  5CPJ C;  2ZY3 A;  2BYM A;  2HUE C;  2NZD A;  4H9O B;  4R8P C;  5JRG D;  5AV6 A;  3W98 B;  3A1K A;  5DNM A;  4J8X C;  3AZF B;  4ZUX B;  4KUD C;  2HIO A;  2JSS A;  4Z5T C;  3MNN D;  3A6N A;  2F2A C;  2ZY2 A;  3O62 D;  5GXQ B;  1EQZ A;  2IO5 C;  4J8U C;  5E5A A;  5BNX B;  3WAA B;  3X1T A;  3C1C C;  5CPK B;  3VH5 W;  2ZM5 A;  3W96 D;  4JJN C;  5AVC D;  4WU9 B;  3AZH D;  1P3F A;  3AZN B;  3UTA D;  3LEL C;  5B1M D;  3MGQ B;  4NFT A;  1P3G D;  4YM6 B;  1TZY D;  1P3M C;  2BYM B;  4XZQ A;  2NZD B;  5AV6 B;  5AV9 D;  5DNM B;  1P3L D;  3AZG D;  1P3O D;  3AN2 D;  3LJA A;  2HIO B;  3A6N B;  4DRB A;  2RVQ C;  3AV2 A;  3X1S A;  3W98 D;  1EQZ B;  5JA4 A;  5E5A B;  3AZF D;  4ZUX D;  3KUY A;  3X1T B;  5B2J C;  3O62 C;  4Z2M H;  5AVB A;  1JFI A;  2YFV A;  5B24 A;  1P3F B;  1ULY A;  3WAA D;  1P34 C;  5CPK D;  1P3P A;  3W96 C;  2Y2G A;  4WU9 D;  5AVC C;  2UWX A;  2Y2Q A;  3AZH C;  3AZN D;  4XZQ B;  3UTA C;  4DRA A;  5B1M C;  3MGQ D;  3LJA B;  1P3G C;  2F8N G;  5B0Y A;  1TZY C;  3AV2 B;  3X1S B;  2NZD D;  3WKJ A;  3REK A;  4Z66 D;  5DNM D;  1Z2C B;  1P3L C;  1P3O C;  5JA4 B;  2ZY4 A;  3AFA A;  3AZG C;  3AN2 C;  3KWQ A;  5AV8 A;  3KUY B;  2HIO D;  3A6N D;  4UPK A;  3KSY A;  5B31 G;  5AVB B;  3AZL A;  1KX3 A;  1JFI B;  1F66 C;  1EQZ D;  3W98 C;  5F99 A;  2YFV B;  5E5A D;  5B24 B;  3X1T D;  3AV1 A;  4XUJ A;  4H9S A;  4KGC B;  1P3F D;  3B6F C;  1AOI A;  5DNN D;  5CPK C;  5B0Y B;  3NQJ A;  3AZN C;  4XZQ D;  3X1V A;  3WKJ B;  3AFA B;  3MGQ C;  1KX4 A;  3KWQ B;  2CV5 A;  5AV8 B;  2PYO A;  3LJA D;  1P3I A;  4WNN A;  5B2I A;  1M1A A;  3AV2 D;  1HQ3 C;  3X1S D;  2NZD C;  4AWL B;  1A7W A;  5GT3 D;  4Z66 C;  3AZL B;  1KX3 B;  5DNM C;  5F99 B;  3WA9 A;  2YFW A;  3KUY D;  3AV1 B;  2HIO C;  3A6N C;  5B0Z C;  4J8V A;  5B32 G;  4XUJ B;  5AVB D;  3LZ1 A;  3TU4 A;  5B24 D;  5E5A C;  4HGA C;  1AOI B;  5KDM A;  3WTP A;  4KHA A;  1ID3 A;  2ARO A;  3B0D C;  3NQJ B;  5AY8 C;  5GSU A;  4KGC D;  3MGS A;  3X1V B;  1N1J A;  3B6G C;  5DNN C;  3REJ C;  1KX4 B;  2CV5 B;  2PYO B;  3F6T A;  5AV5 A;  2FFF B;  1P3I B;  4WNN B;  5B2I B;  1M1A B;  5CHL B;  5B31 A;  3MGP A;  4XZQ C;  3WKJ D;  3AZJ D;  3AFA D;  1H3O A;  1P3B D;  5AV8 D;  3WA9 B;  2YFW B;  5BS7 A;  3LJA C;  5CP6 A;  4J8V B;  3AV2 C;  3AZL D;  5GT3 C;  3LZ1 B;  1KX3 D;  3TU4 B;  5F99 D;  1PZR A;  5FUG A;  3UTB A;  3EG5 B;  3KUY C;  3AV1 D;  5GT0 A;  2NQB A;  4UUZ A;  5KDM B;  1WWS A;  3WTP B;  4KHA B;  1P3A A;  4XUJ D;  4ZBJ B;  1ID3 B;  5BO0 A;  2ARO B;  2Y2O A;  3VH6 A;  3VH6 T;  5GSU B;  5B24 C;  3MGS B;  1N1J B;  1AOI D;  2LY8 A;  4LD9 A;  1TAF A;  1BH8 A;  3R45 A;  4KGC C;  1S32 A;  5B31 B;  3MGP B;  3X1V D;  1P3K C;  2FJ7 A;  1H3O B;  1KX4 D;  3REH A;  2CV5 D;  2CWE A;  2PYO D;  3EPJ A;  5CP6 B;  1M18 A;  1P3I D;  4G92 B;  5B2I D;  1M1A D;  5JRG C;  3WKJ C;  5B1L A;  3AZJ C;  3IP4 C;  2Y2H A;  3LZ0 A;  1P3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...