1P3GA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gA00
4H9SC 3B6FA 5JRGA 4KGCC 4WU8B 3WAAC 3MNNC 5B31C 3WA9D 3AYWD 5B0ZB 5DNNC 5B1MC 3X1TD 4NE3A 4CSRA 3AZHA 5AV9B 5AV6B 3KUYD 3AV1D 1M18A 3AFAB 5C3IB 5CPJB 1P3FC 5BT1C 5AV5D 5GT3D 3REJB 5G49A 1S32D 3WKJB 1ID3A 3LJAB 4Z2MG 3KWQC 3UTAB 1EQZB 5E5AB 1P3IC 3W99B 4YS3B 3X1UA 2NZDC 3O62A 4WU9D 1AOIB 3REKC 1M19B 1KX4D 4E45A 4H9SA 1JFIB 4M6BA 3V9RA 4G91C 3B6GB 3MGRD 3MNNA 1P3OD 4CSRB 3W97B 1ZLAA 1M18B 5BNVB 5DNNA 5B1MA 5AV6D 3AZGB 3UT9D 5G49B 1ULYA 5BO0A 4KHAB 5AY8C 3LELB 3AZLD 1P3BD 1P3FA 4NE6A 3AZFC 1P3LC 5B2ID 5B40C 3AZJB 4KUDC 1KX5A 4YS3D 1P3GD 3KWQA 1BH9B 1P3IA 4X23C 3O62B 2FJ7C 5B32B 2NZDA 3MVDC 4EO5B 1U35A 5BS7C 3AZMD 1P3PD 3REKA 3REHC 4KGCB 5B0YC 3WAAB 3TU4A 1N1JA 5B31B 3LZ0D 4JJNB 3X1VB 5CP6C 3MGSC 5CPIB 4WNNA 2YFWA 4AWLC 1KX3B 5B2JD 3A6ND 3AV2B 5BNXA 1P3FB 2BYMA 5B32G 1TAFA 4WZSB 3W96B 5AY8A 1M1AC 2IO5C 3AZFA 1P3LA 3KWQB 4XZQC 1P3IB 5B40A 4YM6B 4KUDA 3MGQD 1F66D 5B31G 2PYOB 3VH5A 4R8PC 4LD9C 4X23A 3X1TC 2FJ7A 1H3OB 2AROB 1HQ3B 3MVDA 1R4VA 4ZBJC 3WTPB 5BS7A 3LZ1D 3AZKC 3W98D 5AV5C 3REHA 1S32C 4G91B 5B0YA 5CP6A 4XUJB 1KX3D 2RVQC 4HGAC 1TAFB 3UTBC 4WU9C 1TZYC 5GXQD 4J8UC 5AVCD 4J8WC 4G92B 5B40B 4J8XD 1M1AA 4KUDB 5B33D 4XZQA 4H9OB 4X23B 3RELB 4Z5TB 3C1BD 3WA9A 4R8PA 3REID 3AYWA 4LD9A 3X1TA 2HIOC 3B0CW 3AZHC 3KUYA 3AZKA 2F8NK 4QLCC 1P3BC 5B0YB 3AZID 5AV5A 1S32A 5CP6B 3MGSB 1P3AD 4XUJD 3C1CD 2CV5C 1ID3C 4AWLB 4H9PA 3X1UC 5JA4A 4WU9A 5GSUD 1M1AB 1KX4A 3NQJA 4XZQB 1P3MD 5DNMC 5FUGA 5B1LC 4R8PB 5F99D 1P3OA 3AZKB 1B67A 1ZLAC 2HIOA 3AN2B 1HTAA 4QLCA 1P3BA 5AVBC 1P34D 3MGQC 4H9PB 2CV5A 1BFMA 4HGAB 3KXBB 1KX5C 1F66C 5JA4B 4ZUXB 1A7WA 5AV8D 5B24D 3UTBB 1TZYB 2NQBD 4J8UB 4J8WB 4H9RA 3NQJB 4UUZB 4J8VC 3AZMA 1U35C 3B6FB 1P3PA 5JRGB 5FUGB 4WU8D 5DNMA 3TU4C 5B1LA 2HIOB 5B0ZD 3MGPC 5CPKC 3A6NA 3AZHB 4QLCB 4NE5A 5AV9D 5GT0C 2F8NA 5CPJD 3AFAD 2F8NH 3REJD 3WKJD 5AVBA 2CV5B 1ID3B 3LJAD 3KXBD 3AZNC 2HUEC 3MGQA 3UTAD 1EQZD 3W99D 5E5AD 3X1UB 1F66A 3REIC 4H9QA 1AOID 4J8VA 1M19D 3AZIC 1BH8A 3VH6W 5DNMB 5B1LB 3V9RB 3B6GD 3MNNB 4Z66C 3X1SC 1ZLAB 3W97D 5DNNB 1M18D 5B1MB 3AZEC 2F8NB 3MGPA 5CPKA 3AZGD 1P3KC 5BO0B 5AVBB 5GT0A 3LELD 3B0CT 1KX5B 3AZJD 3AZNA 3O62D 3C1BA 3REIA 2NZDB 5B32D 3WA9C 4J8VB 3AYWC 1U35B 3REKB 2F8NG 3KUYC 3AV1C 3AZIA 4KGCD 3TU4B 3NQUA 1N1JB 5GT3C 3WAAD 1P3AA 5B31D 4JJND 3X1VD 5CPID 4WNNB 3MGPB 5CPKB 2YFWB 4Z66A 3X1SA 3B0BA 3AZEA 5BNXB 5GT0B 2BYMB 3AV2D 1P3FD 2BYKA 5GSUA 5BT1D 1P3KA 5AY8B 3W96D 1KX4C 3AZFB 1P3LB 3AZNB 2HUEB 3KWQD 1P3ID 4YM6D 2PYOD 2NZDD 3MGRC 5F99A 2FJ7B 2JSSA 1KU5A 1P3OC 3MVDB 2AROD 1HQ3D 1WWIA 5AV9C 5AV6C 3WTPD 5CPJC 5C3IC 3NQUB 3REHB 3UT9C 3AV1A 3WKJC 3AZLC 1P34A 2YFVA 5GT3A 5B2IC 4Z66B 3X1SB 4YS3C 1P3GC 3AZEB 2NQBA 5B24A 1P3KB 3AZMC 1P3PC 2IO5B 5B40D 4KUDD 4WU8A 3B6GC 4X23D 1Q9CA 4Z5TD 3LZ0C 3RELD 3WA9B 3AYWB 3MGRA 4LD9B 5B0ZA 3X1TB 5B2JC 4DRAA 4ZBJB 3A6NC 3KUYB 3AV1B 5AV9A 5AV6A 3LELC 5CPJA 5B0YD 5AV5B 5GT3B 3UT9A 1S32B 3REJA 3WKJA 1F1EA 3AZLA 5CP6D 3MGSD 3B0DC 3VH6T 3UTAA 5B2IA 1EQZA 4YS3A 1P3GA 5B32C 4WU9B 1AOIA 1M1AD 1KX4B 3LZ1C 1M19A 4CAYA 2L5AA 4XZQD 3W98C 1JFIA 3X1VC 4JJNC 3MGRB 3B6GA 4R8PD 4LD9D 5CPIC 3LZ0A 1P3OB 3VH5W 1KX3C 3W97A 5BNVA 3AZKD 3AV2C 3AN2D 3AZGA 5B2JA 3UT9B 5GXQC 3W96C 3AZLB 1P3BB 4KHAA 5AVCC 3LELA 5B2IB 4J8XC 4YM6C 3AZJA 1P3GB 5B33C 2RVQD 2PYOC 1BH9A 4ZUXD 3UTBD 1TZYD 3R45A 5B32A 3C1BC 2AROC 1HQ3C 4H9RB 4J8UD 4J8WD 3WTPC 3AZMB 4CAYB 1P3PB 3B6FD 3LZ1A 5JRGD 4KGCA 3W98A 3WAAA 3LZ0B 5B31A 4JJNA 3X1VA 1P3AC 4XUJC 3C1CC 5CPIA 2HIOD 5B2JB 1KX3A 3A6NB 3AZHD 3AV2A 4QLCD 5GXQA 3W96A 5GSUC 4G92C 5AVCA 2CV5D 3B0DB 1ID3D 4J8XA 1P3MC 3MGQB 4YM6A 3RELC 4Z5TC 5B33A 3R45B 1F66B 3X1UD 2PYOA 4H9QB 5F99C 1H3OA 2AROA 1HQ3A 3LZ1B 3WTPA 3W98B 1BH8B 5DNMD 5B1LD 5KDMA 1P34C 3MNND 4XUJA 4E44A 3C1CA 1ZLAD 5DNND 5B1MD 5AV8C 5B24C 2F8ND 2NQBC 5GXQB 5AVCB 5AVBD 2CWEA 4J8XB 5B33B 1KX5D 4H9OA 1P3MA 3RELA 4Z5TA 4WU8C 3C1BB 3REIB 4J8VD 1U35D 5B0ZC 3AN2C 3REKD 3AZIB 5KDMB 3AFAC 1WWSA 3TU4D 1P3AB 3REJC 3MGSA 1B6WA 3C1CB 3LJAC 3KXBC 3UTAC 1EQZC 4ZUXC 3W99C 5E5AC 3MGPD 5CPKD 5AV8A 5GT0D 3VH5T 2BYKB 5GSUB 3B6FC 1AOIC 5AY8D 5JRGC 4H9NA 3KSYA 1M19C 3VH6A 4DRBA 3AZFD 1P3LD 1P3MB 3AZND 2LY8A 4Z2MH 5F99B 2FJ7D 4NFTA 3MVDD 4WV4B 3W97C 5CHLB 3AN2A 1M18C 3AZGC 3REHD 3WTPE 3AFAA 1P34B 2YFVB 4Z66D 3X1SD 3LJAA 3AZJC 3KXBA 5AV8B 3AZED 5B24B 2NQBB 4ZUXA 5E5AA 3W99A 3UTBA 1TZYA 3O62C 4J8UA 1P3KD 4J8WA 4UUZA 4H9NB 4EO5C
chains in the Genus database with same CATH superfamily
4H9SC 3B6FA 5JRGA 4KGCC 4WU8B 3WAAC 3MNNC 5B31C 3WA9D 3AYWD 5B0ZB 5DNNC 5B1MC 3X1TD 4NE3A 4CSRA 3AZHA 5AV9B 5AV6B 3KUYD 3AV1D 1M18A 3AFAB 5C3IB 5CPJB 1P3FC 5BT1C 5AV5D 5GT3D 3REJB 5G49A 1S32D 3WKJB 1ID3A 3LJAB 4Z2MG 3KWQC 3UTAB 1EQZB 5E5AB 1P3IC 3W99B 4YS3B 3X1UA 3A1IA 2NZDC 3O62A 4WU9D 1AOIB 3REKC 1M19B 3EPKA 1KX4D 4E45A 4H9SA 1JFIB 4M6BA 3V9RA 4G91C 3B6GB 3MGRD 3MNNA 2Y2QA 1P3OD 4CSRB 3W97B 1ZLAA 1M18B 5BNVB 5DNNA 5B1MA 5AV6D 3AZGB 3UT9D 5G49B 1ULYA 5BO0A 4KHAB 5AY8C 3LELB 3AZLD 1P3BD 1P3FA 4NE6A 3AZFC 1P3LC 2Y2MA 5B2ID 5B40C 3AZJB 4KUDC 1KX5A 4YS3D 1P3GD 3KWQA 1BH9B 1P3IA 4X23C 3O62B 2FJ7C 5B32B 2NZDA 3MVDC 4EO5B 1U35A 5BS7C 3AZMD 1P3PD 3REKA 3REHC 4KGCB 5B0YC 2XD1A 3TU4A 3WAAB 1N1JA 5B31B 3LZ0D 4JJNB 3X1VB 5CP6C 3MGSC 5CPIB 4WNNA 2YFWA 4AWLC 1KX3B 5B2JD 3A6ND 3AV2B 5BNXA 1P3FB 2BYMA 5B32G 1TAFA 4WZSB 2ZY2A 3W96B 5AY8A 1M1AC 2IO5C 3AZFA 1P3LA 3KWQB 4XZQC 1P3IB 5B40A 4YM6B 4KUDA 3MGQD 1F66D 5B31G 2PYOB 3VH5A 4R8PC 4LD9C 4X23A 3EPHA 3X1TC 2FJ7A 1H3OB 2AROB 1HQ3B 3MVDA 1R4VA 4ZBJC 3WTPB 5BS7A 3LZ1D 3AZKC 3W98D 5AV5C 3REHA 1S32C 4G91B 5B0YA 5CP6A 4XUJB 1KX3D 2RVQC 4HGAC 1TAFB 3UTBC 4WU9C 1TZYC 5GXQD 4J8UC 5AVCD 4J8WC 4G92B 5B40B 4J8XD 1M1AA 4KUDB 5B33D 2Y2HA 4XZQA 2RIQA 2Y2KA 4H9OB 4X23B 3RELB 4Z5TB 3C1BD 3WA9A 4R8PA 3REID 3AYWA 4LD9A 3X1TA 2HIOC 2G5IC 3B0CW 3AZHC 3KUYA 3AZKA 2F8NK 4QLCC 1P3BC 5B0YB 3AZID 5AV5A 1S32A 5CP6B 3MGSB 1P3AD 2VQRA 4XUJD 3C1CD 2CV5C 1ID3C 4AWLB 4H9PA 3X1UC 5JA4A 4WU9A 3EPLA 5GSUD 1M1AB 1KX4A 3NQJA 4XZQB 1P3MD 5DNMC 5FUGA 5B1LC 3H0LC 4R8PB 5F99D 1P3OA 3AZKB 1B67A 3FDDA 2HIOA 3AN2B 1ZLAC 1HTAA 4QLCA 1P3BA 1PZRA 5AVBC 1P34D 3MGQC 4H9PB 2CV5A 1BFMA 4HGAB 3KXBB 1KX5C 1F66C 5JA4B 4ZUXB 1A7WA 5AV8D 5B24D 3UTBB 1TZYB 2NQBD 4J8UB 4J8WB 4H9RA 3NQJB 4UUZB 3AL0C 4J8VC 3AZMA 1U35C 3B6FB 1P3PA 5JRGB 5FUGB 4WU8D 5DNMA 3TU4C 5B1LA 2HIOB 5B0ZD 3MGPC 5CPKC 3A6NA 3AZHB 2FFFB 4QLCB 4NE5A 5AV9D 5GT0C 2F8NA 5CPJD 3AFAD 2F8NH 3REJD 3WKJD 5AVBA 2CV5B 1ID3B 3LJAD 3KXBD 3AZNC 2HUEC 3MGQA 3UTAD 1EQZD 3W99D 5E5AD 3X1UB 1F66A 3REIC 4H9QA 1AOID 4J8VA 1M19D 2J8PA 3AZIC 1BH8A 3VH6W 5DNMB 5B1LB 3V9RB 3B6GD 3MNNB 4Z66C 3X1SC 1ZLAB 3W97D 5DNNB 1M18D 5B1MB 3AZEC 2F8NB 3MGPA 5CPKA 3AZGD 1P3KC 5BO0B 5AVBB 5GT0A 3LELD 3B0CT 1KX5B 3AZJD 3AZNA 3O62D 3C1BA 3REIA 3H0MC 5B32D 3WA9C 2NZDB 4J8VB 3AYWC 1U35B 1T3UA 3REKB 2F8NG 3KUYC 3AV1C 3AZIA 4KGCD 2DF4C 3NQUA 3TU4B 1N1JB 5GT3C 3WAAD 1P3AA 5B31D 2Y2PA 4JJND 3X1VD 5CPID 4WNNB 3MGPB 5CPKB 2YFWB 4Z66A 3X1SA 3B0BA 3AZEA 5BNXB 5GT0B 2BYMB 3AV2D 1P3FD 2BYKA 3EPJA 5GSUA 5BT1D 1P3KA 5AY8B 3W96D 1KX4C 3AZFB 1P3LB 3AZNB 2HUEB 3KWQD 2Y2NA 1P3ID 4YM6D 2PYOD 2NZDD 3MGRC 5F99A 2FJ7B 2JSSA 1KU5A 1P3OC 3MVDB 2AROD 1HQ3D 2ZY5A 1WWIA 5AV9C 5AV6C 3WTPD 5CPJC 5C3IC 3NQUB 3REHB 3UT9C 3AV1A 3WKJC 3AZLC 1P34A 2YFVA 5GT3A 5B2IC 4Z66B 2ZM5A 3X1SB 4YS3C 1P3GC 3AZEB 2NQBA 5B24A 1P3KB 2BG1A 3AZMC 2UWXA 1P3PC 2IO5B 5B40D 4KUDD 4WU8A 3B6GC 4X23D 1Q9CA 4Z5TD 3LZ0C 2JCHA 3RELD 3WA9B 3AYWB 3MGRA 4LD9B 5B0ZA 3X1TB 5B2JC 4DRAA 4ZBJB 3A6NC 3KUYB 3AV1B 5AV9A 5AV6A 3LELC 5CPJA 5B0YD 5AV5B 5GT3B 3UT9A 1S32B 3REJA 3WKJA 1F1EA 3AZLA 5CP6D 3MGSD 3B0DC 3VH6T 4UPKA 5B2IA 3UTAA 2Y2JA 1EQZA 4YS3A 1P3GA 5B32C 4WU9B 1AOIA 4WJ3C 1M1AD 1KX4B 3LZ1C 1M19A 4CAYA 2L5AA 4XZQD 3W98C 1JFIA 3X1VC 4JJNC 3MGRB 3B6GA 4R8PD 4LD9D 5CPIC 3LZ0A 1P3OB 3VH5W 3EG5B 1KX3C 3W97A 4DQYB 5BNVA 3AZKD 3AV2C 3AN2D 3AZGA 5B2JA 3UT9B 5GXQC 3W96C 3AZLB 1P3BB 4KHAA 5AVCC 3LELA 5B2IB 4J8XC 4YM6C 3AZJA 1P3GB 5B33C 2RVQD 2PYOC 1BH9A 4ZUXD 3UTBD 3R45A 1TZYD 5B32A 3C1BC 2AROC 1HQ3C 4H9RB 4J8UD 4J8WD 3WTPC 3AZMB 4CAYB 1P3PB 3B6FD 3LZ1A 5JRGD 4KGCA 3W98A 3WAAA 2Y2LA 3LZ0B 5B31A 2XD5A 4JJNA 3X1VA 1P3AC 4XUJC 3C1CC 5CPIA 2HIOD 5B2JB 1KX3A 3A6NB 3AZHD 3AV2A 4QLCD 2Y2OA 2Y2GA 5GXQA 3W96A 5GSUC 4G92C 5AVCA 2CV5D 3B0DB 1ID3D 4J8XA 1P3MC 3MGQB 4YM6A 3RELC 4Z5TC 5B33A 3R45B 1F66B 3X1UD 2PYOA 3KFUG 4H9QB 5F99C 1H3OA 1Z2CB 2AROA 1HQ3A 3LZ1B 3WTPA 3W98B 1BH8B 5DNMD 5B1LD 2F2AC 5KDMA 1P34C 2JE5A 2G5HC 3MNND 2ZY4A 4XUJA 4E44A 3C1CA 1ZLAD 5DNND 5B1MD 5AV8C 5B24C 2F8ND 2NQBC 5GXQB 5AVCB 5AVBD 2CWEA 4J8XB 5B33B 3P5JB 1KX5D 4H9OA 1P3MA 3RELA 4Z5TA 4WU8C 3C1BB 3REIB 4J8VD 1U35D 5B0ZC 3AN2C 3REKD 3AZIB 5KDMB 3AFAC 1WWSA 3TU4D 1P3AB 3REJC 3MGSA 1B6WA 3C1CB 2ZY3A 3LJAC 3KXBC 3UTAC 1EQZC 4ZUXC 3W99C 5E5AC 3MGPD 5CPKD 5AV8A 5GT0D 3VH5T 2BYKB 1W2EA 5GSUB 3B6FC 1AOIC 5AY8D 5JRGC 4H9NA 3KSYA 1M19C 3VH6A 4DRBA 3AZFD 3IP4C 1P3LD 1P3MB 3AZND 2LY8A 2Y2IA 2DQNC 4Z2MH 3H0RC 5F99B 3F6TA 2FJ7D 4NFTA 3MVDD 4WV4B 3W97C 5CHLB 3AN2A 1M18C 3AZGC 2W8SA 3REHD 3WTPE 3AFAA 1P34B 2YFVB 3A1KA 4Z66D 3X1SD 3LJAA 3AZJC 3KXBA 5AV8B 3AZED 5B24B 2NQBB 4ZUXA 5E5AA 3W99A 3UTBA 1TZYA 3O62C 4J8UA 1P3KD 4J8WA 4UUZA 4H9NB 4EO5C
chains in the Genus database with same CATH topology
4H9SC 3B6FA 5JRGA 4KGCC 4WU8B 3WAAC 3MNNC 5B31C 3WA9D 3AYWD 5B0ZB 5DNNC 5B1MC 3X1TD 4NE3A 4CSRA 3AZHA 5AV9B 5AV6B 3KUYD 3AV1D 1M18A 3AFAB 5C3IB 5CPJB 1P3FC 5BT1C 5AV5D 5GT3D 3REJB 5G49A 1S32D 3WKJB 1ID3A 3LJAB 4Z2MG 3KWQC 3UTAB 1EQZB 5E5AB 1P3IC 3W99B 4YS3B 3X1UA 3A1IA 2NZDC 3O62A 4WU9D 1AOIB 3REKC 1M19B 3EPKA 1KX4D 4E45A 4H9SA 1JFIB 4M6BA 3V9RA 4G91C 3B6GB 3MGRD 3MNNA 2Y2QA 1P3OD 4CSRB 3W97B 1ZLAA 1M18B 5BNVB 5DNNA 5B1MA 5AV6D 3AZGB 3UT9D 5G49B 1ULYA 5BO0A 4KHAB 5AY8C 3LELB 3AZLD 1P3BD 1P3FA 4NE6A 3AZFC 1P3LC 2Y2MA 5B2ID 5B40C 3AZJB 4KUDC 1KX5A 4YS3D 1P3GD 3KWQA 1BH9B 1P3IA 4X23C 3O62B 2FJ7C 5B32B 2NZDA 3MVDC 4EO5B 1U35A 5BS7C 3AZMD 1P3PD 3REKA 3REHC 4KGCB 5B0YC 2XD1A 3TU4A 3WAAB 1N1JA 5B31B 3LZ0D 4JJNB 3X1VB 5CP6C 3MGSC 5CPIB 4WNNA 2YFWA 4AWLC 1KX3B 5B2JD 3A6ND 3AV2B 5BNXA 1P3FB 2BYMA 5B32G 1TAFA 4WZSB 2ZY2A 3W96B 5AY8A 1M1AC 2IO5C 3AZFA 1P3LA 3KWQB 4XZQC 1P3IB 5B40A 4YM6B 4KUDA 3MGQD 1F66D 5B31G 2PYOB 3VH5A 4R8PC 4LD9C 4X23A 3EPHA 3X1TC 2FJ7A 1H3OB 2AROB 1HQ3B 3MVDA 1R4VA 4ZBJC 3WTPB 5BS7A 3LZ1D 3AZKC 3W98D 5AV5C 3REHA 1S32C 4G91B 5B0YA 5CP6A 4XUJB 1KX3D 2RVQC 4HGAC 1TAFB 3UTBC 4WU9C 1TZYC 5GXQD 4J8UC 5AVCD 4J8WC 4G92B 5B40B 4J8XD 1M1AA 4KUDB 5B33D 2Y2HA 4XZQA 2RIQA 2Y2KA 4H9OB 4X23B 3RELB 4Z5TB 3C1BD 3WA9A 4R8PA 3REID 3AYWA 4LD9A 3X1TA 2HIOC 2G5IC 3B0CW 3AZHC 3KUYA 3AZKA 2F8NK 4QLCC 1P3BC 5B0YB 3AZID 5AV5A 1S32A 5CP6B 3MGSB 1P3AD 2VQRA 4XUJD 3C1CD 2CV5C 1ID3C 4AWLB 4H9PA 3X1UC 5JA4A 4WU9A 3EPLA 5GSUD 1M1AB 1KX4A 3NQJA 4XZQB 1P3MD 5DNMC 5FUGA 5B1LC 3H0LC 4R8PB 5F99D 1P3OA 3AZKB 1B67A 3FDDA 2HIOA 3AN2B 1ZLAC 1HTAA 4QLCA 1P3BA 1PZRA 5AVBC 1P34D 3MGQC 4H9PB 2CV5A 1BFMA 4HGAB 3KXBB 1KX5C 1F66C 5JA4B 4ZUXB 1A7WA 5AV8D 5B24D 3UTBB 1TZYB 2NQBD 4J8UB 4J8WB 4H9RA 3NQJB 4UUZB 3AL0C 4J8VC 3AZMA 1U35C 3B6FB 1P3PA 5JRGB 5FUGB 4WU8D 5DNMA 3TU4C 5B1LA 2HIOB 5B0ZD 3MGPC 5CPKC 3A6NA 3AZHB 2FFFB 4QLCB 4NE5A 5AV9D 5GT0C 2F8NA 5CPJD 3AFAD 2F8NH 3REJD 3WKJD 5AVBA 2CV5B 1ID3B 3LJAD 3KXBD 3AZNC 2HUEC 3MGQA 3UTAD 1EQZD 3W99D 5E5AD 3X1UB 1F66A 3REIC 4H9QA 1AOID 4J8VA 1M19D 2J8PA 3AZIC 1BH8A 3VH6W 5DNMB 5B1LB 3V9RB 3B6GD 3MNNB 4Z66C 3X1SC 1ZLAB 3W97D 5DNNB 1M18D 5B1MB 3AZEC 2F8NB 3MGPA 5CPKA 3AZGD 1P3KC 5BO0B 5AVBB 5GT0A 3LELD 3B0CT 1KX5B 3AZJD 3AZNA 3O62D 3C1BA 3REIA 3H0MC 5B32D 3WA9C 2NZDB 4J8VB 3AYWC 1U35B 1T3UA 3REKB 2F8NG 3KUYC 3AV1C 3AZIA 4KGCD 2DF4C 3NQUA 3TU4B 1N1JB 5GT3C 3WAAD 1P3AA 5B31D 2Y2PA 4JJND 3X1VD 5CPID 4WNNB 3MGPB 5CPKB 2YFWB 4Z66A 3X1SA 3B0BA 3AZEA 5BNXB 5GT0B 2BYMB 3AV2D 1P3FD 2BYKA 3EPJA 5GSUA 5BT1D 1P3KA 5AY8B 3W96D 1KX4C 3AZFB 1P3LB 3AZNB 2HUEB 3KWQD 2Y2NA 1P3ID 4YM6D 2PYOD 2NZDD 3MGRC 5F99A 2FJ7B 2JSSA 1KU5A 1P3OC 3MVDB 2AROD 1HQ3D 2ZY5A 1WWIA 5AV9C 5AV6C 3WTPD 5CPJC 5C3IC 3NQUB 3REHB 3UT9C 3AV1A 3WKJC 3AZLC 1P34A 2YFVA 5GT3A 5B2IC 4Z66B 2ZM5A 3X1SB 4YS3C 1P3GC 3AZEB 2NQBA 5B24A 1P3KB 2BG1A 3AZMC 2UWXA 1P3PC 2IO5B 5B40D 4KUDD 4WU8A 3B6GC 4X23D 1Q9CA 4Z5TD 3LZ0C 2JCHA 3RELD 3WA9B 3AYWB 3MGRA 4LD9B 5B0ZA 3X1TB 5B2JC 4DRAA 4ZBJB 3A6NC 3KUYB 3AV1B 5AV9A 5AV6A 3LELC 5CPJA 5B0YD 5AV5B 5GT3B 3UT9A 1S32B 3REJA 3WKJA 1F1EA 3AZLA 5CP6D 3MGSD 3B0DC 3VH6T 4UPKA 5B2IA 3UTAA 2Y2JA 1EQZA 4YS3A 1P3GA 5B32C 4WU9B 1AOIA 4WJ3C 1M1AD 1KX4B 3LZ1C 1M19A 4CAYA 2L5AA 4XZQD 3W98C 1JFIA 3X1VC 4JJNC 3MGRB 3B6GA 4R8PD 4LD9D 5CPIC 3LZ0A 1P3OB 3VH5W 3EG5B 1KX3C 3W97A 4DQYB 5BNVA 3AZKD 3AV2C 3AN2D 3AZGA 5B2JA 3UT9B 5GXQC 3W96C 3AZLB 1P3BB 4KHAA 5AVCC 3LELA 5B2IB 4J8XC 4YM6C 3AZJA 1P3GB 5B33C 2RVQD 2PYOC 1BH9A 4ZUXD 3UTBD 3R45A 1TZYD 5B32A 3C1BC 2AROC 1HQ3C 4H9RB 4J8UD 4J8WD 3WTPC 3AZMB 4CAYB 1P3PB 3B6FD 3LZ1A 5JRGD 4KGCA 3W98A 3WAAA 2Y2LA 3LZ0B 5B31A 2XD5A 4JJNA 3X1VA 1P3AC 4XUJC 3C1CC 5CPIA 2HIOD 5B2JB 1KX3A 3A6NB 3AZHD 3AV2A 4QLCD 2Y2OA 2Y2GA 5GXQA 3W96A 5GSUC 4G92C 5AVCA 2CV5D 3B0DB 1ID3D 4J8XA 1P3MC 3MGQB 4YM6A 3RELC 4Z5TC 5B33A 3R45B 1F66B 3X1UD 2PYOA 3KFUG 4H9QB 5F99C 1H3OA 1Z2CB 2AROA 1HQ3A 3LZ1B 3WTPA 3W98B 1BH8B 5DNMD 5B1LD 2F2AC 5KDMA 1P34C 2JE5A 2G5HC 3MNND 2ZY4A 4XUJA 4E44A 3C1CA 1ZLAD 5DNND 5B1MD 5AV8C 5B24C 2F8ND 2NQBC 5GXQB 5AVCB 5AVBD 2CWEA 4J8XB 5B33B 3P5JB 1KX5D 4H9OA 1P3MA 3RELA 4Z5TA 4WU8C 3C1BB 3REIB 4J8VD 1U35D 5B0ZC 3AN2C 3REKD 3AZIB 5KDMB 3AFAC 1WWSA 3TU4D 1P3AB 3REJC 3MGSA 1B6WA 3C1CB 2ZY3A 3LJAC 3KXBC 3UTAC 1EQZC 4ZUXC 3W99C 5E5AC 3MGPD 5CPKD 5AV8A 5GT0D 3VH5T 2BYKB 1W2EA 5GSUB 3B6FC 1AOIC 5AY8D 5JRGC 4H9NA 3KSYA 1M19C 3VH6A 4DRBA 3AZFD 3IP4C 1P3LD 1P3MB 3AZND 2LY8A 2Y2IA 2DQNC 4Z2MH 3H0RC 5F99B 3F6TA 2FJ7D 4NFTA 3MVDD 4WV4B 3W97C 5CHLB 3AN2A 1M18C 3AZGC 2W8SA 3REHD 3WTPE 3AFAA 1P34B 2YFVB 3A1KA 4Z66D 3X1SD 3LJAA 3AZJC 3KXBA 5AV8B 3AZED 5B24B 2NQBB 4ZUXA 5E5AA 3W99A 3UTBA 1TZYA 3O62C 4J8UA 1P3KD 4J8WA 4UUZA 4H9NB 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S C;  3B6F A;  5JRG A;  4KGC C;  4WU8 B;  3WAA C;  3MNN C;  5B31 C;  3WA9 D;  3AYW D;  5B0Z B;  5DNN C;  5B1M C;  3X1T D;  4NE3 A;  4CSR A;  3AZH A;  5AV9 B;  5AV6 B;  3KUY D;  3AV1 D;  1M18 A;  3AFA B;  5C3I B;  5CPJ B;  1P3F C;  5BT1 C;  5AV5 D;  5GT3 D;  3REJ B;  5G49 A;  1S32 D;  3WKJ B;  1ID3 A;  3LJA B;  4Z2M G;  3KWQ C;  3UTA B;  1EQZ B;  5E5A B;  1P3I C;  3W99 B;  4YS3 B;  3X1U A;  2NZD C;  3O62 A;  4WU9 D;  1AOI B;  3REK C;  1M19 B;  1KX4 D;  4E45 A;  4H9S A;  1JFI B;  4M6B A;  3V9R A;  4G91 C;  3B6G B;  3MGR D;  3MNN A;  1P3O D;  4CSR B;  3W97 B;  1ZLA A;  1M18 B;  5BNV B;  5DNN A;  5B1M A;  5AV6 D;  3AZG B;  3UT9 D;  5G49 B;  1ULY A;  5BO0 A;  4KHA B;  5AY8 C;  3LEL B;  3AZL D;  1P3B D;  1P3F A;  4NE6 A;  3AZF C;  1P3L C;  5B2I D;  5B40 C;  3AZJ B;  4KUD C;  1KX5 A;  4YS3 D;  1P3G D;  3KWQ A;  1BH9 B;  1P3I A;  4X23 C;  3O62 B;  2FJ7 C;  5B32 B;  2NZD A;  3MVD C;  4EO5 B;  1U35 A;  5BS7 C;  3AZM D;  1P3P D;  3REK A;  3REH C;  4KGC B;  5B0Y C;  3WAA B;  3TU4 A;  1N1J A;  5B31 B;  3LZ0 D;  4JJN B;  3X1V B;  5CP6 C;  3MGS C;  5CPI B;  4WNN A;  2YFW A;  4AWL C;  1KX3 B;  5B2J D;  3A6N D;  3AV2 B;  5BNX A;  1P3F B;  2BYM A;  5B32 G;  1TAF A;  4WZS B;  3W96 B;  5AY8 A;  1M1A C;  2IO5 C;  3AZF A;  1P3L A;  3KWQ B;  4XZQ C;  1P3I B;  5B40 A;  4YM6 B;  4KUD A;  3MGQ D;  1F66 D;  5B31 G;  2PYO B;  3VH5 A;  4R8P C;  4LD9 C;  4X23 A;  3X1T C;  2FJ7 A;  1H3O B;  2ARO B;  1HQ3 B;  3MVD A;  1R4V A;  4ZBJ C;  3WTP B;  5BS7 A;  3LZ1 D;  3AZK C;  3W98 D;  5AV5 C;  3REH A;  1S32 C;  4G91 B;  5B0Y A;  5CP6 A;  4XUJ B;  1KX3 D;  2RVQ C;  4HGA C;  1TAF B;  3UTB C;  4WU9 C;  1TZY C;  5GXQ D;  4J8U C;  5AVC D;  4J8W C;  4G92 B;  5B40 B;  4J8X D;  1M1A A;  4KUD B;  5B33 D;  4XZQ A;  4H9O B;  4X23 B;  3REL B;  4Z5T B;  3C1B D;  3WA9 A;  4R8P A;  3REI D;  3AYW A;  4LD9 A;  3X1T A;  2HIO C;  3B0C W;  3AZH C;  3KUY A;  3AZK A;  2F8N K;  4QLC C;  1P3B C;  5B0Y B;  3AZI D;  5AV5 A;  1S32 A;  5CP6 B;  3MGS B;  1P3A D;  4XUJ D;  3C1C D;  2CV5 C;  1ID3 C;  4AWL B;  4H9P A;  3X1U C;  5JA4 A;  4WU9 A;  5GSU D;  1M1A B;  1KX4 A;  3NQJ A;  4XZQ B;  1P3M D;  5DNM C;  5FUG A;  5B1L C;  4R8P B;  5F99 D;  1P3O A;  3AZK B;  1B67 A;  1ZLA C;  2HIO A;  3AN2 B;  1HTA A;  4QLC A;  1P3B A;  5AVB C;  1P34 D;  3MGQ C;  4H9P B;  2CV5 A;  1BFM A;  4HGA B;  3KXB B;  1KX5 C;  1F66 C;  5JA4 B;  4ZUX B;  1A7W A;  5AV8 D;  5B24 D;  3UTB B;  1TZY B;  2NQB D;  4J8U B;  4J8W B;  4H9R A;  3NQJ B;  4UUZ B;  4J8V C;  3AZM A;  1U35 C;  3B6F B;  1P3P A;  5JRG B;  5FUG B;  4WU8 D;  5DNM A;  3TU4 C;  5B1L A;  2HIO B;  5B0Z D;  3MGP C;  5CPK C;  3A6N A;  3AZH B;  4QLC B;  4NE5 A;  5AV9 D;  5GT0 C;  2F8N A;  5CPJ D;  3AFA D;  2F8N H;  3REJ D;  3WKJ D;  5AVB A;  2CV5 B;  1ID3 B;  3LJA D;  3KXB D;  3AZN C;  2HUE C;  3MGQ A;  3UTA D;  1EQZ D;  3W99 D;  5E5A D;  3X1U B;  1F66 A;  3REI C;  4H9Q A;  1AOI D;  4J8V A;  1M19 D;  3AZI C;  1BH8 A;  3VH6 W;  5DNM B;  5B1L B;  3V9R B;  3B6G D;  3MNN B;  4Z66 C;  3X1S C;  1ZLA B;  3W97 D;  5DNN B;  1M18 D;  5B1M B;  3AZE C;  2F8N B;  3MGP A;  5CPK A;  3AZG D;  1P3K C;  5BO0 B;  5AVB B;  5GT0 A;  3LEL D;  3B0C T;  1KX5 B;  3AZJ D;  3AZN A;  3O62 D;  3C1B A;  3REI A;  2NZD B;  5B32 D;  3WA9 C;  4J8V B;  3AYW C;  1U35 B;  3REK B;  2F8N G;  3KUY C;  3AV1 C;  3AZI A;  4KGC D;  3TU4 B;  3NQU A;  1N1J B;  5GT3 C;  3WAA D;  1P3A A;  5B31 D;  4JJN D;  3X1V D;  5CPI D;  4WNN B;  3MGP B;  5CPK B;  2YFW B;  4Z66 A;  3X1S A;  3B0B A;  3AZE A;  5BNX B;  5GT0 B;  2BYM B;  3AV2 D;  1P3F D;  2BYK A;  5GSU A;  5BT1 D;  1P3K A;  5AY8 B;  3W96 D;  1KX4 C;  3AZF B;  1P3L B;  3AZN B;  2HUE B;  3KWQ D;  1P3I D;  4YM6 D;  2PYO D;  2NZD D;  3MGR C;  5F99 A;  2FJ7 B;  2JSS A;  1KU5 A;  1P3O C;  3MVD B;  2ARO D;  1HQ3 D;  1WWI A;  5AV9 C;  5AV6 C;  3WTP D;  5CPJ C;  5C3I C;  3NQU B;  3REH B;  3UT9 C;  3AV1 A;  3WKJ C;  3AZL C;  1P34 A;  2YFV A;  5GT3 A;  5B2I C;  4Z66 B;  3X1S B;  4YS3 C;  1P3G C;  3AZE B;  2NQB A;  5B24 A;  1P3K B;  3AZM C;  1P3P C;  2IO5 B;  5B40 D;  4KUD D;  4WU8 A;  3B6G C;  4X23 D;  1Q9C A;  4Z5T D;  3LZ0 C;  3REL D;  3WA9 B;  3AYW B;  3MGR A;  4LD9 B;  5B0Z A;  3X1T B;  5B2J C;  4DRA A;  4ZBJ B;  3A6N C;  3KUY B;  3AV1 B;  5AV9 A;  5AV6 A;  3LEL C;  5CPJ A;  5B0Y D;  5AV5 B;  5GT3 B;  3UT9 A;  1S32 B;  3REJ A;  3WKJ A;  1F1E A;  3AZL A;  5CP6 D;  3MGS D;  3B0D C;  3VH6 T;  3UTA A;  5B2I A;  1EQZ A;  4YS3 A;  1P3G A;  5B32 C;  4WU9 B;  1AOI A;  1M1A D;  1KX4 B;  3LZ1 C;  1M19 A;  4CAY A;  2L5A A;  4XZQ D;  3W98 C;  1JFI A;  3X1V C;  4JJN C;  3MGR B;  3B6G A;  4R8P D;  4LD9 D;  5CPI C;  3LZ0 A;  1P3O B;  3VH5 W;  1KX3 C;  3W97 A;  5BNV A;  3AZK D;  3AV2 C;  3AN2 D;  3AZG A;  5B2J A;  3UT9 B;  5GXQ C;  3W96 C;  3AZL B;  1P3B B;  4KHA A;  5AVC C;  3LEL A;  5B2I B;  4J8X C;  4YM6 C;  3AZJ A;  1P3G B;  5B33 C;  2RVQ D;  2PYO C;  1BH9 A;  4ZUX D;  3UTB D;  1TZY D;  3R45 A;  5B32 A;  3C1B C;  2ARO C;  1HQ3 C;  4H9R B;  4J8U D;  4J8W D;  3WTP C;  3AZM B;  4CAY B;  1P3P B;  3B6F D;  3LZ1 A;  5JRG D;  4KGC A;  3W98 A;  3WAA A;  3LZ0 B;  5B31 A;  4JJN A;  3X1V A;  1P3A C;  4XUJ C;  3C1C C;  5CPI A;  2HIO D;  5B2J B;  1KX3 A;  3A6N B;  3AZH D;  3AV2 A;  4QLC D;  5GXQ A;  3W96 A;  5GSU C;  4G92 C;  5AVC A;  2CV5 D;  3B0D B;  1ID3 D;  4J8X A;  1P3M C;  3MGQ B;  4YM6 A;  3REL C;  4Z5T C;  5B33 A;  3R45 B;  1F66 B;  3X1U D;  2PYO A;  4H9Q B;  5F99 C;  1H3O A;  2ARO A;  1HQ3 A;  3LZ1 B;  3WTP A;  3W98 B;  1BH8 B;  5DNM D;  5B1L D;  5KDM A;  1P34 C;  3MNN D;  4XUJ A;  4E44 A;  3C1C A;  1ZLA D;  5DNN D;  5B1M D;  5AV8 C;  5B24 C;  2F8N D;  2NQB C;  5GXQ B;  5AVC B;  5AVB D;  2CWE A;  4J8X B;  5B33 B;  1KX5 D;  4H9O A;  1P3M A;  3REL A;  4Z5T A;  4WU8 C;  3C1B B;  3REI B;  4J8V D;  1U35 D;  5B0Z C;  3AN2 C;  3REK D;  3AZI B;  5KDM B;  3AFA C;  1WWS A;  3TU4 D;  1P3A B;  3REJ C;  3MGS A;  1B6W A;  3C1C B;  3LJA C;  3KXB C;  3UTA C;  1EQZ C;  4ZUX C;  3W99 C;  5E5A C;  3MGP D;  5CPK D;  5AV8 A;  5GT0 D;  3VH5 T;  2BYK B;  5GSU B;  3B6F C;  1AOI C;  5AY8 D;  5JRG C;  4H9N A;  3KSY A;  1M19 C;  3VH6 A;  4DRB A;  3AZF D;  1P3L D;  1P3M B;  3AZN D;  2LY8 A;  4Z2M H;  5F99 B;  2FJ7 D;  4NFT A;  3MVD D;  4WV4 B;  3W97 C;  5CHL B;  3AN2 A;  1M18 C;  3AZG C;  3REH D;  3WTP E;  3AFA A;  1P34 B;  2YFV B;  4Z66 D;  3X1S D;  3LJA A;  3AZJ C;  3KXB A;  5AV8 B;  3AZE D;  5B24 B;  2NQB B;  4ZUX A;  5E5A A;  3W99 A;  3UTB A;  1TZY A;  3O62 C;  4J8U A;  1P3K D;  4J8W A;  4UUZ A;  4H9N B;  4EO5 C; 
#chains in the Genus database with same CATH topology
 4H9S C;  3B6F A;  5JRG A;  4KGC C;  4WU8 B;  3WAA C;  3MNN C;  5B31 C;  3WA9 D;  3AYW D;  5B0Z B;  5DNN C;  5B1M C;  3X1T D;  4NE3 A;  4CSR A;  3AZH A;  5AV9 B;  5AV6 B;  3KUY D;  3AV1 D;  1M18 A;  3AFA B;  5C3I B;  5CPJ B;  1P3F C;  5BT1 C;  5AV5 D;  5GT3 D;  3REJ B;  5G49 A;  1S32 D;  3WKJ B;  1ID3 A;  3LJA B;  4Z2M G;  3KWQ C;  3UTA B;  1EQZ B;  5E5A B;  1P3I C;  3W99 B;  4YS3 B;  3X1U A;  3A1I A;  2NZD C;  3O62 A;  4WU9 D;  1AOI B;  3REK C;  1M19 B;  3EPK A;  1KX4 D;  4E45 A;  4H9S A;  1JFI B;  4M6B A;  3V9R A;  4G91 C;  3B6G B;  3MGR D;  3MNN A;  2Y2Q A;  1P3O D;  4CSR B;  3W97 B;  1ZLA A;  1M18 B;  5BNV B;  5DNN A;  5B1M A;  5AV6 D;  3AZG B;  3UT9 D;  5G49 B;  1ULY A;  5BO0 A;  4KHA B;  5AY8 C;  3LEL B;  3AZL D;  1P3B D;  1P3F A;  4NE6 A;  3AZF C;  1P3L C;  2Y2M A;  5B2I D;  5B40 C;  3AZJ B;  4KUD C;  1KX5 A;  4YS3 D;  1P3G D;  3KWQ A;  1BH9 B;  1P3I A;  4X23 C;  3O62 B;  2FJ7 C;  5B32 B;  2NZD A;  3MVD C;  4EO5 B;  1U35 A;  5BS7 C;  3AZM D;  1P3P D;  3REK A;  3REH C;  4KGC B;  5B0Y C;  2XD1 A;  3TU4 A;  3WAA B;  1N1J A;  5B31 B;  3LZ0 D;  4JJN B;  3X1V B;  5CP6 C;  3MGS C;  5CPI B;  4WNN A;  2YFW A;  4AWL C;  1KX3 B;  5B2J D;  3A6N D;  3AV2 B;  5BNX A;  1P3F B;  2BYM A;  5B32 G;  1TAF A;  4WZS B;  2ZY2 A;  3W96 B;  5AY8 A;  1M1A C;  2IO5 C;  3AZF A;  1P3L A;  3KWQ B;  4XZQ C;  1P3I B;  5B40 A;  4YM6 B;  4KUD A;  3MGQ D;  1F66 D;  5B31 G;  2PYO B;  3VH5 A;  4R8P C;  4LD9 C;  4X23 A;  3EPH A;  3X1T C;  2FJ7 A;  1H3O B;  2ARO B;  1HQ3 B;  3MVD A;  1R4V A;  4ZBJ C;  3WTP B;  5BS7 A;  3LZ1 D;  3AZK C;  3W98 D;  5AV5 C;  3REH A;  1S32 C;  4G91 B;  5B0Y A;  5CP6 A;  4XUJ B;  1KX3 D;  2RVQ C;  4HGA C;  1TAF B;  3UTB C;  4WU9 C;  1TZY C;  5GXQ D;  4J8U C;  5AVC D;  4J8W C;  4G92 B;  5B40 B;  4J8X D;  1M1A A;  4KUD B;  5B33 D;  2Y2H A;  4XZQ A;  2RIQ A;  2Y2K A;  4H9O B;  4X23 B;  3REL B;  4Z5T B;  3C1B D;  3WA9 A;  4R8P A;  3REI D;  3AYW A;  4LD9 A;  3X1T A;  2HIO C;  2G5I C;  3B0C W;  3AZH C;  3KUY A;  3AZK A;  2F8N K;  4QLC C;  1P3B C;  5B0Y B;  3AZI D;  5AV5 A;  1S32 A;  5CP6 B;  3MGS B;  1P3A D;  2VQR A;  4XUJ D;  3C1C D;  2CV5 C;  1ID3 C;  4AWL B;  4H9P A;  3X1U C;  5JA4 A;  4WU9 A;  3EPL A;  5GSU D;  1M1A B;  1KX4 A;  3NQJ A;  4XZQ B;  1P3M D;  5DNM C;  5FUG A;  5B1L C;  3H0L C;  4R8P B;  5F99 D;  1P3O A;  3AZK B;  1B67 A;  3FDD A;  2HIO A;  3AN2 B;  1ZLA C;  1HTA A;  4QLC A;  1P3B A;  1PZR A;  5AVB C;  1P34 D;  3MGQ C;  4H9P B;  2CV5 A;  1BFM A;  4HGA B;  3KXB B;  1KX5 C;  1F66 C;  5JA4 B;  4ZUX B;  1A7W A;  5AV8 D;  5B24 D;  3UTB B;  1TZY B;  2NQB D;  4J8U B;  4J8W B;  4H9R A;  3NQJ B;  4UUZ B;  3AL0 C;  4J8V C;  3AZM A;  1U35 C;  3B6F B;  1P3P A;  5JRG B;  5FUG B;  4WU8 D;  5DNM A;  3TU4 C;  5B1L A;  2HIO B;  5B0Z D;  3MGP C;  5CPK C;  3A6N A;  3AZH B;  2FFF B;  4QLC B;  4NE5 A;  5AV9 D;  5GT0 C;  2F8N A;  5CPJ D;  3AFA D;  2F8N H;  3REJ D;  3WKJ D;  5AVB A;  2CV5 B;  1ID3 B;  3LJA D;  3KXB D;  3AZN C;  2HUE C;  3MGQ A;  3UTA D;  1EQZ D;  3W99 D;  5E5A D;  3X1U B;  1F66 A;  3REI C;  4H9Q A;  1AOI D;  4J8V A;  1M19 D;  2J8P A;  3AZI C;  1BH8 A;  3VH6 W;  5DNM B;  5B1L B;  3V9R B;  3B6G D;  3MNN B;  4Z66 C;  3X1S C;  1ZLA B;  3W97 D;  5DNN B;  1M18 D;  5B1M B;  3AZE C;  2F8N B;  3MGP A;  5CPK A;  3AZG D;  1P3K C;  5BO0 B;  5AVB B;  5GT0 A;  3LEL D;  3B0C T;  1KX5 B;  3AZJ D;  3AZN A;  3O62 D;  3C1B A;  3REI A;  3H0M C;  5B32 D;  3WA9 C;  2NZD B;  4J8V B;  3AYW C;  1U35 B;  1T3U A;  3REK B;  2F8N G;  3KUY C;  3AV1 C;  3AZI A;  4KGC D;  2DF4 C;  3NQU A;  3TU4 B;  1N1J B;  5GT3 C;  3WAA D;  1P3A A;  5B31 D;  2Y2P A;  4JJN D;  3X1V D;  5CPI D;  4WNN B;  3MGP B;  5CPK B;  2YFW B;  4Z66 A;  3X1S A;  3B0B A;  3AZE A;  5BNX B;  5GT0 B;  2BYM B;  3AV2 D;  1P3F D;  2BYK A;  3EPJ A;  5GSU A;  5BT1 D;  1P3K A;  5AY8 B;  3W96 D;  1KX4 C;  3AZF B;  1P3L B;  3AZN B;  2HUE B;  3KWQ D;  2Y2N A;  1P3I D;  4YM6 D;  2PYO D;  2NZD D;  3MGR C;  5F99 A;  2FJ7 B;  2JSS A;  1KU5 A;  1P3O C;  3MVD B;  2ARO D;  1HQ3 D;  2ZY5 A;  1WWI A;  5AV9 C;  5AV6 C;  3WTP D;  5CPJ C;  5C3I C;  3NQU B;  3REH B;  3UT9 C;  3AV1 A;  3WKJ C;  3AZL C;  1P34 A;  2YFV A;  5GT3 A;  5B2I C;  4Z66 B;  2ZM5 A;  3X1S B;  4YS3 C;  1P3G C;  3AZE B;  2NQB A;  5B24 A;  1P3K B;  2BG1 A;  3AZM C;  2UWX A;  1P3P C;  2IO5 B;  5B40 D;  4KUD D;  4WU8 A;  3B6G C;  4X23 D;  1Q9C A;  4Z5T D;  3LZ0 C;  2JCH A;  3REL D;  3WA9 B;  3AYW B;  3MGR A;  4LD9 B;  5B0Z A;  3X1T B;  5B2J C;  4DRA A;  4ZBJ B;  3A6N C;  3KUY B;  3AV1 B;  5AV9 A;  5AV6 A;  3LEL C;  5CPJ A;  5B0Y D;  5AV5 B;  5GT3 B;  3UT9 A;  1S32 B;  3REJ A;  3WKJ A;  1F1E A;  3AZL A;  5CP6 D;  3MGS D;  3B0D C;  3VH6 T;  4UPK A;  5B2I A;  3UTA A;  2Y2J A;  1EQZ A;  4YS3 A;  1P3G A;  5B32 C;  4WU9 B;  1AOI A;  4WJ3 C;  1M1A D;  1KX4 B;  3LZ1 C;  1M19 A;  4CAY A;  2L5A A;  4XZQ D;  3W98 C;  1JFI A;  3X1V C;  4JJN C;  3MGR B;  3B6G A;  4R8P D;  4LD9 D;  5CPI C;  3LZ0 A;  1P3O B;  3VH5 W;  3EG5 B;  1KX3 C;  3W97 A;  4DQY B;  5BNV A;  3AZK D;  3AV2 C;  3AN2 D;  3AZG A;  5B2J A;  3UT9 B;  5GXQ C;  3W96 C;  3AZL B;  1P3B B;  4KHA A;  5AVC C;  3LEL A;  5B2I B;  4J8X C;  4YM6 C;  3AZJ A;  1P3G B;  5B33 C;  2RVQ D;  2PYO C;  1BH9 A;  4ZUX D;  3UTB D;  3R45 A;  1TZY D;  5B32 A;  3C1B C;  2ARO C;  1HQ3 C;  4H9R B;  4J8U D;  4J8W D;  3WTP C;  3AZM B;  4CAY B;  1P3P B;  3B6F D;  3LZ1 A;  5JRG D;  4KGC A;  3W98 A;  3WAA A;  2Y2L A;  3LZ0 B;  5B31 A;  2XD5 A;  4JJN A;  3X1V A;  1P3A C;  4XUJ C;  3C1C C;  5CPI A;  2HIO D;  5B2J B;  1KX3 A;  3A6N B;  3AZH D;  3AV2 A;  4QLC D;  2Y2O A;  2Y2G A;  5GXQ A;  3W96 A;  5GSU C;  4G92 C;  5AVC A;  2CV5 D;  3B0D B;  1ID3 D;  4J8X A;  1P3M C;  3MGQ B;  4YM6 A;  3REL C;  4Z5T C;  5B33 A;  3R45 B;  1F66 B;  3X1U D;  2PYO A;  3KFU G;  4H9Q B;  5F99 C;  1H3O A;  1Z2C B;  2ARO A;  1HQ3 A;  3LZ1 B;  3WTP A;  3W98 B;  1BH8 B;  5DNM D;  5B1L D;  2F2A C;  5KDM A;  1P34 C;  2JE5 A;  2G5H C;  3MNN D;  2ZY4 A;  4XUJ A;  4E44 A;  3C1C A;  1ZLA D;  5DNN D;  5B1M D;  5AV8 C;  5B24 C;  2F8N D;  2NQB C;  5GXQ B;  5AVC B;  5AVB D;  2CWE A;  4J8X B;  5B33 B;  3P5J B;  1KX5 D;  4H9O A;  1P3M A;  3REL A;  4Z5T A;  4WU8 C;  3C1B B;  3REI B;  4J8V D;  1U35 D;  5B0Z C;  3AN2 C;  3REK D;  3AZI B;  5KDM B;  3AFA C;  1WWS A;  3TU4 D;  1P3A B;  3REJ C;  3MGS A;  1B6W A;  3C1C B;  2ZY3 A;  3LJA C;  3KXB C;  3UTA C;  1EQZ C;  4ZUX C;  3W99 C;  5E5A C;  3MGP D;  5CPK D;  5AV8 A;  5GT0 D;  3VH5 T;  2BYK B;  1W2E A;  5GSU B;  3B6F C;  1AOI C;  5AY8 D;  5JRG C;  4H9N A;  3KSY A;  1M19 C;  3VH6 A;  4DRB A;  3AZF D;  3IP4 C;  1P3L D;  1P3M B;  3AZN D;  2LY8 A;  2Y2I A;  2DQN C;  4Z2M H;  3H0R C;  5F99 B;  3F6T A;  2FJ7 D;  4NFT A;  3MVD D;  4WV4 B;  3W97 C;  5CHL B;  3AN2 A;  1M18 C;  3AZG C;  2W8S A;  3REH D;  3WTP E;  3AFA A;  1P34 B;  2YFV B;  3A1K A;  4Z66 D;  3X1S D;  3LJA A;  3AZJ C;  3KXB A;  5AV8 B;  3AZE D;  5B24 B;  2NQB B;  4ZUX A;  5E5A A;  3W99 A;  3UTB A;  1TZY A;  3O62 C;  4J8U A;  1P3K D;  4J8W A;  4UUZ A;  4H9N B;  4EO5 C; 
#chains in the Genus database with same CATH homology
 4H9S C;  3B6F A;  5JRG A;  4KGC C;  4WU8 B;  3WAA C;  3MNN C;  5B31 C;  3WA9 D;  3AYW D;  5B0Z B;  5DNN C;  5B1M C;  3X1T D;  4NE3 A;  4CSR A;  3AZH A;  5AV9 B;  5AV6 B;  3KUY D;  3AV1 D;  1M18 A;  3AFA B;  5C3I B;  5CPJ B;  1P3F C;  5BT1 C;  5AV5 D;  5GT3 D;  3REJ B;  5G49 A;  1S32 D;  3WKJ B;  1ID3 A;  3LJA B;  4Z2M G;  3KWQ C;  3UTA B;  1EQZ B;  5E5A B;  1P3I C;  3W99 B;  4YS3 B;  3X1U A;  3A1I A;  2NZD C;  3O62 A;  4WU9 D;  1AOI B;  3REK C;  1M19 B;  3EPK A;  1KX4 D;  4E45 A;  4H9S A;  1JFI B;  4M6B A;  3V9R A;  4G91 C;  3B6G B;  3MGR D;  3MNN A;  2Y2Q A;  1P3O D;  4CSR B;  3W97 B;  1ZLA A;  1M18 B;  5BNV B;  5DNN A;  5B1M A;  5AV6 D;  3AZG B;  3UT9 D;  5G49 B;  1ULY A;  5BO0 A;  4KHA B;  5AY8 C;  3LEL B;  3AZL D;  1P3B D;  1P3F A;  4NE6 A;  3AZF C;  1P3L C;  2Y2M A;  5B2I D;  5B40 C;  3AZJ B;  4KUD C;  1KX5 A;  4YS3 D;  1P3G D;  3KWQ A;  1BH9 B;  1P3I A;  4X23 C;  3O62 B;  2FJ7 C;  5B32 B;  2NZD A;  3MVD C;  4EO5 B;  1U35 A;  5BS7 C;  3AZM D;  1P3P D;  3REK A;  3REH C;  4KGC B;  5B0Y C;  2XD1 A;  3TU4 A;  3WAA B;  1N1J A;  5B31 B;  3LZ0 D;  4JJN B;  3X1V B;  5CP6 C;  3MGS C;  5CPI B;  4WNN A;  2YFW A;  4AWL C;  1KX3 B;  5B2J D;  3A6N D;  3AV2 B;  5BNX A;  1P3F B;  2BYM A;  5B32 G;  1TAF A;  4WZS B;  2ZY2 A;  3W96 B;  5AY8 A;  1M1A C;  2IO5 C;  3AZF A;  1P3L A;  3KWQ B;  4XZQ C;  1P3I B;  5B40 A;  4YM6 B;  4KUD A;  3MGQ D;  1F66 D;  5B31 G;  2PYO B;  3VH5 A;  4R8P C;  4LD9 C;  4X23 A;  3EPH A;  3X1T C;  2FJ7 A;  1H3O B;  2ARO B;  1HQ3 B;  3MVD A;  1R4V A;  4ZBJ C;  3WTP B;  5BS7 A;  3LZ1 D;  3AZK C;  3W98 D;  5AV5 C;  3REH A;  1S32 C;  4G91 B;  5B0Y A;  5CP6 A;  4XUJ B;  1KX3 D;  2RVQ C;  4HGA C;  1TAF B;  3UTB C;  4WU9 C;  1TZY C;  5GXQ D;  4J8U C;  5AVC D;  4J8W C;  4G92 B;  5B40 B;  4J8X D;  1M1A A;  4KUD B;  5B33 D;  2Y2H A;  4XZQ A;  2RIQ A;  2Y2K A;  4H9O B;  4X23 B;  3REL B;  4Z5T B;  3C1B D;  3WA9 A;  4R8P A;  3REI D;  3AYW A;  4LD9 A;  3X1T A;  2HIO C;  2G5I C;  3B0C W;  3AZH C;  3KUY A;  3AZK A;  2F8N K;  4QLC C;  1P3B C;  5B0Y B;  3AZI D;  5AV5 A;  1S32 A;  5CP6 B;  3MGS B;  1P3A D;  2VQR A;  4XUJ D;  3C1C D;  2CV5 C;  1ID3 C;  4AWL B;  4H9P A;  3X1U C;  5JA4 A;  4WU9 A;  3EPL A;  5GSU D;  1M1A B;  1KX4 A;  3NQJ A;  4XZQ B;  1P3M D;  5DNM C;  5FUG A;  5B1L C;  3H0L C;  4R8P B;  5F99 D;  1P3O A;  3AZK B;  1B67 A;  3FDD A;  2HIO A;  3AN2 B;  1ZLA C;  1HTA A;  4QLC A;  1P3B A;  1PZR A;  5AVB C;  1P34 D;  3MGQ C;  4H9P B;  2CV5 A;  1BFM A;  4HGA B;  3KXB B;  1KX5 C;  1F66 C;  5JA4 B;  4ZUX B;  1A7W A;  5AV8 D;  5B24 D;  3UTB B;  1TZY B;  2NQB D;  4J8U B;  4J8W B;  4H9R A;  3NQJ B;  4UUZ B;  3AL0 C;  4J8V C;  3AZM A;  1U35 C;  3B6F B;  1P3P A;  5JRG B;  5FUG B;  4WU8 D;  5DNM A;  3TU4 C;  5B1L A;  2HIO B;  5B0Z D;  3MGP C;  5CPK C;  3A6N A;  3AZH B;  2FFF B;  4QLC B;  4NE5 A;  5AV9 D;  5GT0 C;  2F8N A;  5CPJ D;  3AFA D;  2F8N H;  3REJ D;  3WKJ D;  5AVB A;  2CV5 B;  1ID3 B;  3LJA D;  3KXB D;  3AZN C;  2HUE C;  3MGQ A;  3UTA D;  1EQZ D;  3W99 D;  5E5A D;  3X1U B;  1F66 A;  3REI C;  4H9Q A;  1AOI D;  4J8V A;  1M19 D;  2J8P A;  3AZI C;  1BH8 A;  3VH6 W;  5DNM B;  5B1L B;  3V9R B;  3B6G D;  3MNN B;  4Z66 C;  3X1S C;  1ZLA B;  3W97 D;  5DNN B;  1M18 D;  5B1M B;  3AZE C;  2F8N B;  3MGP A;  5CPK A;  3AZG D;  1P3K C;  5BO0 B;  5AVB B;  5GT0 A;  3LEL D;  3B0C T;  1KX5 B;  3AZJ D;  3AZN A;  3O62 D;  3C1B A;  3REI A;  3H0M C;  5B32 D;  3WA9 C;  2NZD B;  4J8V B;  3AYW C;  1U35 B;  1T3U A;  3REK B;  2F8N G;  3KUY C;  3AV1 C;  3AZI A;  4KGC D;  2DF4 C;  3NQU A;  3TU4 B;  1N1J B;  5GT3 C;  3WAA D;  1P3A A;  5B31 D;  2Y2P A;  4JJN D;  3X1V D;  5CPI D;  4WNN B;  3MGP B;  5CPK B;  2YFW B;  4Z66 A;  3X1S A;  3B0B A;  3AZE A;  5BNX B;  5GT0 B;  2BYM B;  3AV2 D;  1P3F D;  2BYK A;  3EPJ A;  5GSU A;  5BT1 D;  1P3K A;  5AY8 B;  3W96 D;  1KX4 C;  3AZF B;  1P3L B;  3AZN B;  2HUE B;  3KWQ D;  2Y2N A;  1P3I D;  4YM6 D;  2PYO D;  2NZD D;  3MGR C;  5F99 A;  2FJ7 B;  2JSS A;  1KU5 A;  1P3O C;  3MVD B;  2ARO D;  1HQ3 D;  2ZY5 A;  1WWI A;  5AV9 C;  5AV6 C;  3WTP D;  5CPJ C;  5C3I C;  3NQU B;  3REH B;  3UT9 C;  3AV1 A;  3WKJ C;  3AZL C;  1P34 A;  2YFV A;  5GT3 A;  5B2I C;  4Z66 B;  2ZM5 A;  3X1S B;  4YS3 C;  1P3G C;  3AZE B;  2NQB A;  5B24 A;  1P3K B;  2BG1 A;  3AZM C;  2UWX A;  1P3P C;  2IO5 B;  5B40 D;  4KUD D;  4WU8 A;  3B6G C;  4X23 D;  1Q9C A;  4Z5T D;  3LZ0 C;  2JCH A;  3REL D;  3WA9 B;  3AYW B;  3MGR A;  4LD9 B;  5B0Z A;  3X1T B;  5B2J C;  4DRA A;  4ZBJ B;  3A6N C;  3KUY B;  3AV1 B;  5AV9 A;  5AV6 A;  3LEL C;  5CPJ A;  5B0Y D;  5AV5 B;  5GT3 B;  3UT9 A;  1S32 B;  3REJ A;  3WKJ A;  1F1E A;  3AZL A;  5CP6 D;  3MGS D;  3B0D C;  3VH6 T;  4UPK A;  5B2I A;  3UTA A;  2Y2J A;  1EQZ A;  4YS3 A;  1P3G A;  5B32 C;  4WU9 B;  1AOI A;  4WJ3 C;  1M1A D;  1KX4 B;  3LZ1 C;  1M19 A;  4CAY A;  2L5A A;  4XZQ D;  3W98 C;  1JFI A;  3X1V C;  4JJN C;  3MGR B;  3B6G A;  4R8P D;  4LD9 D;  5CPI C;  3LZ0 A;  1P3O B;  3VH5 W;  3EG5 B;  1KX3 C;  3W97 A;  4DQY B;  5BNV A;  3AZK D;  3AV2 C;  3AN2 D;  3AZG A;  5B2J A;  3UT9 B;  5GXQ C;  3W96 C;  3AZL B;  1P3B B;  4KHA A;  5AVC C;  3LEL A;  5B2I B;  4J8X C;  4YM6 C;  3AZJ A;  1P3G B;  5B33 C;  2RVQ D;  2PYO C;  1BH9 A;  4ZUX D;  3UTB D;  3R45 A;  1TZY D;  5B32 A;  3C1B C;  2ARO C;  1HQ3 C;  4H9R B;  4J8U D;  4J8W D;  3WTP C;  3AZM B;  4CAY B;  1P3P B;  3B6F D;  3LZ1 A;  5JRG D;  4KGC A;  3W98 A;  3WAA A;  2Y2L A;  3LZ0 B;  5B31 A;  2XD5 A;  4JJN A;  3X1V A;  1P3A C;  4XUJ C;  3C1C C;  5CPI A;  2HIO D;  5B2J B;  1KX3 A;  3A6N B;  3AZH D;  3AV2 A;  4QLC D;  2Y2O A;  2Y2G A;  5GXQ A;  3W96 A;  5GSU C;  4G92 C;  5AVC A;  2CV5 D;  3B0D B;  1ID3 D;  4J8X A;  1P3M C;  3MGQ B;  4YM6 A;  3REL C;  4Z5T C;  5B33 A;  3R45 B;  1F66 B;  3X1U D;  2PYO A;  3KFU G;  4H9Q B;  5F99 C;  1H3O A;  1Z2C B;  2ARO A;  1HQ3 A;  3LZ1 B;  3WTP A;  3W98 B;  1BH8 B;  5DNM D;  5B1L D;  2F2A C;  5KDM A;  1P34 C;  2JE5 A;  2G5H C;  3MNN D;  2ZY4 A;  4XUJ A;  4E44 A;  3C1C A;  1ZLA D;  5DNN D;  5B1M D;  5AV8 C;  5B24 C;  2F8N D;  2NQB C;  5GXQ B;  5AVC B;  5AVB D;  2CWE A;  4J8X B;  5B33 B;  3P5J B;  1KX5 D;  4H9O A;  1P3M A;  3REL A;  4Z5T A;  4WU8 C;  3C1B B;  3REI B;  4J8V D;  1U35 D;  5B0Z C;  3AN2 C;  3REK D;  3AZI B;  5KDM B;  3AFA C;  1WWS A;  3TU4 D;  1P3A B;  3REJ C;  3MGS A;  1B6W A;  3C1C B;  2ZY3 A;  3LJA C;  3KXB C;  3UTA C;  1EQZ C;  4ZUX C;  3W99 C;  5E5A C;  3MGP D;  5CPK D;  5AV8 A;  5GT0 D;  3VH5 T;  2BYK B;  1W2E A;  5GSU B;  3B6F C;  1AOI C;  5AY8 D;  5JRG C;  4H9N A;  3KSY A;  1M19 C;  3VH6 A;  4DRB A;  3AZF D;  3IP4 C;  1P3L D;  1P3M B;  3AZN D;  2LY8 A;  2Y2I A;  2DQN C;  4Z2M H;  3H0R C;  5F99 B;  3F6T A;  2FJ7 D;  4NFT A;  3MVD D;  4WV4 B;  3W97 C;  5CHL B;  3AN2 A;  1M18 C;  3AZG C;  2W8S A;  3REH D;  3WTP E;  3AFA A;  1P34 B;  2YFV B;  3A1K A;  4Z66 D;  3X1S D;  3LJA A;  3AZJ C;  3KXB A;  5AV8 B;  3AZE D;  5B24 B;  2NQB B;  4ZUX A;  5E5A A;  3W99 A;  3UTB A;  1TZY A;  3O62 C;  4J8U A;  1P3K D;  4J8W A;  4UUZ A;  4H9N B;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...