1P3OB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGAKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oB00
1TZYB 4QLCC 5DNNA 5GSUD 5B2IC 5CPJD 4WU9B 3X1SB 3AZEC 5GT0C 4ZBJC 4YS3A 4R8PA 3MNNB 3MVDA 3X1VA 1B67A 3R45B 3C1BB 5GSUC 4LD9B 4X23A 3REJC 3UTBD 1P3MD 3AZMB 4J8WD 5GXQC 1EQZC 3WAAD 5B31D 3B6FA 4NE3A 4ZUXD 1ID3D 3UTBC 1P3MC 4M6BA 1AOID 3AZID 2PYOD 4XUJD 4NE5A 4J8WC 3KWQB 1P3ID 3B0CW 3W97B 1TZYD 3VH6A 4WU9D 3LJAD 2FJ7A 3V9RB 4XUJC 1S32A 3MGSB 3WKJA 5AV6C 5B1LA 1KX3B 5B33C 3MNND 3AV1A 1TZYC 1JFIB 2L5AA 4KUDB 3LJAC 1P3BA 5BNVA 1M1AA 3AZMD 1P3LB 2CV5A 4J8XA 5B0ZA 3VH5W 3O62B 1WWIA 3WTPD 2YFVB 3KXBA 5C3IB 3KWQD 3RELC 1P3OA 1KX5C 4UUZA 5G49B 3REIC 3C1CC 3W97D 1P34A 5JRGD 3WTPC 3UT9A 3MGSD 3KWQC 3B6GB 5AVCA 5BNXB 4J8UB 1HQ3B 4KUDD 5E5AC 5JRGC 1P3KC 1P3LD 5B1MB 5FUGA 2YFWB 4R8PB 4Z66B 3AFAA 3MGRB 4G91C 5AV8A 4XZQB 3O62D 4WU8A 1P3PA 3VH5A 5DNMA 3AZLC 1H3OB 1BFMA 3TU4B 3REHC 5B40C 4JJND 5AVBB 3LZ0B 3AZHC 3AV2C 2F8NB 3A6NC 4J8VA 3X1TC 3AN2A 1U35C 4YM6C 3UTAA 4CSRB 5CPIA 4H9SA 4QLCB 2HIOC 5B2IB 4JJNC 3B6GD 4NE6A 3X1UD 3W98A 5DNND 5AY8A 5B31G 1HQ3D 3NQJB 4J8UD 5GT0B 4ZBJB 3REKA 3AZEB 5GT3C 5B24C 4DRAA 5B1MD 3AYWC 5GSUB 2BYMA 4R8PD 3KUYA 3MVDD 3REJB 3X1UC 5DNNC 3MGRD 5GXQB 5BS7A 1EQZB 5B0YA 4EO5C 1P3GC 1M1AB 2JSSA 1BH9A 4YS3C 1HTAA 5AV5A 1F66A 3AZGA 5AVBD 3LZ0D 3MVDC 3X1VC 1P3MB 2F8ND 4X23C 5CPKA 2IO5C 4H9NA 5B32A 1KX4A 4QLCD 3B6FC 5B2ID 1P3OB 5B2JA 4XUJB 5AV6B 5GT0D 2NZDA 5B33B 3AZJC 1ZLAA 1S32D 3WKJD 5BT1C 3LJAB 3W96A 1P3GA 3REJD 3AV1D 1ULYA 2FJ7C 4H9QB 5GXQD 1EQZD 1M1AD 1S32C 3WKJC 5FUGB 5B1LC 3AV1C 2AROA 1P3BC 3RELB 1M1AC 1KX5B 2NQBA 3REIB 3C1CB 2CV5C 4CAYA 4J8XC 5B0ZC 1P3OD 4WV4B 1N1JB 1P3AA 3WTPB 3AZJA 3AZFA 5AV6D 1P34D 5B33D 3MGQA 5AV9A 3KXBC 3AZKA 1P3OC 5E5AB 4DRBA 5JRGB 1BH8B 3WA9A 1P3KB 1M18A 5CP6A 1P34C 5JA4A 3UT9C 4G91B 3MGPA 3W99A 5AVCC 3KUYB 4KHAB 3AZLB 5B0YB 5B40B 3REHB 3RELD 1KX5D 3LZ1A 3REID 3AZHB 3A6NB 4WNNB 4Z5TA 3C1CD 3AV2B 3X1TB 1F66B 1Q9CA 3AFAC 1U35B 4YM6B 5AV8C 3LELA 2HIOB 4JJNB 4WU8C 3WTPE 1TAFB 5CPJA 5DNMC 1P3PC 1P3FA 1M19A 4H9RB 5E5AD 5BO0B 5GT3B 5B24B 1P3KD 4J8VC 3W98D 3REKD 3AYWB 4H9OB 3NQUB 3AN2C 2F8NG 3UTAC 5CPIC 4H9SC 3X1UB 5DNNB 4AWLC 4EO5B 3KUYD 1P3GB 3WAAA 3W98C 5AY8C 3REKC 4YS3B 3AZLD 5B0YD 5B40D 4H9PA 3REHD 4ZUXA 3MVDB 3X1VB 3VH6T 3AZHD 3AV2D 1ID3A 3A6ND 5AV5D 4X23B 1AOIA 1A7WA 2LY8A 5F99A 3X1TD 2IO5B 3KUYC 3AZIA 1F66D 2PYOA 1U35D 2HUEC 4YM6D 1P3IA 5BS7C 5KDMA 5B0YC 3B6FB 2HIOD 4WU9A 4HGAC 5AV5C 3X1SA 1F66C 3AZGC 5GT3D 3AZJB 5B24D 3AYWD 3MNNA 5B32C 5CPKC 3C1BA 4LD9A 1ZLAD 2RVQD 1KX4C 2FJ7B 3AZMA 1P3GD 5B2JC 1S32B 3WKJB 5CP6B 4YS3D 2NZDC 5B1LB 1ZLAC 2RVQC 3AV1B 3X1VD 3B0CT 4X23D 3W96C 1P3BB 5BNVB 4KGCC 1F1EA 2CV5B 3B6FD 4J8XB 3W97A 5B0ZB 4Z2MG 3MGSA 3AZJD 1KX3A 3KSYA 2AROC 5BT1D 3KXBB 3AZFD 4UUZB 1JFIA 2NQBC 4KUDA 1M19B 2FJ7D 1P3LA 1P34B 3VH5T 1P3AC 4G92C 3UT9B 3AZFC 5CP6D 5B1LD 5AVCB 3MGQC 5AV9C 4KGCA 3O62A 3AZKC 3MGPD 1P3BD 3WA9C 2YFVA 1M18C 4NFTA 5CP6C 5G49A 2CV5D 4J8XD 5B0ZD 3LZ1D 3AFAB 5AV8B 3MGPC 3W99C 4WU8B 1P3PB 5DNMB 3B6GA 3KXBD 5BNXA 3LZ1C 1HQ3A 4J8UA 4Z5TC 4J8VB 1P3FD 1M19D 3B0BA 5B1MA 3AN2B 3UTAB 3UT9D 2YFWA 5CPIB 3LELC 4Z66A 2F8NH 4AWLB 5AVCD 3MGRA 5CPJC 4XZQA 3W98B 5AY8B 3REKB 3AZNA 1P3FC 5B32G 1M19C 1H3OA 3TU4A 2F8NK 3B0DC 5AVBA 3LZ0A 2BYMB 2F8NA 3AFAD 2HUEB 5AV8D 5F99D 4CSRA 3WAAC 4QLCA 5B31C 4WU8D 5B2IA 1P3PD 5DNMD 1BH9B 4HGAB 5AV5B 3AZGB 4ZUXC 2BYKA 3NQJA 3AZEA 1ID3C 5GT0A 4J8VD 1AOIC 3X1SD 5F99C 3AZIC 5CPKB 5B32B 4H9NB 2PYOC 5GSUA 3AN2D 3UTAD 1P3IC 1KX4B 5CPID 4E44A 3REJA 3C1BD 4LD9D 4WU9C 5B2JB 5GXQA 1EQZA 5AY8D 3X1SC 2NZDB 1KU5A 1ZLAB 3MNNC 3UTBA 1P3MA 3C1BC 3W96B 4LD9C 4J8WA 4KGCB 5B31A 1WWSA 3AZMC 3AZGD 4XUJA 5AV6A 4Z2MH 5CHLB 2AROB 5B33A 5CPKD 5B32D 1TZYA 2NQBB 3LJAA 1KX4D 1KX3D 4CAYB 3W97C 1P3AB 4H9QA 5B2JD 4G92B 3AZFB 2NZDD 3MGSC 3R45A 3MGQB 1KX3C 5AV9B 3AZKB 3W96D 4KUDC 3WA9B 4KGCD 1M18B 3RELA 3AZNB 1KX5A 1P3LC 3REIA 3C1CA 5JA4B 4E45A 1N1JA 3MGPB 3WTPA 3W99B 3KWQA 3O62C 2AROD 3X1UA 5C3IC 2NQBD 3LZ1B 4Z5TB 3V9RA 5E5AA 5JRGA 1BH8A 1P3KA 1R4VA 2BYKB 1P3AD 3LELB 3MGQD 5CPJB 5AV9D 3B6GC 4Z66D 3AZKD 1P3FB 4KHAA 4J8UC 1HQ3C 3WA9D 3AZLA 4XZQD 1M18D 5B40A 3REHA 3AZND 1B6WA 3B0DB 5B1MC 3AZHA 3AV2A 3A6NA 4WNNA 3TU4D 3X1TA 4R8PC 4Z66C 3UTBB 3W99D 1U35A 3MGRC 4YM6A 4J8WB 3WAAB 4XZQC 5B31B 2HIOA 4JJNA 3AZNC 1TAFA 4H9PB 4ZUXB 3TU4C 1ID3B 5AVBC 4Z5TD 3LZ0C 4H9RA 5BO0A 5GT3A 1AOIB 5F99B 5B24A 3AZIB 2PYOB 3AYWA 3AZED 4H9OA 3VH6W 1P3IB 5KDMB 3NQUA 3LELD 2CWEA 4WZSB
chains in the Genus database with same CATH superfamily
1TZYB 4QLCC 5DNNA 5GSUD 5B2IC 5CPJD 4WU9B 3X1SB 3AZEC 5GT0C 4ZBJC 4YS3A 4R8PA 3MNNB 3MVDA 3X1VA 1B67A 3R45B 3C1BB 2FFFB 5GSUC 4LD9B 4X23A 3REJC 3UTBD 1P3MD 3AZMB 4J8WD 5GXQC 1EQZC 3WAAD 5B31D 3B6FA 2DQNC 4NE3A 1Z2CB 2VQRA 4ZUXD 1ID3D 3UTBC 1P3MC 4M6BA 1AOID 3AZID 2PYOD 4XUJD 4NE5A 4J8WC 3KWQB 1P3ID 2J8PA 3B0CW 3W97B 1TZYD 3VH6A 4WU9D 3LJAD 2FJ7A 3V9RB 4XUJC 1S32A 3MGSB 3WKJA 5AV6C 5B1LA 1KX3B 5B33C 2XD1A 3MNND 3AV1A 1TZYC 1JFIB 2L5AA 4KUDB 3LJAC 1P3BA 5BNVA 1M1AA 3AZMD 1P3LB 2CV5A 4J8XA 5B0ZA 2Y2NA 2Y2KA 3VH5W 3O62B 1WWIA 3WTPD 2Y2HA 2YFVB 3KXBA 5C3IB 3KWQD 3RELC 1P3OA 1KX5C 4UUZA 5G49B 3REIC 3C1CC 3W97D 1P34A 5JRGD 3WTPC 3UT9A 3MGSD 3KWQC 3B6GB 5AVCA 5BNXB 3P5JB 4J8UB 1HQ3B 4KUDD 5E5AC 5JRGC 3EG5B 1P3KC 1P3LD 5B1MB 5FUGA 2YFWB 4R8PB 4Z66B 3AFAA 3MGRB 4G91C 5AV8A 4XZQB 3O62D 4WU8A 1P3PA 3VH5A 5DNMA 3AZLC 1H3OB 1BFMA 3TU4B 3REHC 5B40C 4JJND 5AVBB 3LZ0B 3AZHC 3AV2C 2F8NB 3A6NC 2W8SA 4J8VA 3X1TC 3IP4C 3AN2A 1U35C 4YM6C 3UTAA 4CSRB 5CPIA 4H9SA 4QLCB 2HIOC 5B2IB 4JJNC 3B6GD 3EPJA 3KFUG 4NE6A 3X1UD 3W98A 5DNND 5AY8A 5B31G 1HQ3D 3NQJB 4J8UD 5GT0B 4ZBJB 3REKA 3AZEB 5GT3C 5B24C 4DRAA 2JCHA 2Y2QA 5B1MD 3AYWC 5GSUB 2BYMA 4R8PD 3KUYA 3MVDD 3REJB 3X1UC 5DNNC 3MGRD 5GXQB 5BS7A 1EQZB 5B0YA 4EO5C 1P3GC 1M1AB 2JSSA 1BH9A 3EPKA 4YS3C 1HTAA 5AV5A 3AL0C 1F66A 3AZGA 5AVBD 3LZ0D 3MVDC 3X1VC 1P3MB 2F8ND 4X23C 5CPKA 2IO5C 4H9NA 5B32A 1KX4A 4QLCD 3B6FC 5B2ID 1P3OB 3A1KA 4UPKA 5B2JA 4XUJB 5AV6B 5GT0D 2NZDA 5B33B 3AZJC 4DQYB 1ZLAA 1S32D 3WKJD 5BT1C 3LJAB 3W96A 1P3GA 3REJD 3AV1D 1ULYA 2FJ7C 4H9QB 5GXQD 1EQZD 1M1AD 1S32C 3WKJC 5FUGB 5B1LC 3AV1C 2AROA 1P3BC 3RELB 1M1AC 1KX5B 2NQBA 3REIB 3C1CB 2CV5C 4CAYA 4J8XC 5B0ZC 1P3OD 4WV4B 1N1JB 1P3AA 3WTPB 3AZJA 1W2EA 3AZFA 5AV6D 1P34D 5B33D 3MGQA 5AV9A 3KXBC 3AZKA 1P3OC 5E5AB 4DRBA 5JRGB 1BH8B 3WA9A 1P3KB 1M18A 5CP6A 1P34C 2Y2JA 5JA4A 3UT9C 4G91B 3MGPA 3W99A 5AVCC 3KUYB 4KHAB 3AZLB 5B0YB 5B40B 3REHB 3RELD 1KX5D 3LZ1A 3REID 3AZHB 3A6NB 4WNNB 2RIQA 4Z5TA 3C1CD 3AV2B 3X1TB 1F66B 1Q9CA 2Y2PA 3AFAC 1U35B 4YM6B 5AV8C 3LELA 2HIOB 4WJ3C 4JJNB 4WU8C 3WTPE 1TAFB 5CPJA 5DNMC 1P3PC 2ZY3A 1P3FA 1M19A 4H9RB 5E5AD 5BO0B 5GT3B 5B24B 1P3KD 4J8VC 3W98D 3REKD 3AYWB 4H9OB 3NQUB 3AN2C 2F8NG 2XD5A 3UTAC 5CPIC 4H9SC 3X1UB 5DNNB 4AWLC 4EO5B 3KUYD 1P3GB 3WAAA 3W98C 5AY8C 3REKC 4YS3B 3AZLD 5B0YD 5B40D 4H9PA 3REHD 4ZUXA 3MVDB 3X1VB 3VH6T 3AZHD 3AV2D 1ID3A 3A6ND 5AV5D 2G5HC 4X23B 1T3UA 1AOIA 1A7WA 2LY8A 5F99A 3X1TD 2IO5B 3KUYC 3AZIA 1F66D 2PYOA 1U35D 2HUEC 4YM6D 1P3IA 5BS7C 5KDMA 5B0YC 3B6FB 2HIOD 4WU9A 4HGAC 5AV5C 3X1SA 1F66C 3AZGC 5GT3D 3AZJB 5B24D 3AYWD 3MNNA 5B32C 5CPKC 3C1BA 4LD9A 1ZLAD 2RVQD 1KX4C 2FJ7B 3AZMA 2ZY2A 1P3GD 5B2JC 1S32B 3WKJB 2Y2OA 5CP6B 4YS3D 2NZDC 5B1LB 1ZLAC 2RVQC 3AV1B 3X1VD 3B0CT 4X23D 3W96C 1P3BB 5BNVB 4KGCC 1F1EA 2CV5B 3B6FD 4J8XB 3W97A 5B0ZB 4Z2MG 3MGSA 2ZY4A 3AZJD 1KX3A 3KSYA 2AROC 5BT1D 3KXBB 3AZFD 4UUZB 1JFIA 2NQBC 4KUDA 2Y2LA 1M19B 4WZSB 2FJ7D 1P3LA 1P34B 3VH5T 1P3AC 4G92C 2BG1A 2ZM5A 3UT9B 3AZFC 5CP6D 5B1LD 5AVCB 3MGQC 5AV9C 4KGCA 3O62A 3AZKC 3MGPD 1P3BD 3WA9C 2YFVA 1M18C 4NFTA 5CP6C 5G49A 2CV5D 4J8XD 5B0ZD 3LZ1D 3AFAB 5AV8B 3MGPC 3W99C 1PZRA 4WU8B 1P3PB 5DNMB 3B6GA 3KXBD 5BNXA 3LZ1C 1HQ3A 4J8UA 4Z5TC 4J8VB 1P3FD 1M19D 3B0BA 5B1MA 3AN2B 3UTAB 3UT9D 2YFWA 5CPIB 3LELC 4Z66A 2F8NH 3FDDA 4AWLB 5AVCD 3MGRA 5CPJC 4XZQA 3W98B 5AY8B 3REKB 3AZNA 1P3FC 5B32G 1M19C 1H3OA 3TU4A 2F8NK 5AVBA 3B0DC 3LZ0A 2BYMB 2F8NA 3F6TA 2DF4C 3AFAD 2HUEB 5AV8D 5F99D 4CSRA 3WAAC 4QLCA 5B31C 4WU8D 5B2IA 1P3PD 5DNMD 1BH9B 2Y2MA 4HGAB 5AV5B 2G5IC 2JE5A 3AZGB 4ZUXC 2BYKA 2ZY5A 3NQJA 3AZEA 5GT0A 1ID3C 4J8VD 1AOIC 3X1SD 5F99C 3AZIC 5CPKB 5B32B 4H9NB 2PYOC 5GSUA 3AN2D 3UTAD 1P3IC 1KX4B 5CPID 4E44A 3REJA 3C1BD 4LD9D 4WU9C 5B2JB 5GXQA 1EQZA 5AY8D 3X1SC 2NZDB 1KU5A 1ZLAB 3MNNC 3UTBA 1P3MA 3C1BC 3W96B 4LD9C 4J8WA 4KGCB 5B31A 1WWSA 3AZMC 3AZGD 4XUJA 5AV6A 4Z2MH 3A1IA 2AROB 5CHLB 5B33A 5CPKD 5B32D 1TZYA 2NQBB 3LJAA 1KX4D 1KX3D 4CAYB 3EPLA 3W97C 1P3AB 2Y2GA 4H9QA 5B2JD 4G92B 3AZFB 2NZDD 3MGSC 3R45A 3MGQB 1KX3C 5AV9B 3AZKB 3W96D 4KUDC 3WA9B 4KGCD 1M18B 3RELA 3AZNB 1KX5A 1P3LC 3REIA 2UWXA 3C1CA 5JA4B 4E45A 1N1JA 3MGPB 3WTPA 3W99B 3KWQA 3O62C 2AROD 2F2AC 5C3IC 2NQBD 3LZ1B 4Z5TB 3V9RA 5E5AA 5JRGA 3H0RC 1BH8A 1P3KA 1R4VA 2BYKB 1P3AD 3H0MC 3LELB 2Y2IA 3MGQD 5CPJB 5AV9D 3B6GC 4Z66D 3AZKD 1P3FB 4KHAA 4J8UC 1HQ3C 3WA9D 3AZLA 4XZQD 1M18D 5B40A 3REHA 3AZND 1B6WA 3B0DB 3H0LC 5B1MC 3AZHA 3AV2A 3A6NA 4WNNA 3TU4D 3X1TA 4R8PC 4Z66C 3UTBB 3W99D 1U35A 3MGRC 4YM6A 4J8WB 3WAAB 4XZQC 5B31B 2HIOA 4JJNA 3AZNC 1TAFA 4H9PB 4ZUXB 3TU4C 1ID3B 5AVBC 4Z5TD 3LZ0C 4H9RA 5BO0A 5GT3A 1AOIB 5F99B 5B24A 3AZIB 2PYOB 3AYWA 3AZED 4H9OA 3VH6W 1P3IB 3EPHA 5KDMB 3NQUA 3LELD 2CWEA 3X1UA
chains in the Genus database with same CATH topology
1TZYB 4QLCC 5DNNA 5GSUD 5B2IC 5CPJD 4WU9B 3X1SB 3AZEC 5GT0C 4ZBJC 4YS3A 4R8PA 3MNNB 3MVDA 3X1VA 1B67A 3R45B 3C1BB 2FFFB 5GSUC 4LD9B 4X23A 3REJC 3UTBD 1P3MD 3AZMB 4J8WD 5GXQC 1EQZC 3WAAD 5B31D 3B6FA 2DQNC 4NE3A 1Z2CB 2VQRA 4ZUXD 1ID3D 3UTBC 1P3MC 4M6BA 1AOID 3AZID 2PYOD 4XUJD 4NE5A 4J8WC 3KWQB 1P3ID 2J8PA 3B0CW 3W97B 1TZYD 3VH6A 4WU9D 3LJAD 2FJ7A 3V9RB 4XUJC 1S32A 3MGSB 3WKJA 5AV6C 5B1LA 1KX3B 5B33C 2XD1A 3MNND 3AV1A 1TZYC 1JFIB 2L5AA 4KUDB 3LJAC 1P3BA 5BNVA 1M1AA 3AZMD 1P3LB 2CV5A 4J8XA 5B0ZA 2Y2NA 2Y2KA 3VH5W 3O62B 1WWIA 3WTPD 2Y2HA 2YFVB 3KXBA 5C3IB 3KWQD 3RELC 1P3OA 1KX5C 4UUZA 5G49B 3REIC 3C1CC 3W97D 1P34A 5JRGD 3WTPC 3UT9A 3MGSD 3KWQC 3B6GB 5AVCA 5BNXB 3P5JB 4J8UB 1HQ3B 4KUDD 5E5AC 5JRGC 3EG5B 1P3KC 1P3LD 5B1MB 5FUGA 2YFWB 4R8PB 4Z66B 3AFAA 3MGRB 4G91C 5AV8A 4XZQB 3O62D 4WU8A 1P3PA 3VH5A 5DNMA 3AZLC 1H3OB 1BFMA 3TU4B 3REHC 5B40C 4JJND 5AVBB 3LZ0B 3AZHC 3AV2C 2F8NB 3A6NC 2W8SA 4J8VA 3X1TC 3IP4C 3AN2A 1U35C 4YM6C 3UTAA 4CSRB 5CPIA 4H9SA 4QLCB 2HIOC 5B2IB 4JJNC 3B6GD 3EPJA 3KFUG 4NE6A 3X1UD 3W98A 5DNND 5AY8A 5B31G 1HQ3D 3NQJB 4J8UD 5GT0B 4ZBJB 3REKA 3AZEB 5GT3C 5B24C 4DRAA 2JCHA 2Y2QA 5B1MD 3AYWC 5GSUB 2BYMA 4R8PD 3KUYA 3MVDD 3REJB 3X1UC 5DNNC 3MGRD 5GXQB 5BS7A 1EQZB 5B0YA 4EO5C 1P3GC 1M1AB 2JSSA 1BH9A 3EPKA 4YS3C 1HTAA 5AV5A 3AL0C 1F66A 3AZGA 5AVBD 3LZ0D 3MVDC 3X1VC 1P3MB 2F8ND 4X23C 5CPKA 2IO5C 4H9NA 5B32A 1KX4A 4QLCD 3B6FC 5B2ID 1P3OB 3A1KA 4UPKA 5B2JA 4XUJB 5AV6B 5GT0D 2NZDA 5B33B 3AZJC 4DQYB 1ZLAA 1S32D 3WKJD 5BT1C 3LJAB 3W96A 1P3GA 3REJD 3AV1D 1ULYA 2FJ7C 4H9QB 5GXQD 1EQZD 1M1AD 1S32C 3WKJC 5FUGB 5B1LC 3AV1C 2AROA 1P3BC 3RELB 1M1AC 1KX5B 2NQBA 3REIB 3C1CB 2CV5C 4CAYA 4J8XC 5B0ZC 1P3OD 4WV4B 1N1JB 1P3AA 3WTPB 3AZJA 1W2EA 3AZFA 5AV6D 1P34D 5B33D 3MGQA 5AV9A 3KXBC 3AZKA 1P3OC 5E5AB 4DRBA 5JRGB 1BH8B 3WA9A 1P3KB 1M18A 5CP6A 1P34C 2Y2JA 5JA4A 3UT9C 4G91B 3MGPA 3W99A 5AVCC 3KUYB 4KHAB 3AZLB 5B0YB 5B40B 3REHB 3RELD 1KX5D 3LZ1A 3REID 3AZHB 3A6NB 4WNNB 2RIQA 4Z5TA 3C1CD 3AV2B 3X1TB 1F66B 1Q9CA 2Y2PA 3AFAC 1U35B 4YM6B 5AV8C 3LELA 2HIOB 4WJ3C 4JJNB 4WU8C 3WTPE 1TAFB 5CPJA 5DNMC 1P3PC 2ZY3A 1P3FA 1M19A 4H9RB 5E5AD 5BO0B 5GT3B 5B24B 1P3KD 4J8VC 3W98D 3REKD 3AYWB 4H9OB 3NQUB 3AN2C 2F8NG 2XD5A 3UTAC 5CPIC 4H9SC 3X1UB 5DNNB 4AWLC 4EO5B 3KUYD 1P3GB 3WAAA 3W98C 5AY8C 3REKC 4YS3B 3AZLD 5B0YD 5B40D 4H9PA 3REHD 4ZUXA 3MVDB 3X1VB 3VH6T 3AZHD 3AV2D 1ID3A 3A6ND 5AV5D 2G5HC 4X23B 1T3UA 1AOIA 1A7WA 2LY8A 5F99A 3X1TD 2IO5B 3KUYC 3AZIA 1F66D 2PYOA 1U35D 2HUEC 4YM6D 1P3IA 5BS7C 5KDMA 5B0YC 3B6FB 2HIOD 4WU9A 4HGAC 5AV5C 3X1SA 1F66C 3AZGC 5GT3D 3AZJB 5B24D 3AYWD 3MNNA 5B32C 5CPKC 3C1BA 4LD9A 1ZLAD 2RVQD 1KX4C 2FJ7B 3AZMA 2ZY2A 1P3GD 5B2JC 1S32B 3WKJB 2Y2OA 5CP6B 4YS3D 2NZDC 5B1LB 1ZLAC 2RVQC 3AV1B 3X1VD 3B0CT 4X23D 3W96C 1P3BB 5BNVB 4KGCC 1F1EA 2CV5B 3B6FD 4J8XB 3W97A 5B0ZB 4Z2MG 3MGSA 2ZY4A 3AZJD 1KX3A 3KSYA 2AROC 5BT1D 3KXBB 3AZFD 4UUZB 1JFIA 2NQBC 4KUDA 2Y2LA 1M19B 4WZSB 2FJ7D 1P3LA 1P34B 3VH5T 1P3AC 4G92C 2BG1A 2ZM5A 3UT9B 3AZFC 5CP6D 5B1LD 5AVCB 3MGQC 5AV9C 4KGCA 3O62A 3AZKC 3MGPD 1P3BD 3WA9C 2YFVA 1M18C 4NFTA 5CP6C 5G49A 2CV5D 4J8XD 5B0ZD 3LZ1D 3AFAB 5AV8B 3MGPC 3W99C 1PZRA 4WU8B 1P3PB 5DNMB 3B6GA 3KXBD 5BNXA 3LZ1C 1HQ3A 4J8UA 4Z5TC 4J8VB 1P3FD 1M19D 3B0BA 5B1MA 3AN2B 3UTAB 3UT9D 2YFWA 5CPIB 3LELC 4Z66A 2F8NH 3FDDA 4AWLB 5AVCD 3MGRA 5CPJC 4XZQA 3W98B 5AY8B 3REKB 3AZNA 1P3FC 5B32G 1M19C 1H3OA 3TU4A 2F8NK 5AVBA 3B0DC 3LZ0A 2BYMB 2F8NA 3F6TA 2DF4C 3AFAD 2HUEB 5AV8D 5F99D 4CSRA 3WAAC 4QLCA 5B31C 4WU8D 5B2IA 1P3PD 5DNMD 1BH9B 2Y2MA 4HGAB 5AV5B 2G5IC 2JE5A 3AZGB 4ZUXC 2BYKA 2ZY5A 3NQJA 3AZEA 5GT0A 1ID3C 4J8VD 1AOIC 3X1SD 5F99C 3AZIC 5CPKB 5B32B 4H9NB 2PYOC 5GSUA 3AN2D 3UTAD 1P3IC 1KX4B 5CPID 4E44A 3REJA 3C1BD 4LD9D 4WU9C 5B2JB 5GXQA 1EQZA 5AY8D 3X1SC 2NZDB 1KU5A 1ZLAB 3MNNC 3UTBA 1P3MA 3C1BC 3W96B 4LD9C 4J8WA 4KGCB 5B31A 1WWSA 3AZMC 3AZGD 4XUJA 5AV6A 4Z2MH 3A1IA 2AROB 5CHLB 5B33A 5CPKD 5B32D 1TZYA 2NQBB 3LJAA 1KX4D 1KX3D 4CAYB 3EPLA 3W97C 1P3AB 2Y2GA 4H9QA 5B2JD 4G92B 3AZFB 2NZDD 3MGSC 3R45A 3MGQB 1KX3C 5AV9B 3AZKB 3W96D 4KUDC 3WA9B 4KGCD 1M18B 3RELA 3AZNB 1KX5A 1P3LC 3REIA 2UWXA 3C1CA 5JA4B 4E45A 1N1JA 3MGPB 3WTPA 3W99B 3KWQA 3O62C 2AROD 2F2AC 5C3IC 2NQBD 3LZ1B 4Z5TB 3V9RA 5E5AA 5JRGA 3H0RC 1BH8A 1P3KA 1R4VA 2BYKB 1P3AD 3H0MC 3LELB 2Y2IA 3MGQD 5CPJB 5AV9D 3B6GC 4Z66D 3AZKD 1P3FB 4KHAA 4J8UC 1HQ3C 3WA9D 3AZLA 4XZQD 1M18D 5B40A 3REHA 3AZND 1B6WA 3B0DB 3H0LC 5B1MC 3AZHA 3AV2A 3A6NA 4WNNA 3TU4D 3X1TA 4R8PC 4Z66C 3UTBB 3W99D 1U35A 3MGRC 4YM6A 4J8WB 3WAAB 4XZQC 5B31B 2HIOA 4JJNA 3AZNC 1TAFA 4H9PB 4ZUXB 3TU4C 1ID3B 5AVBC 4Z5TD 3LZ0C 4H9RA 5BO0A 5GT3A 1AOIB 5F99B 5B24A 3AZIB 2PYOB 3AYWA 3AZED 4H9OA 3VH6W 1P3IB 3EPHA 5KDMB 3NQUA 3LELD 2CWEA 3X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY B;  4QLC C;  5DNN A;  5GSU D;  5B2I C;  5CPJ D;  4WU9 B;  3X1S B;  3AZE C;  5GT0 C;  4ZBJ C;  4YS3 A;  4R8P A;  3MNN B;  3MVD A;  3X1V A;  1B67 A;  3R45 B;  3C1B B;  5GSU C;  4LD9 B;  4X23 A;  3REJ C;  3UTB D;  1P3M D;  3AZM B;  4J8W D;  5GXQ C;  1EQZ C;  3WAA D;  5B31 D;  3B6F A;  4NE3 A;  4ZUX D;  1ID3 D;  3UTB C;  1P3M C;  4M6B A;  1AOI D;  3AZI D;  2PYO D;  4XUJ D;  4NE5 A;  4J8W C;  3KWQ B;  1P3I D;  3B0C W;  3W97 B;  1TZY D;  3VH6 A;  4WU9 D;  3LJA D;  2FJ7 A;  3V9R B;  4XUJ C;  1S32 A;  3MGS B;  3WKJ A;  5AV6 C;  5B1L A;  1KX3 B;  5B33 C;  3MNN D;  3AV1 A;  1TZY C;  1JFI B;  2L5A A;  4KUD B;  3LJA C;  1P3B A;  5BNV A;  1M1A A;  3AZM D;  1P3L B;  2CV5 A;  4J8X A;  5B0Z A;  3VH5 W;  3O62 B;  1WWI A;  3WTP D;  2YFV B;  3KXB A;  5C3I B;  3KWQ D;  3REL C;  1P3O A;  1KX5 C;  4UUZ A;  5G49 B;  3REI C;  3C1C C;  3W97 D;  1P34 A;  5JRG D;  3WTP C;  3UT9 A;  3MGS D;  3KWQ C;  3B6G B;  5AVC A;  5BNX B;  4J8U B;  1HQ3 B;  4KUD D;  5E5A C;  5JRG C;  1P3K C;  1P3L D;  5B1M B;  5FUG A;  2YFW B;  4R8P B;  4Z66 B;  3AFA A;  3MGR B;  4G91 C;  5AV8 A;  4XZQ B;  3O62 D;  4WU8 A;  1P3P A;  3VH5 A;  5DNM A;  3AZL C;  1H3O B;  1BFM A;  3TU4 B;  3REH C;  5B40 C;  4JJN D;  5AVB B;  3LZ0 B;  3AZH C;  3AV2 C;  2F8N B;  3A6N C;  4J8V A;  3X1T C;  3AN2 A;  1U35 C;  4YM6 C;  3UTA A;  4CSR B;  5CPI A;  4H9S A;  4QLC B;  2HIO C;  5B2I B;  4JJN C;  3B6G D;  4NE6 A;  3X1U D;  3W98 A;  5DNN D;  5AY8 A;  5B31 G;  1HQ3 D;  3NQJ B;  4J8U D;  5GT0 B;  4ZBJ B;  3REK A;  3AZE B;  5GT3 C;  5B24 C;  4DRA A;  5B1M D;  3AYW C;  5GSU B;  2BYM A;  4R8P D;  3KUY A;  3MVD D;  3REJ B;  3X1U C;  5DNN C;  3MGR D;  5GXQ B;  5BS7 A;  1EQZ B;  5B0Y A;  4EO5 C;  1P3G C;  1M1A B;  2JSS A;  1BH9 A;  4YS3 C;  1HTA A;  5AV5 A;  1F66 A;  3AZG A;  5AVB D;  3LZ0 D;  3MVD C;  3X1V C;  1P3M B;  2F8N D;  4X23 C;  5CPK A;  2IO5 C;  4H9N A;  5B32 A;  1KX4 A;  4QLC D;  3B6F C;  5B2I D;  1P3O B;  5B2J A;  4XUJ B;  5AV6 B;  5GT0 D;  2NZD A;  5B33 B;  3AZJ C;  1ZLA A;  1S32 D;  3WKJ D;  5BT1 C;  3LJA B;  3W96 A;  1P3G A;  3REJ D;  3AV1 D;  1ULY A;  2FJ7 C;  4H9Q B;  5GXQ D;  1EQZ D;  1M1A D;  1S32 C;  3WKJ C;  5FUG B;  5B1L C;  3AV1 C;  2ARO A;  1P3B C;  3REL B;  1M1A C;  1KX5 B;  2NQB A;  3REI B;  3C1C B;  2CV5 C;  4CAY A;  4J8X C;  5B0Z C;  1P3O D;  4WV4 B;  1N1J B;  1P3A A;  3WTP B;  3AZJ A;  3AZF A;  5AV6 D;  1P34 D;  5B33 D;  3MGQ A;  5AV9 A;  3KXB C;  3AZK A;  1P3O C;  5E5A B;  4DRB A;  5JRG B;  1BH8 B;  3WA9 A;  1P3K B;  1M18 A;  5CP6 A;  1P34 C;  5JA4 A;  3UT9 C;  4G91 B;  3MGP A;  3W99 A;  5AVC C;  3KUY B;  4KHA B;  3AZL B;  5B0Y B;  5B40 B;  3REH B;  3REL D;  1KX5 D;  3LZ1 A;  3REI D;  3AZH B;  3A6N B;  4WNN B;  4Z5T A;  3C1C D;  3AV2 B;  3X1T B;  1F66 B;  1Q9C A;  3AFA C;  1U35 B;  4YM6 B;  5AV8 C;  3LEL A;  2HIO B;  4JJN B;  4WU8 C;  3WTP E;  1TAF B;  5CPJ A;  5DNM C;  1P3P C;  1P3F A;  1M19 A;  4H9R B;  5E5A D;  5BO0 B;  5GT3 B;  5B24 B;  1P3K D;  4J8V C;  3W98 D;  3REK D;  3AYW B;  4H9O B;  3NQU B;  3AN2 C;  2F8N G;  3UTA C;  5CPI C;  4H9S C;  3X1U B;  5DNN B;  4AWL C;  4EO5 B;  3KUY D;  1P3G B;  3WAA A;  3W98 C;  5AY8 C;  3REK C;  4YS3 B;  3AZL D;  5B0Y D;  5B40 D;  4H9P A;  3REH D;  4ZUX A;  3MVD B;  3X1V B;  3VH6 T;  3AZH D;  3AV2 D;  1ID3 A;  3A6N D;  5AV5 D;  4X23 B;  1AOI A;  1A7W A;  2LY8 A;  5F99 A;  3X1T D;  2IO5 B;  3KUY C;  3AZI A;  1F66 D;  2PYO A;  1U35 D;  2HUE C;  4YM6 D;  1P3I A;  5BS7 C;  5KDM A;  5B0Y C;  3B6F B;  2HIO D;  4WU9 A;  4HGA C;  5AV5 C;  3X1S A;  1F66 C;  3AZG C;  5GT3 D;  3AZJ B;  5B24 D;  3AYW D;  3MNN A;  5B32 C;  5CPK C;  3C1B A;  4LD9 A;  1ZLA D;  2RVQ D;  1KX4 C;  2FJ7 B;  3AZM A;  1P3G D;  5B2J C;  1S32 B;  3WKJ B;  5CP6 B;  4YS3 D;  2NZD C;  5B1L B;  1ZLA C;  2RVQ C;  3AV1 B;  3X1V D;  3B0C T;  4X23 D;  3W96 C;  1P3B B;  5BNV B;  4KGC C;  1F1E A;  2CV5 B;  3B6F D;  4J8X B;  3W97 A;  5B0Z B;  4Z2M G;  3MGS A;  3AZJ D;  1KX3 A;  3KSY A;  2ARO C;  5BT1 D;  3KXB B;  3AZF D;  4UUZ B;  1JFI A;  2NQB C;  4KUD A;  1M19 B;  2FJ7 D;  1P3L A;  1P34 B;  3VH5 T;  1P3A C;  4G92 C;  3UT9 B;  3AZF C;  5CP6 D;  5B1L D;  5AVC B;  3MGQ C;  5AV9 C;  4KGC A;  3O62 A;  3AZK C;  3MGP D;  1P3B D;  3WA9 C;  2YFV A;  1M18 C;  4NFT A;  5CP6 C;  5G49 A;  2CV5 D;  4J8X D;  5B0Z D;  3LZ1 D;  3AFA B;  5AV8 B;  3MGP C;  3W99 C;  4WU8 B;  1P3P B;  5DNM B;  3B6G A;  3KXB D;  5BNX A;  3LZ1 C;  1HQ3 A;  4J8U A;  4Z5T C;  4J8V B;  1P3F D;  1M19 D;  3B0B A;  5B1M A;  3AN2 B;  3UTA B;  3UT9 D;  2YFW A;  5CPI B;  3LEL C;  4Z66 A;  2F8N H;  4AWL B;  5AVC D;  3MGR A;  5CPJ C;  4XZQ A;  3W98 B;  5AY8 B;  3REK B;  3AZN A;  1P3F C;  5B32 G;  1M19 C;  1H3O A;  3TU4 A;  2F8N K;  3B0D C;  5AVB A;  3LZ0 A;  2BYM B;  2F8N A;  3AFA D;  2HUE B;  5AV8 D;  5F99 D;  4CSR A;  3WAA C;  4QLC A;  5B31 C;  4WU8 D;  5B2I A;  1P3P D;  5DNM D;  1BH9 B;  4HGA B;  5AV5 B;  3AZG B;  4ZUX C;  2BYK A;  3NQJ A;  3AZE A;  1ID3 C;  5GT0 A;  4J8V D;  1AOI C;  3X1S D;  5F99 C;  3AZI C;  5CPK B;  5B32 B;  4H9N B;  2PYO C;  5GSU A;  3AN2 D;  3UTA D;  1P3I C;  1KX4 B;  5CPI D;  4E44 A;  3REJ A;  3C1B D;  4LD9 D;  4WU9 C;  5B2J B;  5GXQ A;  1EQZ A;  5AY8 D;  3X1S C;  2NZD B;  1KU5 A;  1ZLA B;  3MNN C;  3UTB A;  1P3M A;  3C1B C;  3W96 B;  4LD9 C;  4J8W A;  4KGC B;  5B31 A;  1WWS A;  3AZM C;  3AZG D;  4XUJ A;  5AV6 A;  4Z2M H;  5CHL B;  2ARO B;  5B33 A;  5CPK D;  5B32 D;  1TZY A;  2NQB B;  3LJA A;  1KX4 D;  1KX3 D;  4CAY B;  3W97 C;  1P3A B;  4H9Q A;  5B2J D;  4G92 B;  3AZF B;  2NZD D;  3MGS C;  3R45 A;  3MGQ B;  1KX3 C;  5AV9 B;  3AZK B;  3W96 D;  4KUD C;  3WA9 B;  4KGC D;  1M18 B;  3REL A;  3AZN B;  1KX5 A;  1P3L C;  3REI A;  3C1C A;  5JA4 B;  4E45 A;  1N1J A;  3MGP B;  3WTP A;  3W99 B;  3KWQ A;  3O62 C;  2ARO D;  3X1U A;  5C3I C;  2NQB D;  3LZ1 B;  4Z5T B;  3V9R A;  5E5A A;  5JRG A;  1BH8 A;  1P3K A;  1R4V A;  2BYK B;  1P3A D;  3LEL B;  3MGQ D;  5CPJ B;  5AV9 D;  3B6G C;  4Z66 D;  3AZK D;  1P3F B;  4KHA A;  4J8U C;  1HQ3 C;  3WA9 D;  3AZL A;  4XZQ D;  1M18 D;  5B40 A;  3REH A;  3AZN D;  1B6W A;  3B0D B;  5B1M C;  3AZH A;  3AV2 A;  3A6N A;  4WNN A;  3TU4 D;  3X1T A;  4R8P C;  4Z66 C;  3UTB B;  3W99 D;  1U35 A;  3MGR C;  4YM6 A;  4J8W B;  3WAA B;  4XZQ C;  5B31 B;  2HIO A;  4JJN A;  3AZN C;  1TAF A;  4H9P B;  4ZUX B;  3TU4 C;  1ID3 B;  5AVB C;  4Z5T D;  3LZ0 C;  4H9R A;  5BO0 A;  5GT3 A;  1AOI B;  5F99 B;  5B24 A;  3AZI B;  2PYO B;  3AYW A;  3AZE D;  4H9O A;  3VH6 W;  1P3I B;  5KDM B;  3NQU A;  3LEL D;  2CWE A;  4WZS B; 
#chains in the Genus database with same CATH topology
 1TZY B;  4QLC C;  5DNN A;  5GSU D;  5B2I C;  5CPJ D;  4WU9 B;  3X1S B;  3AZE C;  5GT0 C;  4ZBJ C;  4YS3 A;  4R8P A;  3MNN B;  3MVD A;  3X1V A;  1B67 A;  3R45 B;  3C1B B;  2FFF B;  5GSU C;  4LD9 B;  4X23 A;  3REJ C;  3UTB D;  1P3M D;  3AZM B;  4J8W D;  5GXQ C;  1EQZ C;  3WAA D;  5B31 D;  3B6F A;  2DQN C;  4NE3 A;  1Z2C B;  2VQR A;  4ZUX D;  1ID3 D;  3UTB C;  1P3M C;  4M6B A;  1AOI D;  3AZI D;  2PYO D;  4XUJ D;  4NE5 A;  4J8W C;  3KWQ B;  1P3I D;  2J8P A;  3B0C W;  3W97 B;  1TZY D;  3VH6 A;  4WU9 D;  3LJA D;  2FJ7 A;  3V9R B;  4XUJ C;  1S32 A;  3MGS B;  3WKJ A;  5AV6 C;  5B1L A;  1KX3 B;  5B33 C;  2XD1 A;  3MNN D;  3AV1 A;  1TZY C;  1JFI B;  2L5A A;  4KUD B;  3LJA C;  1P3B A;  5BNV A;  1M1A A;  3AZM D;  1P3L B;  2CV5 A;  4J8X A;  5B0Z A;  2Y2N A;  2Y2K A;  3VH5 W;  3O62 B;  1WWI A;  3WTP D;  2Y2H A;  2YFV B;  3KXB A;  5C3I B;  3KWQ D;  3REL C;  1P3O A;  1KX5 C;  4UUZ A;  5G49 B;  3REI C;  3C1C C;  3W97 D;  1P34 A;  5JRG D;  3WTP C;  3UT9 A;  3MGS D;  3KWQ C;  3B6G B;  5AVC A;  5BNX B;  3P5J B;  4J8U B;  1HQ3 B;  4KUD D;  5E5A C;  5JRG C;  3EG5 B;  1P3K C;  1P3L D;  5B1M B;  5FUG A;  2YFW B;  4R8P B;  4Z66 B;  3AFA A;  3MGR B;  4G91 C;  5AV8 A;  4XZQ B;  3O62 D;  4WU8 A;  1P3P A;  3VH5 A;  5DNM A;  3AZL C;  1H3O B;  1BFM A;  3TU4 B;  3REH C;  5B40 C;  4JJN D;  5AVB B;  3LZ0 B;  3AZH C;  3AV2 C;  2F8N B;  3A6N C;  2W8S A;  4J8V A;  3X1T C;  3IP4 C;  3AN2 A;  1U35 C;  4YM6 C;  3UTA A;  4CSR B;  5CPI A;  4H9S A;  4QLC B;  2HIO C;  5B2I B;  4JJN C;  3B6G D;  3EPJ A;  3KFU G;  4NE6 A;  3X1U D;  3W98 A;  5DNN D;  5AY8 A;  5B31 G;  1HQ3 D;  3NQJ B;  4J8U D;  5GT0 B;  4ZBJ B;  3REK A;  3AZE B;  5GT3 C;  5B24 C;  4DRA A;  2JCH A;  2Y2Q A;  5B1M D;  3AYW C;  5GSU B;  2BYM A;  4R8P D;  3KUY A;  3MVD D;  3REJ B;  3X1U C;  5DNN C;  3MGR D;  5GXQ B;  5BS7 A;  1EQZ B;  5B0Y A;  4EO5 C;  1P3G C;  1M1A B;  2JSS A;  1BH9 A;  3EPK A;  4YS3 C;  1HTA A;  5AV5 A;  3AL0 C;  1F66 A;  3AZG A;  5AVB D;  3LZ0 D;  3MVD C;  3X1V C;  1P3M B;  2F8N D;  4X23 C;  5CPK A;  2IO5 C;  4H9N A;  5B32 A;  1KX4 A;  4QLC D;  3B6F C;  5B2I D;  1P3O B;  3A1K A;  4UPK A;  5B2J A;  4XUJ B;  5AV6 B;  5GT0 D;  2NZD A;  5B33 B;  3AZJ C;  4DQY B;  1ZLA A;  1S32 D;  3WKJ D;  5BT1 C;  3LJA B;  3W96 A;  1P3G A;  3REJ D;  3AV1 D;  1ULY A;  2FJ7 C;  4H9Q B;  5GXQ D;  1EQZ D;  1M1A D;  1S32 C;  3WKJ C;  5FUG B;  5B1L C;  3AV1 C;  2ARO A;  1P3B C;  3REL B;  1M1A C;  1KX5 B;  2NQB A;  3REI B;  3C1C B;  2CV5 C;  4CAY A;  4J8X C;  5B0Z C;  1P3O D;  4WV4 B;  1N1J B;  1P3A A;  3WTP B;  3AZJ A;  1W2E A;  3AZF A;  5AV6 D;  1P34 D;  5B33 D;  3MGQ A;  5AV9 A;  3KXB C;  3AZK A;  1P3O C;  5E5A B;  4DRB A;  5JRG B;  1BH8 B;  3WA9 A;  1P3K B;  1M18 A;  5CP6 A;  1P34 C;  2Y2J A;  5JA4 A;  3UT9 C;  4G91 B;  3MGP A;  3W99 A;  5AVC C;  3KUY B;  4KHA B;  3AZL B;  5B0Y B;  5B40 B;  3REH B;  3REL D;  1KX5 D;  3LZ1 A;  3REI D;  3AZH B;  3A6N B;  4WNN B;  2RIQ A;  4Z5T A;  3C1C D;  3AV2 B;  3X1T B;  1F66 B;  1Q9C A;  2Y2P A;  3AFA C;  1U35 B;  4YM6 B;  5AV8 C;  3LEL A;  2HIO B;  4WJ3 C;  4JJN B;  4WU8 C;  3WTP E;  1TAF B;  5CPJ A;  5DNM C;  1P3P C;  2ZY3 A;  1P3F A;  1M19 A;  4H9R B;  5E5A D;  5BO0 B;  5GT3 B;  5B24 B;  1P3K D;  4J8V C;  3W98 D;  3REK D;  3AYW B;  4H9O B;  3NQU B;  3AN2 C;  2F8N G;  2XD5 A;  3UTA C;  5CPI C;  4H9S C;  3X1U B;  5DNN B;  4AWL C;  4EO5 B;  3KUY D;  1P3G B;  3WAA A;  3W98 C;  5AY8 C;  3REK C;  4YS3 B;  3AZL D;  5B0Y D;  5B40 D;  4H9P A;  3REH D;  4ZUX A;  3MVD B;  3X1V B;  3VH6 T;  3AZH D;  3AV2 D;  1ID3 A;  3A6N D;  5AV5 D;  2G5H C;  4X23 B;  1T3U A;  1AOI A;  1A7W A;  2LY8 A;  5F99 A;  3X1T D;  2IO5 B;  3KUY C;  3AZI A;  1F66 D;  2PYO A;  1U35 D;  2HUE C;  4YM6 D;  1P3I A;  5BS7 C;  5KDM A;  5B0Y C;  3B6F B;  2HIO D;  4WU9 A;  4HGA C;  5AV5 C;  3X1S A;  1F66 C;  3AZG C;  5GT3 D;  3AZJ B;  5B24 D;  3AYW D;  3MNN A;  5B32 C;  5CPK C;  3C1B A;  4LD9 A;  1ZLA D;  2RVQ D;  1KX4 C;  2FJ7 B;  3AZM A;  2ZY2 A;  1P3G D;  5B2J C;  1S32 B;  3WKJ B;  2Y2O A;  5CP6 B;  4YS3 D;  2NZD C;  5B1L B;  1ZLA C;  2RVQ C;  3AV1 B;  3X1V D;  3B0C T;  4X23 D;  3W96 C;  1P3B B;  5BNV B;  4KGC C;  1F1E A;  2CV5 B;  3B6F D;  4J8X B;  3W97 A;  5B0Z B;  4Z2M G;  3MGS A;  2ZY4 A;  3AZJ D;  1KX3 A;  3KSY A;  2ARO C;  5BT1 D;  3KXB B;  3AZF D;  4UUZ B;  1JFI A;  2NQB C;  4KUD A;  2Y2L A;  1M19 B;  4WZS B;  2FJ7 D;  1P3L A;  1P34 B;  3VH5 T;  1P3A C;  4G92 C;  2BG1 A;  2ZM5 A;  3UT9 B;  3AZF C;  5CP6 D;  5B1L D;  5AVC B;  3MGQ C;  5AV9 C;  4KGC A;  3O62 A;  3AZK C;  3MGP D;  1P3B D;  3WA9 C;  2YFV A;  1M18 C;  4NFT A;  5CP6 C;  5G49 A;  2CV5 D;  4J8X D;  5B0Z D;  3LZ1 D;  3AFA B;  5AV8 B;  3MGP C;  3W99 C;  1PZR A;  4WU8 B;  1P3P B;  5DNM B;  3B6G A;  3KXB D;  5BNX A;  3LZ1 C;  1HQ3 A;  4J8U A;  4Z5T C;  4J8V B;  1P3F D;  1M19 D;  3B0B A;  5B1M A;  3AN2 B;  3UTA B;  3UT9 D;  2YFW A;  5CPI B;  3LEL C;  4Z66 A;  2F8N H;  3FDD A;  4AWL B;  5AVC D;  3MGR A;  5CPJ C;  4XZQ A;  3W98 B;  5AY8 B;  3REK B;  3AZN A;  1P3F C;  5B32 G;  1M19 C;  1H3O A;  3TU4 A;  2F8N K;  5AVB A;  3B0D C;  3LZ0 A;  2BYM B;  2F8N A;  3F6T A;  2DF4 C;  3AFA D;  2HUE B;  5AV8 D;  5F99 D;  4CSR A;  3WAA C;  4QLC A;  5B31 C;  4WU8 D;  5B2I A;  1P3P D;  5DNM D;  1BH9 B;  2Y2M A;  4HGA B;  5AV5 B;  2G5I C;  2JE5 A;  3AZG B;  4ZUX C;  2BYK A;  2ZY5 A;  3NQJ A;  3AZE A;  5GT0 A;  1ID3 C;  4J8V D;  1AOI C;  3X1S D;  5F99 C;  3AZI C;  5CPK B;  5B32 B;  4H9N B;  2PYO C;  5GSU A;  3AN2 D;  3UTA D;  1P3I C;  1KX4 B;  5CPI D;  4E44 A;  3REJ A;  3C1B D;  4LD9 D;  4WU9 C;  5B2J B;  5GXQ A;  1EQZ A;  5AY8 D;  3X1S C;  2NZD B;  1KU5 A;  1ZLA B;  3MNN C;  3UTB A;  1P3M A;  3C1B C;  3W96 B;  4LD9 C;  4J8W A;  4KGC B;  5B31 A;  1WWS A;  3AZM C;  3AZG D;  4XUJ A;  5AV6 A;  4Z2M H;  3A1I A;  2ARO B;  5CHL B;  5B33 A;  5CPK D;  5B32 D;  1TZY A;  2NQB B;  3LJA A;  1KX4 D;  1KX3 D;  4CAY B;  3EPL A;  3W97 C;  1P3A B;  2Y2G A;  4H9Q A;  5B2J D;  4G92 B;  3AZF B;  2NZD D;  3MGS C;  3R45 A;  3MGQ B;  1KX3 C;  5AV9 B;  3AZK B;  3W96 D;  4KUD C;  3WA9 B;  4KGC D;  1M18 B;  3REL A;  3AZN B;  1KX5 A;  1P3L C;  3REI A;  2UWX A;  3C1C A;  5JA4 B;  4E45 A;  1N1J A;  3MGP B;  3WTP A;  3W99 B;  3KWQ A;  3O62 C;  2ARO D;  2F2A C;  5C3I C;  2NQB D;  3LZ1 B;  4Z5T B;  3V9R A;  5E5A A;  5JRG A;  3H0R C;  1BH8 A;  1P3K A;  1R4V A;  2BYK B;  1P3A D;  3H0M C;  3LEL B;  2Y2I A;  3MGQ D;  5CPJ B;  5AV9 D;  3B6G C;  4Z66 D;  3AZK D;  1P3F B;  4KHA A;  4J8U C;  1HQ3 C;  3WA9 D;  3AZL A;  4XZQ D;  1M18 D;  5B40 A;  3REH A;  3AZN D;  1B6W A;  3B0D B;  3H0L C;  5B1M C;  3AZH A;  3AV2 A;  3A6N A;  4WNN A;  3TU4 D;  3X1T A;  4R8P C;  4Z66 C;  3UTB B;  3W99 D;  1U35 A;  3MGR C;  4YM6 A;  4J8W B;  3WAA B;  4XZQ C;  5B31 B;  2HIO A;  4JJN A;  3AZN C;  1TAF A;  4H9P B;  4ZUX B;  3TU4 C;  1ID3 B;  5AVB C;  4Z5T D;  3LZ0 C;  4H9R A;  5BO0 A;  5GT3 A;  1AOI B;  5F99 B;  5B24 A;  3AZI B;  2PYO B;  3AYW A;  3AZE D;  4H9O A;  3VH6 W;  1P3I B;  3EPH A;  5KDM B;  3NQU A;  3LEL D;  2CWE A;  3X1U A; 
#chains in the Genus database with same CATH homology
 1TZY B;  4QLC C;  5DNN A;  5GSU D;  5B2I C;  5CPJ D;  4WU9 B;  3X1S B;  3AZE C;  5GT0 C;  4ZBJ C;  4YS3 A;  4R8P A;  3MNN B;  3MVD A;  3X1V A;  1B67 A;  3R45 B;  3C1B B;  2FFF B;  5GSU C;  4LD9 B;  4X23 A;  3REJ C;  3UTB D;  1P3M D;  3AZM B;  4J8W D;  5GXQ C;  1EQZ C;  3WAA D;  5B31 D;  3B6F A;  2DQN C;  4NE3 A;  1Z2C B;  2VQR A;  4ZUX D;  1ID3 D;  3UTB C;  1P3M C;  4M6B A;  1AOI D;  3AZI D;  2PYO D;  4XUJ D;  4NE5 A;  4J8W C;  3KWQ B;  1P3I D;  2J8P A;  3B0C W;  3W97 B;  1TZY D;  3VH6 A;  4WU9 D;  3LJA D;  2FJ7 A;  3V9R B;  4XUJ C;  1S32 A;  3MGS B;  3WKJ A;  5AV6 C;  5B1L A;  1KX3 B;  5B33 C;  2XD1 A;  3MNN D;  3AV1 A;  1TZY C;  1JFI B;  2L5A A;  4KUD B;  3LJA C;  1P3B A;  5BNV A;  1M1A A;  3AZM D;  1P3L B;  2CV5 A;  4J8X A;  5B0Z A;  2Y2N A;  2Y2K A;  3VH5 W;  3O62 B;  1WWI A;  3WTP D;  2Y2H A;  2YFV B;  3KXB A;  5C3I B;  3KWQ D;  3REL C;  1P3O A;  1KX5 C;  4UUZ A;  5G49 B;  3REI C;  3C1C C;  3W97 D;  1P34 A;  5JRG D;  3WTP C;  3UT9 A;  3MGS D;  3KWQ C;  3B6G B;  5AVC A;  5BNX B;  3P5J B;  4J8U B;  1HQ3 B;  4KUD D;  5E5A C;  5JRG C;  3EG5 B;  1P3K C;  1P3L D;  5B1M B;  5FUG A;  2YFW B;  4R8P B;  4Z66 B;  3AFA A;  3MGR B;  4G91 C;  5AV8 A;  4XZQ B;  3O62 D;  4WU8 A;  1P3P A;  3VH5 A;  5DNM A;  3AZL C;  1H3O B;  1BFM A;  3TU4 B;  3REH C;  5B40 C;  4JJN D;  5AVB B;  3LZ0 B;  3AZH C;  3AV2 C;  2F8N B;  3A6N C;  2W8S A;  4J8V A;  3X1T C;  3IP4 C;  3AN2 A;  1U35 C;  4YM6 C;  3UTA A;  4CSR B;  5CPI A;  4H9S A;  4QLC B;  2HIO C;  5B2I B;  4JJN C;  3B6G D;  3EPJ A;  3KFU G;  4NE6 A;  3X1U D;  3W98 A;  5DNN D;  5AY8 A;  5B31 G;  1HQ3 D;  3NQJ B;  4J8U D;  5GT0 B;  4ZBJ B;  3REK A;  3AZE B;  5GT3 C;  5B24 C;  4DRA A;  2JCH A;  2Y2Q A;  5B1M D;  3AYW C;  5GSU B;  2BYM A;  4R8P D;  3KUY A;  3MVD D;  3REJ B;  3X1U C;  5DNN C;  3MGR D;  5GXQ B;  5BS7 A;  1EQZ B;  5B0Y A;  4EO5 C;  1P3G C;  1M1A B;  2JSS A;  1BH9 A;  3EPK A;  4YS3 C;  1HTA A;  5AV5 A;  3AL0 C;  1F66 A;  3AZG A;  5AVB D;  3LZ0 D;  3MVD C;  3X1V C;  1P3M B;  2F8N D;  4X23 C;  5CPK A;  2IO5 C;  4H9N A;  5B32 A;  1KX4 A;  4QLC D;  3B6F C;  5B2I D;  1P3O B;  3A1K A;  4UPK A;  5B2J A;  4XUJ B;  5AV6 B;  5GT0 D;  2NZD A;  5B33 B;  3AZJ C;  4DQY B;  1ZLA A;  1S32 D;  3WKJ D;  5BT1 C;  3LJA B;  3W96 A;  1P3G A;  3REJ D;  3AV1 D;  1ULY A;  2FJ7 C;  4H9Q B;  5GXQ D;  1EQZ D;  1M1A D;  1S32 C;  3WKJ C;  5FUG B;  5B1L C;  3AV1 C;  2ARO A;  1P3B C;  3REL B;  1M1A C;  1KX5 B;  2NQB A;  3REI B;  3C1C B;  2CV5 C;  4CAY A;  4J8X C;  5B0Z C;  1P3O D;  4WV4 B;  1N1J B;  1P3A A;  3WTP B;  3AZJ A;  1W2E A;  3AZF A;  5AV6 D;  1P34 D;  5B33 D;  3MGQ A;  5AV9 A;  3KXB C;  3AZK A;  1P3O C;  5E5A B;  4DRB A;  5JRG B;  1BH8 B;  3WA9 A;  1P3K B;  1M18 A;  5CP6 A;  1P34 C;  2Y2J A;  5JA4 A;  3UT9 C;  4G91 B;  3MGP A;  3W99 A;  5AVC C;  3KUY B;  4KHA B;  3AZL B;  5B0Y B;  5B40 B;  3REH B;  3REL D;  1KX5 D;  3LZ1 A;  3REI D;  3AZH B;  3A6N B;  4WNN B;  2RIQ A;  4Z5T A;  3C1C D;  3AV2 B;  3X1T B;  1F66 B;  1Q9C A;  2Y2P A;  3AFA C;  1U35 B;  4YM6 B;  5AV8 C;  3LEL A;  2HIO B;  4WJ3 C;  4JJN B;  4WU8 C;  3WTP E;  1TAF B;  5CPJ A;  5DNM C;  1P3P C;  2ZY3 A;  1P3F A;  1M19 A;  4H9R B;  5E5A D;  5BO0 B;  5GT3 B;  5B24 B;  1P3K D;  4J8V C;  3W98 D;  3REK D;  3AYW B;  4H9O B;  3NQU B;  3AN2 C;  2F8N G;  2XD5 A;  3UTA C;  5CPI C;  4H9S C;  3X1U B;  5DNN B;  4AWL C;  4EO5 B;  3KUY D;  1P3G B;  3WAA A;  3W98 C;  5AY8 C;  3REK C;  4YS3 B;  3AZL D;  5B0Y D;  5B40 D;  4H9P A;  3REH D;  4ZUX A;  3MVD B;  3X1V B;  3VH6 T;  3AZH D;  3AV2 D;  1ID3 A;  3A6N D;  5AV5 D;  2G5H C;  4X23 B;  1T3U A;  1AOI A;  1A7W A;  2LY8 A;  5F99 A;  3X1T D;  2IO5 B;  3KUY C;  3AZI A;  1F66 D;  2PYO A;  1U35 D;  2HUE C;  4YM6 D;  1P3I A;  5BS7 C;  5KDM A;  5B0Y C;  3B6F B;  2HIO D;  4WU9 A;  4HGA C;  5AV5 C;  3X1S A;  1F66 C;  3AZG C;  5GT3 D;  3AZJ B;  5B24 D;  3AYW D;  3MNN A;  5B32 C;  5CPK C;  3C1B A;  4LD9 A;  1ZLA D;  2RVQ D;  1KX4 C;  2FJ7 B;  3AZM A;  2ZY2 A;  1P3G D;  5B2J C;  1S32 B;  3WKJ B;  2Y2O A;  5CP6 B;  4YS3 D;  2NZD C;  5B1L B;  1ZLA C;  2RVQ C;  3AV1 B;  3X1V D;  3B0C T;  4X23 D;  3W96 C;  1P3B B;  5BNV B;  4KGC C;  1F1E A;  2CV5 B;  3B6F D;  4J8X B;  3W97 A;  5B0Z B;  4Z2M G;  3MGS A;  2ZY4 A;  3AZJ D;  1KX3 A;  3KSY A;  2ARO C;  5BT1 D;  3KXB B;  3AZF D;  4UUZ B;  1JFI A;  2NQB C;  4KUD A;  2Y2L A;  1M19 B;  4WZS B;  2FJ7 D;  1P3L A;  1P34 B;  3VH5 T;  1P3A C;  4G92 C;  2BG1 A;  2ZM5 A;  3UT9 B;  3AZF C;  5CP6 D;  5B1L D;  5AVC B;  3MGQ C;  5AV9 C;  4KGC A;  3O62 A;  3AZK C;  3MGP D;  1P3B D;  3WA9 C;  2YFV A;  1M18 C;  4NFT A;  5CP6 C;  5G49 A;  2CV5 D;  4J8X D;  5B0Z D;  3LZ1 D;  3AFA B;  5AV8 B;  3MGP C;  3W99 C;  1PZR A;  4WU8 B;  1P3P B;  5DNM B;  3B6G A;  3KXB D;  5BNX A;  3LZ1 C;  1HQ3 A;  4J8U A;  4Z5T C;  4J8V B;  1P3F D;  1M19 D;  3B0B A;  5B1M A;  3AN2 B;  3UTA B;  3UT9 D;  2YFW A;  5CPI B;  3LEL C;  4Z66 A;  2F8N H;  3FDD A;  4AWL B;  5AVC D;  3MGR A;  5CPJ C;  4XZQ A;  3W98 B;  5AY8 B;  3REK B;  3AZN A;  1P3F C;  5B32 G;  1M19 C;  1H3O A;  3TU4 A;  2F8N K;  5AVB A;  3B0D C;  3LZ0 A;  2BYM B;  2F8N A;  3F6T A;  2DF4 C;  3AFA D;  2HUE B;  5AV8 D;  5F99 D;  4CSR A;  3WAA C;  4QLC A;  5B31 C;  4WU8 D;  5B2I A;  1P3P D;  5DNM D;  1BH9 B;  2Y2M A;  4HGA B;  5AV5 B;  2G5I C;  2JE5 A;  3AZG B;  4ZUX C;  2BYK A;  2ZY5 A;  3NQJ A;  3AZE A;  5GT0 A;  1ID3 C;  4J8V D;  1AOI C;  3X1S D;  5F99 C;  3AZI C;  5CPK B;  5B32 B;  4H9N B;  2PYO C;  5GSU A;  3AN2 D;  3UTA D;  1P3I C;  1KX4 B;  5CPI D;  4E44 A;  3REJ A;  3C1B D;  4LD9 D;  4WU9 C;  5B2J B;  5GXQ A;  1EQZ A;  5AY8 D;  3X1S C;  2NZD B;  1KU5 A;  1ZLA B;  3MNN C;  3UTB A;  1P3M A;  3C1B C;  3W96 B;  4LD9 C;  4J8W A;  4KGC B;  5B31 A;  1WWS A;  3AZM C;  3AZG D;  4XUJ A;  5AV6 A;  4Z2M H;  3A1I A;  2ARO B;  5CHL B;  5B33 A;  5CPK D;  5B32 D;  1TZY A;  2NQB B;  3LJA A;  1KX4 D;  1KX3 D;  4CAY B;  3EPL A;  3W97 C;  1P3A B;  2Y2G A;  4H9Q A;  5B2J D;  4G92 B;  3AZF B;  2NZD D;  3MGS C;  3R45 A;  3MGQ B;  1KX3 C;  5AV9 B;  3AZK B;  3W96 D;  4KUD C;  3WA9 B;  4KGC D;  1M18 B;  3REL A;  3AZN B;  1KX5 A;  1P3L C;  3REI A;  2UWX A;  3C1C A;  5JA4 B;  4E45 A;  1N1J A;  3MGP B;  3WTP A;  3W99 B;  3KWQ A;  3O62 C;  2ARO D;  2F2A C;  5C3I C;  2NQB D;  3LZ1 B;  4Z5T B;  3V9R A;  5E5A A;  5JRG A;  3H0R C;  1BH8 A;  1P3K A;  1R4V A;  2BYK B;  1P3A D;  3H0M C;  3LEL B;  2Y2I A;  3MGQ D;  5CPJ B;  5AV9 D;  3B6G C;  4Z66 D;  3AZK D;  1P3F B;  4KHA A;  4J8U C;  1HQ3 C;  3WA9 D;  3AZL A;  4XZQ D;  1M18 D;  5B40 A;  3REH A;  3AZN D;  1B6W A;  3B0D B;  3H0L C;  5B1M C;  3AZH A;  3AV2 A;  3A6N A;  4WNN A;  3TU4 D;  3X1T A;  4R8P C;  4Z66 C;  3UTB B;  3W99 D;  1U35 A;  3MGR C;  4YM6 A;  4J8W B;  3WAA B;  4XZQ C;  5B31 B;  2HIO A;  4JJN A;  3AZN C;  1TAF A;  4H9P B;  4ZUX B;  3TU4 C;  1ID3 B;  5AVB C;  4Z5T D;  3LZ0 C;  4H9R A;  5BO0 A;  5GT3 A;  1AOI B;  5F99 B;  5B24 A;  3AZI B;  2PYO B;  3AYW A;  3AZE D;  4H9O A;  3VH6 W;  1P3I B;  3EPH A;  5KDM B;  3NQU A;  3LEL D;  2CWE A;  3X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...