1P3OB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGAKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oB00
3KUYB 3AZMB 3AV2D 5KDMA 3KXBD 3W98C 4UUZB 5B31C 1M18B 5B2IB 4H9NA 3REKB 5JA4A 4XZQB 4HGAB 3W99D 4XZQC 5KDMB 5CPIA 4G91B 2JSSA 4Z66A 5CHLB 5GXQA 3MGRA 2RVQC 5JA4B 4H9SC 2HUEC 3LZ1B 2FJ7D 5E5AA 3WKJA 3AZFD 2L5AA 3X1UC 1KX3D 4NE3A 5CPIB 3LZ1C 5B0ZC 4Z66B 3AZNC 5GXQB 3MGRB 3VH5A 3AZLC 1S32B 3AV2A 5GT0D 3MNNA 4J8WD 1AOID 3KXBA 5E5AB 3VH5W 5BS7C 3WKJB 3AZGB 1S32C 1P3OD 4WU8D 3MGSC 1F66A 3WKJC 5CPJD 3MGPA 3AZGC 1P3LA 2IO5B 3AV2B 3MNNB 3A6NA 3MGQD 5GSUD 5B40D 3KXBB 4CAYB 4H9RA 1F66B 3AFAD 3KXBC 3MGPB 4LD9D 3TU4D 3VH6A 4ZUXD 5AV5D 1P3LB 3W99B 4XUJD 3AZKA 3A6NB 1KX3A 3B6GA 4CSRA 3W99C 5B2JD 3B6FA 4H9RB 5AV8D 3W97D 2BYKA 1KX3B 4CSRB 2FJ7C 3AZHD 5B1MD 3AZFC 3B6FB 4ZBJB 3REHC 1KX3C 4KGCD 5DNMA 4WV4B 5BO0A 3MGQA 2LY8A 2AROD 4ZBJC 2BYKB 3X1TD 3WTPD 4WU8B 1P3OB 2CV5D 3W96D 5GT0C 4J8WC 3AFAA 1F1EA 1AOIC 1P3OC 3AZJD 4WU8C 1H3OA 3TU4A 4ZUXA 3O62D 5BO0B 5DNMB 3MGQB 5JRGA 3MVDA 5CPJC 1TZYD 3R45A 3AFAB 4H9PA 5GSUC 5B40C 3AZID 5BNXA 1H3OB 5AV5B 4ZUXB 3TU4B 1ULYA 5JRGB 3MVDB 4LD9C 3TU4C 3R45B 5AV5C 3KSYA 4XUJC 3AZED 4KUDC 4H9PB 4NE5A 4Z5TD 3UTAD 1BH9A 4QLCD 5B2JC 1U35D 3X1TA 3W97B 3WTPA 1P3ID 5AV8C 3LZ0D 1M19A 3AZHB 3W97C 1A7WA 4WU9C 3AZJA 5CPKD 3AZMD 2NQBD 3AZHC 2F8NG 5B1MC 1KX4C 4J8UC 3X1TB 1P3GA 4KGCC 3WTPB 1M18D 3W96B 5B2ID 2AROC 2NZDA 4WZSB 3REKD 3AZJB 3W96C 2CV5C 5AY8A 3B0DC 1HTAA 3VH5T 1P3GB 2BYMB 3O62C 1TZYC 3AZIB 2NZDB 1U35A 4QLCA 5AY8B 1M1AA 3AYWA 3AZIC 2F8ND 5CPID 4Z66D 5CPKA 3MGRD 2NQBA 3UTAB 1U35B 5B33D 4QLCB 3AZEC 3B0BA 5E5AD 3AYWB 4Z5TC 3UTAC 1P3KA 5AV6A 5CP6C 5CPKB 1P3IC 3LZ0C 1P3PC 2NQBB 3MNND 1KU5A 3AV1A 3KUYC 3AZMC 1P3MA 5BT1C 1P3KB 5FUGA 1F66D 1P3FD 1P34D 1M18C 3MGPD 5B2IC 3UT9A 3REKC 1P3LD 3C1BA 2PYOA 2F8NA 3A6ND 1BH8A 4HGAC 3AV1B 1P3MB 4H9NB 5FUGB 5BNVA 4G91C 5B33A 3WAAA 1TAFA 3UT9B 2F8NK 4J8XA 2PYOB 3AZKD 2F8NB 3B6GD 1ZLAA 5B0YA 3B6FD 1HQ3D 5BNVB 5CPIC 4H9OA 1JFIA 5B33B 1EQZA 4Z66C 1B67A 5GXQC 3MGRC 1TAFB 3C1CA 4J8XB 5GT3A 1P3FA 1P34A 5E5AC 5B0YB 4H9OB 5DNMD 1EQZB 3C1CB 5GT3B 2IO5C 3AV2C 3MNNC 1P3FB 1P34B 1F66C 1P3FC 5JRGD 3MVDD 3MGPC 4YM6A 3AN2D 1P3LC 1HQ3A 4E45A 3A6NC 5B32G 3V9RA 3AZKB 3B6GB 2YFWA 3REID 4YM6B 3AZKC 1HQ3B 3B6GC 4YS3A 3V9RB 3LJAA 3B6FC 1HQ3C 1P3AD 2YFWB 5AVCD 1M19D 4NE6A 3X1SA 4AWLB 4WNNA 3UTBA 4YS3B 4AWLC 3AN2A 1P3GD 5DNMC 3MGQC 2NZDD 3X1SB 3WA9D 5B1LA 4WNNB 5AY8D 4EO5B 3AFAC 3REJA 3UTBB 4KHAA 1N1JA 3REIA 2HIOD 3AN2B 4ZUXC 4EO5C 5DNND 3RELA 5JRGC 3MVDC 5BNXB 4JJNA 5B1LB 3LELA 3REJB 1P3AA 3AYWD 1M1AD 4KHAB 4R8PA 1N1JB 1KX5D 3REIB 5AVCA 3WTPE 3RELB 5B31G 5B32A 4JJNB 1BH9B 3LELB 3KWQA 4Z2MH 1P3AB 4R8PB 1P3KD 5AVCB 5AV6D 4J8VA 1M19B 3X1TC 1P3AC 3WA9A 3WTPC 3X1VA 3NQJA 1M19C 5B24D 1Q9CA 5B32B 3AZJC 2HIOA 3KWQB 5G49A 3AV1D 5C3IB 1P3MD 5DNNA 4J8VB 3WA9B 1P3GC 5C3IC 4DRAA 2NZDC 3UT9D 3C1BD 1KX5A 2PYOD 2HIOB 5G49B 5AY8C 5DNNB 4X23A 1M1AB 3WAAD 4J8XD 1KX5B 1U35C 4QLCC 1M1AC 3AYWC 1ZLAD 5B0YD 1WWIA 5B24A 4Z2MG 4X23B 1EQZD 5CPKC 3X1UD 1P3BA 3C1CD 2NQBC 5GT3D 5AV6B 5AV9A 1P3KC 5AV6C 5B24B 3W98A 5B31A 3MGSD 3AV1C 1P3MC 4XZQA 3C1BB 1WWSA 1BH8B 2YFVA 4YM6D 3UT9C 3C1BC 2PYOC 4H9SA 3X1UA 3WAAB 3LZ1A 5B0ZA 5B33C 2YFVB 3AZNA 3WAAC 1ZLAB 3AZLA 4J8XC 3B0CW 2HUEB 1JFIB 4YS3D 5BS7A 1ZLAC 3X1UB 1S32A 5B0YC 3LJAD 3MGSA 5B0ZB 1EQZC 3AZNB 3AZGA 3REHD 3C1CC 3X1SD 3AZLB 5GT3C 3UTBD 1P34C 1B6WA 3MGSB 4M6BA 5F99D 4CAYA 5B1LD 3REJD 3W99A 5AVBD 3RELD 4NFTA 4YM6C 4JJND 3LELD 2FJ7A 4R8PD 3AZFA 3REHA 4KUDD 3VH6W 5B32D 3LJAB 3KWQD 5GT0A 4J8WA 4YS3C 1ID3D 1AOIA 2FJ7B 5F99A 4WU9D 3AZFB 3LJAC 4WU8A 4J8VD 3REHB 1P3OA 3X1VD 4H9QA 5CPJA 1KX4D 4J8UD 1BFMA 3X1SC 4G92B 5GT0B 5AVBA 4J8WB 3UTBC 5GSUA 5B40A 1AOIB 5F99B 2F8NH 4G92C 3AN2C 4H9QB 5F99C 5CPJB 4LD9A 5AV5A 5B1LC 4XUJA 4E44A 5AVBB 3REJC 4KUDA 5GSUB 5B40B 3REIC 5B2JA 5AVBC 3RELC 4X23D 1ID3A 5AV8A 4LD9B 3W97A 4JJNC 4WU9A 3LELC 4XUJB 4KUDB 4R8PC 3AZHA 5B1MA 5AVCC 5B2JB 4J8UA 1KX4A 4KGCA 1P3BD 1ID3B 5AV8B 2AROA 5B32C 4WU9B 5CP6D 3KWQC 3W96A 2CV5A 1ID3C 5AV9D 3X1VB 3NQJB 1P3PD 3B0CT 5B1MB 1KX4B 4J8VC 4J8UB 3WA9C 5B31D 3W98D 4KGCB 3X1VC 3O62A 3KUYD 5BT1D 1TZYA 2AROB 2BYMA 2CWEA 2HIOC 2CV5B 3AZIA 5DNNC 4XZQD 3B0DB 3O62B 1TZYB 2RVQD 1KX5C 3AZEA 1R4VA 4Z5TA 3UTAA 3NQUA 3LZ1D 5B0ZD 5CP6A 4X23C 3AZND 1P3IA 3LZ0A 3AZLD 1P3PA 3AZEB 5GXQD 4DRBA 3KUYA 3AZMA 1S32D 1P3BB 4Z5TB 3NQUB 5B24C 4UUZA 3WKJD 1M18A 5CP6B 3AZGD 1P3BC 5B2IA 1P3IB 5AV9B 3LZ0B 1P3PB 3VH6T 3REKA 3W98B 5B31B 5AV9C
chains in the Genus database with same CATH superfamily
3KUYB 3AZMB 3AV2D 5KDMA 3KXBD 3W98C 4UUZB 5B31C 1M18B 5B2IB 4H9NA 3REKB 5JA4A 4XZQB 4HGAB 3W99D 4XZQC 5KDMB 2Y2KA 2Y2HA 5CPIA 3AL0C 4G91B 2JSSA 4Z66A 5CHLB 5GXQA 3MGRA 2RVQC 5JA4B 4H9SC 2HUEC 3LZ1B 2FJ7D 5E5AA 3WKJA 4DQYB 3AZFD 2L5AA 3X1UC 1KX3D 4NE3A 5CPIB 3LZ1C 2Y2MA 5B0ZC 2VQRA 4Z66B 3AZNC 5GXQB 3MGRB 3VH5A 3AZLC 1S32B 3AV2A 5GT0D 3MNNA 4J8WD 1AOID 3KXBA 5E5AB 3VH5W 5BS7C 3WKJB 3AZGB 1S32C 1P3OD 3EPKA 4WU8D 3MGSC 1F66A 3WKJC 2ZY4A 5CPJD 2FFFB 3MGPA 3AZGC 3KFUG 1P3LA 2IO5B 3AV2B 3MNNB 3A6NA 3MGQD 5GSUD 5B40D 3KXBB 4CAYB 4H9RA 1F66B 3AFAD 3KXBC 3MGPB 4LD9D 3TU4D 3VH6A 4ZUXD 5AV5D 1P3LB 3W99B 4XUJD 3AZKA 3A6NB 1KX3A 3B6GA 4CSRA 3W99C 5B2JD 3B6FA 4H9RB 3IP4C 5AV8D 3W97D 2BYKA 1KX3B 4CSRB 2FJ7C 3AZHD 5B1MD 3AZFC 2Y2IA 3B6FB 4ZBJB 3REHC 1KX3C 4KGCD 5DNMA 4WV4B 5BO0A 3MGQA 2LY8A 2AROD 4ZBJC 2BYKB 3X1TD 3WTPD 4WU8B 1P3OB 3F6TA 2CV5D 5GT0C 3W96D 4J8WC 3AFAA 1F1EA 1AOIC 4WJ3C 1P3OC 3AZJD 4WU8C 1H3OA 3TU4A 4ZUXA 3O62D 5BO0B 5DNMB 3MGQB 5JRGA 3MVDA 5CPJC 1TZYD 3R45A 3AFAB 4H9PA 5GSUC 5B40C 3AZID 5BNXA 1H3OB 1T3UA 4ZUXB 5AV5B 3TU4B 1ULYA 5JRGB 3MVDB 4LD9C 3TU4C 3R45B 5AV5C 3KSYA 4XUJC 3AZED 4KUDC 4H9PB 4NE5A 2F2AC 4Z5TD 3UTAD 1BH9A 4QLCD 5B2JC 1U35D 3X1TA 3W97B 3WTPA 1P3ID 5AV8C 3LZ0D 1M19A 3AZHB 3W97C 1A7WA 4WU9C 3AZJA 5CPKD 3AZMD 2NQBD 3AZHC 2F8NG 5B1MC 3EG5B 1KX4C 4J8UC 3X1TB 1P3GA 4KGCC 3WTPB 1M18D 3W96B 3EPLA 5B2ID 2AROC 2NZDA 4WZSB 3REKD 3AZJB 3W96C 2CV5C 5AY8A 3B0DC 1HTAA 3VH5T 1P3GB 2BYMB 3O62C 1TZYC 3AZIB 2NZDB 1U35A 4QLCA 5AY8B 1M1AA 3AYWA 3AZIC 3A1IA 2F8ND 5CPID 4Z66D 5CPKA 3MGRD 2NQBA 3UTAB 1U35B 5B33D 4QLCB 3AZEC 3B0BA 5E5AD 3AYWB 4Z5TC 3UTAC 1P3KA 2Y2JA 2ZY2A 5AV6A 2XD1A 5CP6C 5CPKB 1P3IC 3LZ0C 1P3PC 2NQBB 3MNND 1KU5A 3AV1A 3KUYC 3AZMC 1P3MA 5BT1C 1P3KB 5FUGA 1F66D 1P3FD 1P34D 1M18C 3MGPD 5B2IC 3UT9A 3REKC 1P3LD 3C1BA 2PYOA 2F8NA 3A6ND 1BH8A 4HGAC 3AV1B 1P3MB 4H9NB 5FUGB 5BNVA 4G91C 3A1KA 5B33A 3WAAA 1TAFA 3UT9B 2F8NK 4J8XA 2PYOB 1Z2CB 3AZKD 2F8NB 3B6GD 2G5IC 1ZLAA 5B0YA 3B6FD 1HQ3D 5BNVB 5CPIC 4H9OA 1JFIA 5B33B 1EQZA 4Z66C 1B67A 5GXQC 3MGRC 1TAFB 3C1CA 4J8XB 5GT3A 1P3FA 1P34A 5E5AC 5B0YB 4H9OB 5DNMD 1EQZB 3C1CB 5GT3B 2IO5C 3AV2C 3MNNC 1P3FB 1P34B 1F66C 1P3FC 3H0LC 5JRGD 3MVDD 3MGPC 4YM6A 3AN2D 1P3LC 1HQ3A 4E45A 3A6NC 5B32G 2J8PA 3V9RA 3AZKB 3B6GB 2YFWA 3REID 4YM6B 3AZKC 1HQ3B 3B6GC 2Y2GA 4YS3A 2Y2LA 3V9RB 3LJAA 3B6FC 1HQ3C 1P3AD 2JE5A 2YFWB 5AVCD 1M19D 4NE6A 3X1SA 4AWLB 4WNNA 3UTBA 4YS3B 2Y2NA 4AWLC 3AN2A 1P3GD 5DNMC 3MGQC 2NZDD 3X1SB 3WA9D 5B1LA 4WNNB 3H0MC 5AY8D 4EO5B 3AFAC 3REJA 3UTBB 4KHAA 1N1JA 3REIA 2HIOD 3AN2B 4ZUXC 3EPJA 4EO5C 5DNND 3RELA 5JRGC 3MVDC 5BNXB 4JJNA 5B1LB 3LELA 3REJB 1P3AA 3AYWD 1M1AD 2Y2QA 4KHAB 4R8PA 1N1JB 3P5JB 1KX5D 3REIB 5AVCA 3WTPE 3RELB 5B31G 5B32A 4JJNB 1BH9B 2RIQA 3LELB 3KWQA 4Z2MH 1P3AB 4R8PB 1P3KD 5AVCB 3H0RC 5AV6D 4J8VA 3X1TC 1M19B 1P3AC 3WA9A 3WTPC 3X1VA 3NQJA 1M19C 5B24D 1Q9CA 5B32B 3AZJC 2HIOA 3KWQB 5G49A 3AV1D 5C3IB 1P3MD 5DNNA 4J8VB 3EPHA 3WA9B 1P3GC 5C3IC 4DRAA 2NZDC 3UT9D 3C1BD 1KX5A 2PYOD 2HIOB 5G49B 5AY8C 5DNNB 4X23A 1M1AB 3WAAD 4J8XD 1KX5B 1U35C 4QLCC 1M1AC 3AYWC 1ZLAD 2ZM5A 5B0YD 1WWIA 5B24A 4Z2MG 4X23B 1EQZD 5CPKC 3X1UD 1P3BA 3C1CD 2NQBC 5GT3D 5AV6B 5AV9A 2JCHA 1P3KC 5AV6C 5B24B 3W98A 5B31A 3MGSD 3AV1C 1P3MC 4XZQA 3C1BB 1WWSA 1BH8B 2YFVA 4YM6D 3UT9C 3C1BC 2PYOC 4H9SA 4UPKA 3X1UA 3WAAB 3LZ1A 5B0ZA 5B33C 2YFVB 3AZNA 3WAAC 1ZLAB 3AZLA 4J8XC 3B0CW 2HUEB 1JFIB 4YS3D 5BS7A 1ZLAC 3X1UB 1S32A 5B0YC 3LJAD 3MGSA 5B0ZB 1PZRA 1EQZC 3AZNB 3AZGA 3REHD 3C1CC 3X1SD 3AZLB 5GT3C 3UTBD 1P34C 2G5HC 1B6WA 3MGSB 3FDDA 4M6BA 5F99D 4CAYA 5B1LD 3REJD 3W99A 5AVBD 3RELD 2ZY3A 4NFTA 4YM6C 4JJND 3LELD 2FJ7A 4R8PD 3AZFA 3REHA 4KUDD 3VH6W 5B32D 3LJAB 3KWQD 5GT0A 4J8WA 4YS3C 1ID3D 1AOIA 2FJ7B 5F99A 4WU9D 3AZFB 3LJAC 4WU8A 4J8VD 3REHB 1P3OA 3X1VD 4H9QA 5CPJA 1KX4D 4J8UD 1BFMA 3X1SC 4G92B 5GT0B 5AVBA 4J8WB 3UTBC 5GSUA 5B40A 1AOIB 5F99B 2F8NH 4G92C 3AN2C 4H9QB 5F99C 5CPJB 4LD9A 5AV5A 5B1LC 4XUJA 4E44A 5AVBB 3REJC 4KUDA 5GSUB 5B40B 3REIC 1W2EA 5B2JA 5AVBC 3RELC 4X23D 1ID3A 5AV8A 4LD9B 3W97A 2ZY5A 4JJNC 4WU9A 3LELC 4XUJB 4KUDB 4R8PC 3AZHA 5B1MA 5AVCC 5B2JB 4J8UA 1KX4A 2W8SA 2Y2OA 4KGCA 2UWXA 1P3BD 1ID3B 5AV8B 2AROA 5B32C 4WU9B 5CP6D 3KWQC 3W96A 2CV5A 1ID3C 5AV9D 3X1VB 3NQJB 1P3PD 3B0CT 5B1MB 2Y2PA 4J8VC 4J8UB 1KX4B 3WA9C 2XD5A 5B31D 2BG1A 3W98D 3X1VC 3O62A 3KUYD 4KGCB 5BT1D 1TZYA 2AROB 2DF4C 2BYMA 2CWEA 2HIOC 2CV5B 3AZIA 5DNNC 4XZQD 3B0DB 3O62B 1TZYB 2RVQD 1KX5C 3AZEA 1R4VA 4Z5TA 3UTAA 2DQNC 3NQUA 3LZ1D 5B0ZD 5CP6A 4X23C 3AZND 1P3IA 3LZ0A 3AZLD 1P3PA 3AZEB 5GXQD 4DRBA 3KUYA 3AZMA 1S32D 1P3BB 4Z5TB 3NQUB 5B24C 4UUZA 3WKJD 1M18A 5CP6B 3AZGD 1P3BC 5B2IA 1P3IB 5AV9B 3LZ0B 1P3PB 3VH6T 3REKA 3W98B 5B31B 5AV9C
chains in the Genus database with same CATH topology
3KUYB 3AZMB 3AV2D 5KDMA 3KXBD 3W98C 4UUZB 5B31C 1M18B 5B2IB 4H9NA 3REKB 5JA4A 4XZQB 4HGAB 3W99D 4XZQC 5KDMB 2Y2KA 2Y2HA 5CPIA 3AL0C 4G91B 2JSSA 4Z66A 5CHLB 5GXQA 3MGRA 2RVQC 5JA4B 4H9SC 2HUEC 3LZ1B 2FJ7D 5E5AA 3WKJA 4DQYB 3AZFD 2L5AA 3X1UC 1KX3D 4NE3A 5CPIB 3LZ1C 2Y2MA 5B0ZC 2VQRA 4Z66B 3AZNC 5GXQB 3MGRB 3VH5A 3AZLC 1S32B 3AV2A 5GT0D 3MNNA 4J8WD 1AOID 3KXBA 5E5AB 3VH5W 5BS7C 3WKJB 3AZGB 1S32C 1P3OD 3EPKA 4WU8D 3MGSC 1F66A 3WKJC 2ZY4A 5CPJD 2FFFB 3MGPA 3AZGC 3KFUG 1P3LA 2IO5B 3AV2B 3MNNB 3A6NA 3MGQD 5GSUD 5B40D 3KXBB 4CAYB 4H9RA 1F66B 3AFAD 3KXBC 3MGPB 4LD9D 3TU4D 3VH6A 4ZUXD 5AV5D 1P3LB 3W99B 4XUJD 3AZKA 3A6NB 1KX3A 3B6GA 4CSRA 3W99C 5B2JD 3B6FA 4H9RB 3IP4C 5AV8D 3W97D 2BYKA 1KX3B 4CSRB 2FJ7C 3AZHD 5B1MD 3AZFC 2Y2IA 3B6FB 4ZBJB 3REHC 1KX3C 4KGCD 5DNMA 4WV4B 5BO0A 3MGQA 2LY8A 2AROD 4ZBJC 2BYKB 3X1TD 3WTPD 4WU8B 1P3OB 3F6TA 2CV5D 5GT0C 3W96D 4J8WC 3AFAA 1F1EA 1AOIC 4WJ3C 1P3OC 3AZJD 4WU8C 1H3OA 3TU4A 4ZUXA 3O62D 5BO0B 5DNMB 3MGQB 5JRGA 3MVDA 5CPJC 1TZYD 3R45A 3AFAB 4H9PA 5GSUC 5B40C 3AZID 5BNXA 1H3OB 1T3UA 4ZUXB 5AV5B 3TU4B 1ULYA 5JRGB 3MVDB 4LD9C 3TU4C 3R45B 5AV5C 3KSYA 4XUJC 3AZED 4KUDC 4H9PB 4NE5A 2F2AC 4Z5TD 3UTAD 1BH9A 4QLCD 5B2JC 1U35D 3X1TA 3W97B 3WTPA 1P3ID 5AV8C 3LZ0D 1M19A 3AZHB 3W97C 1A7WA 4WU9C 3AZJA 5CPKD 3AZMD 2NQBD 3AZHC 2F8NG 5B1MC 3EG5B 1KX4C 4J8UC 3X1TB 1P3GA 4KGCC 3WTPB 1M18D 3W96B 3EPLA 5B2ID 2AROC 2NZDA 4WZSB 3REKD 3AZJB 3W96C 2CV5C 5AY8A 3B0DC 1HTAA 3VH5T 1P3GB 2BYMB 3O62C 1TZYC 3AZIB 2NZDB 1U35A 4QLCA 5AY8B 1M1AA 3AYWA 3AZIC 3A1IA 2F8ND 5CPID 4Z66D 5CPKA 3MGRD 2NQBA 3UTAB 1U35B 5B33D 4QLCB 3AZEC 3B0BA 5E5AD 3AYWB 4Z5TC 3UTAC 1P3KA 2Y2JA 2ZY2A 5AV6A 2XD1A 5CP6C 5CPKB 1P3IC 3LZ0C 1P3PC 2NQBB 3MNND 1KU5A 3AV1A 3KUYC 3AZMC 1P3MA 5BT1C 1P3KB 5FUGA 1F66D 1P3FD 1P34D 1M18C 3MGPD 5B2IC 3UT9A 3REKC 1P3LD 3C1BA 2PYOA 2F8NA 3A6ND 1BH8A 4HGAC 3AV1B 1P3MB 4H9NB 5FUGB 5BNVA 4G91C 3A1KA 5B33A 3WAAA 1TAFA 3UT9B 2F8NK 4J8XA 2PYOB 1Z2CB 3AZKD 2F8NB 3B6GD 2G5IC 1ZLAA 5B0YA 3B6FD 1HQ3D 5BNVB 5CPIC 4H9OA 1JFIA 5B33B 1EQZA 4Z66C 1B67A 5GXQC 3MGRC 1TAFB 3C1CA 4J8XB 5GT3A 1P3FA 1P34A 5E5AC 5B0YB 4H9OB 5DNMD 1EQZB 3C1CB 5GT3B 2IO5C 3AV2C 3MNNC 1P3FB 1P34B 1F66C 1P3FC 3H0LC 5JRGD 3MVDD 3MGPC 4YM6A 3AN2D 1P3LC 1HQ3A 4E45A 3A6NC 5B32G 2J8PA 3V9RA 3AZKB 3B6GB 2YFWA 3REID 4YM6B 3AZKC 1HQ3B 3B6GC 2Y2GA 4YS3A 2Y2LA 3V9RB 3LJAA 3B6FC 1HQ3C 1P3AD 2JE5A 2YFWB 5AVCD 1M19D 4NE6A 3X1SA 4AWLB 4WNNA 3UTBA 4YS3B 2Y2NA 4AWLC 3AN2A 1P3GD 5DNMC 3MGQC 2NZDD 3X1SB 3WA9D 5B1LA 4WNNB 3H0MC 5AY8D 4EO5B 3AFAC 3REJA 3UTBB 4KHAA 1N1JA 3REIA 2HIOD 3AN2B 4ZUXC 3EPJA 4EO5C 5DNND 3RELA 5JRGC 3MVDC 5BNXB 4JJNA 5B1LB 3LELA 3REJB 1P3AA 3AYWD 1M1AD 2Y2QA 4KHAB 4R8PA 1N1JB 3P5JB 1KX5D 3REIB 5AVCA 3WTPE 3RELB 5B31G 5B32A 4JJNB 1BH9B 2RIQA 3LELB 3KWQA 4Z2MH 1P3AB 4R8PB 1P3KD 5AVCB 3H0RC 5AV6D 4J8VA 3X1TC 1M19B 1P3AC 3WA9A 3WTPC 3X1VA 3NQJA 1M19C 5B24D 1Q9CA 5B32B 3AZJC 2HIOA 3KWQB 5G49A 3AV1D 5C3IB 1P3MD 5DNNA 4J8VB 3EPHA 3WA9B 1P3GC 5C3IC 4DRAA 2NZDC 3UT9D 3C1BD 1KX5A 2PYOD 2HIOB 5G49B 5AY8C 5DNNB 4X23A 1M1AB 3WAAD 4J8XD 1KX5B 1U35C 4QLCC 1M1AC 3AYWC 1ZLAD 2ZM5A 5B0YD 1WWIA 5B24A 4Z2MG 4X23B 1EQZD 5CPKC 3X1UD 1P3BA 3C1CD 2NQBC 5GT3D 5AV6B 5AV9A 2JCHA 1P3KC 5AV6C 5B24B 3W98A 5B31A 3MGSD 3AV1C 1P3MC 4XZQA 3C1BB 1WWSA 1BH8B 2YFVA 4YM6D 3UT9C 3C1BC 2PYOC 4H9SA 4UPKA 3X1UA 3WAAB 3LZ1A 5B0ZA 5B33C 2YFVB 3AZNA 3WAAC 1ZLAB 3AZLA 4J8XC 3B0CW 2HUEB 1JFIB 4YS3D 5BS7A 1ZLAC 3X1UB 1S32A 5B0YC 3LJAD 3MGSA 5B0ZB 1PZRA 1EQZC 3AZNB 3AZGA 3REHD 3C1CC 3X1SD 3AZLB 5GT3C 3UTBD 1P34C 2G5HC 1B6WA 3MGSB 3FDDA 4M6BA 5F99D 4CAYA 5B1LD 3REJD 3W99A 5AVBD 3RELD 2ZY3A 4NFTA 4YM6C 4JJND 3LELD 2FJ7A 4R8PD 3AZFA 3REHA 4KUDD 3VH6W 5B32D 3LJAB 3KWQD 5GT0A 4J8WA 4YS3C 1ID3D 1AOIA 2FJ7B 5F99A 4WU9D 3AZFB 3LJAC 4WU8A 4J8VD 3REHB 1P3OA 3X1VD 4H9QA 5CPJA 1KX4D 4J8UD 1BFMA 3X1SC 4G92B 5GT0B 5AVBA 4J8WB 3UTBC 5GSUA 5B40A 1AOIB 5F99B 2F8NH 4G92C 3AN2C 4H9QB 5F99C 5CPJB 4LD9A 5AV5A 5B1LC 4XUJA 4E44A 5AVBB 3REJC 4KUDA 5GSUB 5B40B 3REIC 1W2EA 5B2JA 5AVBC 3RELC 4X23D 1ID3A 5AV8A 4LD9B 3W97A 2ZY5A 4JJNC 4WU9A 3LELC 4XUJB 4KUDB 4R8PC 3AZHA 5B1MA 5AVCC 5B2JB 4J8UA 1KX4A 2W8SA 2Y2OA 4KGCA 2UWXA 1P3BD 1ID3B 5AV8B 2AROA 5B32C 4WU9B 5CP6D 3KWQC 3W96A 2CV5A 1ID3C 5AV9D 3X1VB 3NQJB 1P3PD 3B0CT 5B1MB 2Y2PA 4J8VC 4J8UB 1KX4B 3WA9C 2XD5A 5B31D 2BG1A 3W98D 3X1VC 3O62A 3KUYD 4KGCB 5BT1D 1TZYA 2AROB 2DF4C 2BYMA 2CWEA 2HIOC 2CV5B 3AZIA 5DNNC 4XZQD 3B0DB 3O62B 1TZYB 2RVQD 1KX5C 3AZEA 1R4VA 4Z5TA 3UTAA 2DQNC 3NQUA 3LZ1D 5B0ZD 5CP6A 4X23C 3AZND 1P3IA 3LZ0A 3AZLD 1P3PA 3AZEB 5GXQD 4DRBA 3KUYA 3AZMA 1S32D 1P3BB 4Z5TB 3NQUB 5B24C 4UUZA 3WKJD 1M18A 5CP6B 3AZGD 1P3BC 5B2IA 1P3IB 5AV9B 3LZ0B 1P3PB 3VH6T 3REKA 3W98B 5B31B 5AV9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY B;  3AZM B;  3AV2 D;  5KDM A;  3KXB D;  3W98 C;  4UUZ B;  5B31 C;  1M18 B;  5B2I B;  4H9N A;  3REK B;  5JA4 A;  4XZQ B;  4HGA B;  3W99 D;  4XZQ C;  5KDM B;  5CPI A;  4G91 B;  2JSS A;  4Z66 A;  5CHL B;  5GXQ A;  3MGR A;  2RVQ C;  5JA4 B;  4H9S C;  2HUE C;  3LZ1 B;  2FJ7 D;  5E5A A;  3WKJ A;  3AZF D;  2L5A A;  3X1U C;  1KX3 D;  4NE3 A;  5CPI B;  3LZ1 C;  5B0Z C;  4Z66 B;  3AZN C;  5GXQ B;  3MGR B;  3VH5 A;  3AZL C;  1S32 B;  3AV2 A;  5GT0 D;  3MNN A;  4J8W D;  1AOI D;  3KXB A;  5E5A B;  3VH5 W;  5BS7 C;  3WKJ B;  3AZG B;  1S32 C;  1P3O D;  4WU8 D;  3MGS C;  1F66 A;  3WKJ C;  5CPJ D;  3MGP A;  3AZG C;  1P3L A;  2IO5 B;  3AV2 B;  3MNN B;  3A6N A;  3MGQ D;  5GSU D;  5B40 D;  3KXB B;  4CAY B;  4H9R A;  1F66 B;  3AFA D;  3KXB C;  3MGP B;  4LD9 D;  3TU4 D;  3VH6 A;  4ZUX D;  5AV5 D;  1P3L B;  3W99 B;  4XUJ D;  3AZK A;  3A6N B;  1KX3 A;  3B6G A;  4CSR A;  3W99 C;  5B2J D;  3B6F A;  4H9R B;  5AV8 D;  3W97 D;  2BYK A;  1KX3 B;  4CSR B;  2FJ7 C;  3AZH D;  5B1M D;  3AZF C;  3B6F B;  4ZBJ B;  3REH C;  1KX3 C;  4KGC D;  5DNM A;  4WV4 B;  5BO0 A;  3MGQ A;  2LY8 A;  2ARO D;  4ZBJ C;  2BYK B;  3X1T D;  3WTP D;  4WU8 B;  1P3O B;  2CV5 D;  3W96 D;  5GT0 C;  4J8W C;  3AFA A;  1F1E A;  1AOI C;  1P3O C;  3AZJ D;  4WU8 C;  1H3O A;  3TU4 A;  4ZUX A;  3O62 D;  5BO0 B;  5DNM B;  3MGQ B;  5JRG A;  3MVD A;  5CPJ C;  1TZY D;  3R45 A;  3AFA B;  4H9P A;  5GSU C;  5B40 C;  3AZI D;  5BNX A;  1H3O B;  5AV5 B;  4ZUX B;  3TU4 B;  1ULY A;  5JRG B;  3MVD B;  4LD9 C;  3TU4 C;  3R45 B;  5AV5 C;  3KSY A;  4XUJ C;  3AZE D;  4KUD C;  4H9P B;  4NE5 A;  4Z5T D;  3UTA D;  1BH9 A;  4QLC D;  5B2J C;  1U35 D;  3X1T A;  3W97 B;  3WTP A;  1P3I D;  5AV8 C;  3LZ0 D;  1M19 A;  3AZH B;  3W97 C;  1A7W A;  4WU9 C;  3AZJ A;  5CPK D;  3AZM D;  2NQB D;  3AZH C;  2F8N G;  5B1M C;  1KX4 C;  4J8U C;  3X1T B;  1P3G A;  4KGC C;  3WTP B;  1M18 D;  3W96 B;  5B2I D;  2ARO C;  2NZD A;  4WZS B;  3REK D;  3AZJ B;  3W96 C;  2CV5 C;  5AY8 A;  3B0D C;  1HTA A;  3VH5 T;  1P3G B;  2BYM B;  3O62 C;  1TZY C;  3AZI B;  2NZD B;  1U35 A;  4QLC A;  5AY8 B;  1M1A A;  3AYW A;  3AZI C;  2F8N D;  5CPI D;  4Z66 D;  5CPK A;  3MGR D;  2NQB A;  3UTA B;  1U35 B;  5B33 D;  4QLC B;  3AZE C;  3B0B A;  5E5A D;  3AYW B;  4Z5T C;  3UTA C;  1P3K A;  5AV6 A;  5CP6 C;  5CPK B;  1P3I C;  3LZ0 C;  1P3P C;  2NQB B;  3MNN D;  1KU5 A;  3AV1 A;  3KUY C;  3AZM C;  1P3M A;  5BT1 C;  1P3K B;  5FUG A;  1F66 D;  1P3F D;  1P34 D;  1M18 C;  3MGP D;  5B2I C;  3UT9 A;  3REK C;  1P3L D;  3C1B A;  2PYO A;  2F8N A;  3A6N D;  1BH8 A;  4HGA C;  3AV1 B;  1P3M B;  4H9N B;  5FUG B;  5BNV A;  4G91 C;  5B33 A;  3WAA A;  1TAF A;  3UT9 B;  2F8N K;  4J8X A;  2PYO B;  3AZK D;  2F8N B;  3B6G D;  1ZLA A;  5B0Y A;  3B6F D;  1HQ3 D;  5BNV B;  5CPI C;  4H9O A;  1JFI A;  5B33 B;  1EQZ A;  4Z66 C;  1B67 A;  5GXQ C;  3MGR C;  1TAF B;  3C1C A;  4J8X B;  5GT3 A;  1P3F A;  1P34 A;  5E5A C;  5B0Y B;  4H9O B;  5DNM D;  1EQZ B;  3C1C B;  5GT3 B;  2IO5 C;  3AV2 C;  3MNN C;  1P3F B;  1P34 B;  1F66 C;  1P3F C;  5JRG D;  3MVD D;  3MGP C;  4YM6 A;  3AN2 D;  1P3L C;  1HQ3 A;  4E45 A;  3A6N C;  5B32 G;  3V9R A;  3AZK B;  3B6G B;  2YFW A;  3REI D;  4YM6 B;  3AZK C;  1HQ3 B;  3B6G C;  4YS3 A;  3V9R B;  3LJA A;  3B6F C;  1HQ3 C;  1P3A D;  2YFW B;  5AVC D;  1M19 D;  4NE6 A;  3X1S A;  4AWL B;  4WNN A;  3UTB A;  4YS3 B;  4AWL C;  3AN2 A;  1P3G D;  5DNM C;  3MGQ C;  2NZD D;  3X1S B;  3WA9 D;  5B1L A;  4WNN B;  5AY8 D;  4EO5 B;  3AFA C;  3REJ A;  3UTB B;  4KHA A;  1N1J A;  3REI A;  2HIO D;  3AN2 B;  4ZUX C;  4EO5 C;  5DNN D;  3REL A;  5JRG C;  3MVD C;  5BNX B;  4JJN A;  5B1L B;  3LEL A;  3REJ B;  1P3A A;  3AYW D;  1M1A D;  4KHA B;  4R8P A;  1N1J B;  1KX5 D;  3REI B;  5AVC A;  3WTP E;  3REL B;  5B31 G;  5B32 A;  4JJN B;  1BH9 B;  3LEL B;  3KWQ A;  4Z2M H;  1P3A B;  4R8P B;  1P3K D;  5AVC B;  5AV6 D;  4J8V A;  1M19 B;  3X1T C;  1P3A C;  3WA9 A;  3WTP C;  3X1V A;  3NQJ A;  1M19 C;  5B24 D;  1Q9C A;  5B32 B;  3AZJ C;  2HIO A;  3KWQ B;  5G49 A;  3AV1 D;  5C3I B;  1P3M D;  5DNN A;  4J8V B;  3WA9 B;  1P3G C;  5C3I C;  4DRA A;  2NZD C;  3UT9 D;  3C1B D;  1KX5 A;  2PYO D;  2HIO B;  5G49 B;  5AY8 C;  5DNN B;  4X23 A;  1M1A B;  3WAA D;  4J8X D;  1KX5 B;  1U35 C;  4QLC C;  1M1A C;  3AYW C;  1ZLA D;  5B0Y D;  1WWI A;  5B24 A;  4Z2M G;  4X23 B;  1EQZ D;  5CPK C;  3X1U D;  1P3B A;  3C1C D;  2NQB C;  5GT3 D;  5AV6 B;  5AV9 A;  1P3K C;  5AV6 C;  5B24 B;  3W98 A;  5B31 A;  3MGS D;  3AV1 C;  1P3M C;  4XZQ A;  3C1B B;  1WWS A;  1BH8 B;  2YFV A;  4YM6 D;  3UT9 C;  3C1B C;  2PYO C;  4H9S A;  3X1U A;  3WAA B;  3LZ1 A;  5B0Z A;  5B33 C;  2YFV B;  3AZN A;  3WAA C;  1ZLA B;  3AZL A;  4J8X C;  3B0C W;  2HUE B;  1JFI B;  4YS3 D;  5BS7 A;  1ZLA C;  3X1U B;  1S32 A;  5B0Y C;  3LJA D;  3MGS A;  5B0Z B;  1EQZ C;  3AZN B;  3AZG A;  3REH D;  3C1C C;  3X1S D;  3AZL B;  5GT3 C;  3UTB D;  1P34 C;  1B6W A;  3MGS B;  4M6B A;  5F99 D;  4CAY A;  5B1L D;  3REJ D;  3W99 A;  5AVB D;  3REL D;  4NFT A;  4YM6 C;  4JJN D;  3LEL D;  2FJ7 A;  4R8P D;  3AZF A;  3REH A;  4KUD D;  3VH6 W;  5B32 D;  3LJA B;  3KWQ D;  5GT0 A;  4J8W A;  4YS3 C;  1ID3 D;  1AOI A;  2FJ7 B;  5F99 A;  4WU9 D;  3AZF B;  3LJA C;  4WU8 A;  4J8V D;  3REH B;  1P3O A;  3X1V D;  4H9Q A;  5CPJ A;  1KX4 D;  4J8U D;  1BFM A;  3X1S C;  4G92 B;  5GT0 B;  5AVB A;  4J8W B;  3UTB C;  5GSU A;  5B40 A;  1AOI B;  5F99 B;  2F8N H;  4G92 C;  3AN2 C;  4H9Q B;  5F99 C;  5CPJ B;  4LD9 A;  5AV5 A;  5B1L C;  4XUJ A;  4E44 A;  5AVB B;  3REJ C;  4KUD A;  5GSU B;  5B40 B;  3REI C;  5B2J A;  5AVB C;  3REL C;  4X23 D;  1ID3 A;  5AV8 A;  4LD9 B;  3W97 A;  4JJN C;  4WU9 A;  3LEL C;  4XUJ B;  4KUD B;  4R8P C;  3AZH A;  5B1M A;  5AVC C;  5B2J B;  4J8U A;  1KX4 A;  4KGC A;  1P3B D;  1ID3 B;  5AV8 B;  2ARO A;  5B32 C;  4WU9 B;  5CP6 D;  3KWQ C;  3W96 A;  2CV5 A;  1ID3 C;  5AV9 D;  3X1V B;  3NQJ B;  1P3P D;  3B0C T;  5B1M B;  1KX4 B;  4J8V C;  4J8U B;  3WA9 C;  5B31 D;  3W98 D;  4KGC B;  3X1V C;  3O62 A;  3KUY D;  5BT1 D;  1TZY A;  2ARO B;  2BYM A;  2CWE A;  2HIO C;  2CV5 B;  3AZI A;  5DNN C;  4XZQ D;  3B0D B;  3O62 B;  1TZY B;  2RVQ D;  1KX5 C;  3AZE A;  1R4V A;  4Z5T A;  3UTA A;  3NQU A;  3LZ1 D;  5B0Z D;  5CP6 A;  4X23 C;  3AZN D;  1P3I A;  3LZ0 A;  3AZL D;  1P3P A;  3AZE B;  5GXQ D;  4DRB A;  3KUY A;  3AZM A;  1S32 D;  1P3B B;  4Z5T B;  3NQU B;  5B24 C;  4UUZ A;  3WKJ D;  1M18 A;  5CP6 B;  3AZG D;  1P3B C;  5B2I A;  1P3I B;  5AV9 B;  3LZ0 B;  1P3P B;  3VH6 T;  3REK A;  3W98 B;  5B31 B;  5AV9 C; 
#chains in the Genus database with same CATH topology
 3KUY B;  3AZM B;  3AV2 D;  5KDM A;  3KXB D;  3W98 C;  4UUZ B;  5B31 C;  1M18 B;  5B2I B;  4H9N A;  3REK B;  5JA4 A;  4XZQ B;  4HGA B;  3W99 D;  4XZQ C;  5KDM B;  2Y2K A;  2Y2H A;  5CPI A;  3AL0 C;  4G91 B;  2JSS A;  4Z66 A;  5CHL B;  5GXQ A;  3MGR A;  2RVQ C;  5JA4 B;  4H9S C;  2HUE C;  3LZ1 B;  2FJ7 D;  5E5A A;  3WKJ A;  4DQY B;  3AZF D;  2L5A A;  3X1U C;  1KX3 D;  4NE3 A;  5CPI B;  3LZ1 C;  2Y2M A;  5B0Z C;  2VQR A;  4Z66 B;  3AZN C;  5GXQ B;  3MGR B;  3VH5 A;  3AZL C;  1S32 B;  3AV2 A;  5GT0 D;  3MNN A;  4J8W D;  1AOI D;  3KXB A;  5E5A B;  3VH5 W;  5BS7 C;  3WKJ B;  3AZG B;  1S32 C;  1P3O D;  3EPK A;  4WU8 D;  3MGS C;  1F66 A;  3WKJ C;  2ZY4 A;  5CPJ D;  2FFF B;  3MGP A;  3AZG C;  3KFU G;  1P3L A;  2IO5 B;  3AV2 B;  3MNN B;  3A6N A;  3MGQ D;  5GSU D;  5B40 D;  3KXB B;  4CAY B;  4H9R A;  1F66 B;  3AFA D;  3KXB C;  3MGP B;  4LD9 D;  3TU4 D;  3VH6 A;  4ZUX D;  5AV5 D;  1P3L B;  3W99 B;  4XUJ D;  3AZK A;  3A6N B;  1KX3 A;  3B6G A;  4CSR A;  3W99 C;  5B2J D;  3B6F A;  4H9R B;  3IP4 C;  5AV8 D;  3W97 D;  2BYK A;  1KX3 B;  4CSR B;  2FJ7 C;  3AZH D;  5B1M D;  3AZF C;  2Y2I A;  3B6F B;  4ZBJ B;  3REH C;  1KX3 C;  4KGC D;  5DNM A;  4WV4 B;  5BO0 A;  3MGQ A;  2LY8 A;  2ARO D;  4ZBJ C;  2BYK B;  3X1T D;  3WTP D;  4WU8 B;  1P3O B;  3F6T A;  2CV5 D;  5GT0 C;  3W96 D;  4J8W C;  3AFA A;  1F1E A;  1AOI C;  4WJ3 C;  1P3O C;  3AZJ D;  4WU8 C;  1H3O A;  3TU4 A;  4ZUX A;  3O62 D;  5BO0 B;  5DNM B;  3MGQ B;  5JRG A;  3MVD A;  5CPJ C;  1TZY D;  3R45 A;  3AFA B;  4H9P A;  5GSU C;  5B40 C;  3AZI D;  5BNX A;  1H3O B;  1T3U A;  4ZUX B;  5AV5 B;  3TU4 B;  1ULY A;  5JRG B;  3MVD B;  4LD9 C;  3TU4 C;  3R45 B;  5AV5 C;  3KSY A;  4XUJ C;  3AZE D;  4KUD C;  4H9P B;  4NE5 A;  2F2A C;  4Z5T D;  3UTA D;  1BH9 A;  4QLC D;  5B2J C;  1U35 D;  3X1T A;  3W97 B;  3WTP A;  1P3I D;  5AV8 C;  3LZ0 D;  1M19 A;  3AZH B;  3W97 C;  1A7W A;  4WU9 C;  3AZJ A;  5CPK D;  3AZM D;  2NQB D;  3AZH C;  2F8N G;  5B1M C;  3EG5 B;  1KX4 C;  4J8U C;  3X1T B;  1P3G A;  4KGC C;  3WTP B;  1M18 D;  3W96 B;  3EPL A;  5B2I D;  2ARO C;  2NZD A;  4WZS B;  3REK D;  3AZJ B;  3W96 C;  2CV5 C;  5AY8 A;  3B0D C;  1HTA A;  3VH5 T;  1P3G B;  2BYM B;  3O62 C;  1TZY C;  3AZI B;  2NZD B;  1U35 A;  4QLC A;  5AY8 B;  1M1A A;  3AYW A;  3AZI C;  3A1I A;  2F8N D;  5CPI D;  4Z66 D;  5CPK A;  3MGR D;  2NQB A;  3UTA B;  1U35 B;  5B33 D;  4QLC B;  3AZE C;  3B0B A;  5E5A D;  3AYW B;  4Z5T C;  3UTA C;  1P3K A;  2Y2J A;  2ZY2 A;  5AV6 A;  2XD1 A;  5CP6 C;  5CPK B;  1P3I C;  3LZ0 C;  1P3P C;  2NQB B;  3MNN D;  1KU5 A;  3AV1 A;  3KUY C;  3AZM C;  1P3M A;  5BT1 C;  1P3K B;  5FUG A;  1F66 D;  1P3F D;  1P34 D;  1M18 C;  3MGP D;  5B2I C;  3UT9 A;  3REK C;  1P3L D;  3C1B A;  2PYO A;  2F8N A;  3A6N D;  1BH8 A;  4HGA C;  3AV1 B;  1P3M B;  4H9N B;  5FUG B;  5BNV A;  4G91 C;  3A1K A;  5B33 A;  3WAA A;  1TAF A;  3UT9 B;  2F8N K;  4J8X A;  2PYO B;  1Z2C B;  3AZK D;  2F8N B;  3B6G D;  2G5I C;  1ZLA A;  5B0Y A;  3B6F D;  1HQ3 D;  5BNV B;  5CPI C;  4H9O A;  1JFI A;  5B33 B;  1EQZ A;  4Z66 C;  1B67 A;  5GXQ C;  3MGR C;  1TAF B;  3C1C A;  4J8X B;  5GT3 A;  1P3F A;  1P34 A;  5E5A C;  5B0Y B;  4H9O B;  5DNM D;  1EQZ B;  3C1C B;  5GT3 B;  2IO5 C;  3AV2 C;  3MNN C;  1P3F B;  1P34 B;  1F66 C;  1P3F C;  3H0L C;  5JRG D;  3MVD D;  3MGP C;  4YM6 A;  3AN2 D;  1P3L C;  1HQ3 A;  4E45 A;  3A6N C;  5B32 G;  2J8P A;  3V9R A;  3AZK B;  3B6G B;  2YFW A;  3REI D;  4YM6 B;  3AZK C;  1HQ3 B;  3B6G C;  2Y2G A;  4YS3 A;  2Y2L A;  3V9R B;  3LJA A;  3B6F C;  1HQ3 C;  1P3A D;  2JE5 A;  2YFW B;  5AVC D;  1M19 D;  4NE6 A;  3X1S A;  4AWL B;  4WNN A;  3UTB A;  4YS3 B;  2Y2N A;  4AWL C;  3AN2 A;  1P3G D;  5DNM C;  3MGQ C;  2NZD D;  3X1S B;  3WA9 D;  5B1L A;  4WNN B;  3H0M C;  5AY8 D;  4EO5 B;  3AFA C;  3REJ A;  3UTB B;  4KHA A;  1N1J A;  3REI A;  2HIO D;  3AN2 B;  4ZUX C;  3EPJ A;  4EO5 C;  5DNN D;  3REL A;  5JRG C;  3MVD C;  5BNX B;  4JJN A;  5B1L B;  3LEL A;  3REJ B;  1P3A A;  3AYW D;  1M1A D;  2Y2Q A;  4KHA B;  4R8P A;  1N1J B;  3P5J B;  1KX5 D;  3REI B;  5AVC A;  3WTP E;  3REL B;  5B31 G;  5B32 A;  4JJN B;  1BH9 B;  2RIQ A;  3LEL B;  3KWQ A;  4Z2M H;  1P3A B;  4R8P B;  1P3K D;  5AVC B;  3H0R C;  5AV6 D;  4J8V A;  3X1T C;  1M19 B;  1P3A C;  3WA9 A;  3WTP C;  3X1V A;  3NQJ A;  1M19 C;  5B24 D;  1Q9C A;  5B32 B;  3AZJ C;  2HIO A;  3KWQ B;  5G49 A;  3AV1 D;  5C3I B;  1P3M D;  5DNN A;  4J8V B;  3EPH A;  3WA9 B;  1P3G C;  5C3I C;  4DRA A;  2NZD C;  3UT9 D;  3C1B D;  1KX5 A;  2PYO D;  2HIO B;  5G49 B;  5AY8 C;  5DNN B;  4X23 A;  1M1A B;  3WAA D;  4J8X D;  1KX5 B;  1U35 C;  4QLC C;  1M1A C;  3AYW C;  1ZLA D;  2ZM5 A;  5B0Y D;  1WWI A;  5B24 A;  4Z2M G;  4X23 B;  1EQZ D;  5CPK C;  3X1U D;  1P3B A;  3C1C D;  2NQB C;  5GT3 D;  5AV6 B;  5AV9 A;  2JCH A;  1P3K C;  5AV6 C;  5B24 B;  3W98 A;  5B31 A;  3MGS D;  3AV1 C;  1P3M C;  4XZQ A;  3C1B B;  1WWS A;  1BH8 B;  2YFV A;  4YM6 D;  3UT9 C;  3C1B C;  2PYO C;  4H9S A;  4UPK A;  3X1U A;  3WAA B;  3LZ1 A;  5B0Z A;  5B33 C;  2YFV B;  3AZN A;  3WAA C;  1ZLA B;  3AZL A;  4J8X C;  3B0C W;  2HUE B;  1JFI B;  4YS3 D;  5BS7 A;  1ZLA C;  3X1U B;  1S32 A;  5B0Y C;  3LJA D;  3MGS A;  5B0Z B;  1PZR A;  1EQZ C;  3AZN B;  3AZG A;  3REH D;  3C1C C;  3X1S D;  3AZL B;  5GT3 C;  3UTB D;  1P34 C;  2G5H C;  1B6W A;  3MGS B;  3FDD A;  4M6B A;  5F99 D;  4CAY A;  5B1L D;  3REJ D;  3W99 A;  5AVB D;  3REL D;  2ZY3 A;  4NFT A;  4YM6 C;  4JJN D;  3LEL D;  2FJ7 A;  4R8P D;  3AZF A;  3REH A;  4KUD D;  3VH6 W;  5B32 D;  3LJA B;  3KWQ D;  5GT0 A;  4J8W A;  4YS3 C;  1ID3 D;  1AOI A;  2FJ7 B;  5F99 A;  4WU9 D;  3AZF B;  3LJA C;  4WU8 A;  4J8V D;  3REH B;  1P3O A;  3X1V D;  4H9Q A;  5CPJ A;  1KX4 D;  4J8U D;  1BFM A;  3X1S C;  4G92 B;  5GT0 B;  5AVB A;  4J8W B;  3UTB C;  5GSU A;  5B40 A;  1AOI B;  5F99 B;  2F8N H;  4G92 C;  3AN2 C;  4H9Q B;  5F99 C;  5CPJ B;  4LD9 A;  5AV5 A;  5B1L C;  4XUJ A;  4E44 A;  5AVB B;  3REJ C;  4KUD A;  5GSU B;  5B40 B;  3REI C;  1W2E A;  5B2J A;  5AVB C;  3REL C;  4X23 D;  1ID3 A;  5AV8 A;  4LD9 B;  3W97 A;  2ZY5 A;  4JJN C;  4WU9 A;  3LEL C;  4XUJ B;  4KUD B;  4R8P C;  3AZH A;  5B1M A;  5AVC C;  5B2J B;  4J8U A;  1KX4 A;  2W8S A;  2Y2O A;  4KGC A;  2UWX A;  1P3B D;  1ID3 B;  5AV8 B;  2ARO A;  5B32 C;  4WU9 B;  5CP6 D;  3KWQ C;  3W96 A;  2CV5 A;  1ID3 C;  5AV9 D;  3X1V B;  3NQJ B;  1P3P D;  3B0C T;  5B1M B;  2Y2P A;  4J8V C;  4J8U B;  1KX4 B;  3WA9 C;  2XD5 A;  5B31 D;  2BG1 A;  3W98 D;  3X1V C;  3O62 A;  3KUY D;  4KGC B;  5BT1 D;  1TZY A;  2ARO B;  2DF4 C;  2BYM A;  2CWE A;  2HIO C;  2CV5 B;  3AZI A;  5DNN C;  4XZQ D;  3B0D B;  3O62 B;  1TZY B;  2RVQ D;  1KX5 C;  3AZE A;  1R4V A;  4Z5T A;  3UTA A;  2DQN C;  3NQU A;  3LZ1 D;  5B0Z D;  5CP6 A;  4X23 C;  3AZN D;  1P3I A;  3LZ0 A;  3AZL D;  1P3P A;  3AZE B;  5GXQ D;  4DRB A;  3KUY A;  3AZM A;  1S32 D;  1P3B B;  4Z5T B;  3NQU B;  5B24 C;  4UUZ A;  3WKJ D;  1M18 A;  5CP6 B;  3AZG D;  1P3B C;  5B2I A;  1P3I B;  5AV9 B;  3LZ0 B;  1P3P B;  3VH6 T;  3REK A;  3W98 B;  5B31 B;  5AV9 C; 
#chains in the Genus database with same CATH homology
 3KUY B;  3AZM B;  3AV2 D;  5KDM A;  3KXB D;  3W98 C;  4UUZ B;  5B31 C;  1M18 B;  5B2I B;  4H9N A;  3REK B;  5JA4 A;  4XZQ B;  4HGA B;  3W99 D;  4XZQ C;  5KDM B;  2Y2K A;  2Y2H A;  5CPI A;  3AL0 C;  4G91 B;  2JSS A;  4Z66 A;  5CHL B;  5GXQ A;  3MGR A;  2RVQ C;  5JA4 B;  4H9S C;  2HUE C;  3LZ1 B;  2FJ7 D;  5E5A A;  3WKJ A;  4DQY B;  3AZF D;  2L5A A;  3X1U C;  1KX3 D;  4NE3 A;  5CPI B;  3LZ1 C;  2Y2M A;  5B0Z C;  2VQR A;  4Z66 B;  3AZN C;  5GXQ B;  3MGR B;  3VH5 A;  3AZL C;  1S32 B;  3AV2 A;  5GT0 D;  3MNN A;  4J8W D;  1AOI D;  3KXB A;  5E5A B;  3VH5 W;  5BS7 C;  3WKJ B;  3AZG B;  1S32 C;  1P3O D;  3EPK A;  4WU8 D;  3MGS C;  1F66 A;  3WKJ C;  2ZY4 A;  5CPJ D;  2FFF B;  3MGP A;  3AZG C;  3KFU G;  1P3L A;  2IO5 B;  3AV2 B;  3MNN B;  3A6N A;  3MGQ D;  5GSU D;  5B40 D;  3KXB B;  4CAY B;  4H9R A;  1F66 B;  3AFA D;  3KXB C;  3MGP B;  4LD9 D;  3TU4 D;  3VH6 A;  4ZUX D;  5AV5 D;  1P3L B;  3W99 B;  4XUJ D;  3AZK A;  3A6N B;  1KX3 A;  3B6G A;  4CSR A;  3W99 C;  5B2J D;  3B6F A;  4H9R B;  3IP4 C;  5AV8 D;  3W97 D;  2BYK A;  1KX3 B;  4CSR B;  2FJ7 C;  3AZH D;  5B1M D;  3AZF C;  2Y2I A;  3B6F B;  4ZBJ B;  3REH C;  1KX3 C;  4KGC D;  5DNM A;  4WV4 B;  5BO0 A;  3MGQ A;  2LY8 A;  2ARO D;  4ZBJ C;  2BYK B;  3X1T D;  3WTP D;  4WU8 B;  1P3O B;  3F6T A;  2CV5 D;  5GT0 C;  3W96 D;  4J8W C;  3AFA A;  1F1E A;  1AOI C;  4WJ3 C;  1P3O C;  3AZJ D;  4WU8 C;  1H3O A;  3TU4 A;  4ZUX A;  3O62 D;  5BO0 B;  5DNM B;  3MGQ B;  5JRG A;  3MVD A;  5CPJ C;  1TZY D;  3R45 A;  3AFA B;  4H9P A;  5GSU C;  5B40 C;  3AZI D;  5BNX A;  1H3O B;  1T3U A;  4ZUX B;  5AV5 B;  3TU4 B;  1ULY A;  5JRG B;  3MVD B;  4LD9 C;  3TU4 C;  3R45 B;  5AV5 C;  3KSY A;  4XUJ C;  3AZE D;  4KUD C;  4H9P B;  4NE5 A;  2F2A C;  4Z5T D;  3UTA D;  1BH9 A;  4QLC D;  5B2J C;  1U35 D;  3X1T A;  3W97 B;  3WTP A;  1P3I D;  5AV8 C;  3LZ0 D;  1M19 A;  3AZH B;  3W97 C;  1A7W A;  4WU9 C;  3AZJ A;  5CPK D;  3AZM D;  2NQB D;  3AZH C;  2F8N G;  5B1M C;  3EG5 B;  1KX4 C;  4J8U C;  3X1T B;  1P3G A;  4KGC C;  3WTP B;  1M18 D;  3W96 B;  3EPL A;  5B2I D;  2ARO C;  2NZD A;  4WZS B;  3REK D;  3AZJ B;  3W96 C;  2CV5 C;  5AY8 A;  3B0D C;  1HTA A;  3VH5 T;  1P3G B;  2BYM B;  3O62 C;  1TZY C;  3AZI B;  2NZD B;  1U35 A;  4QLC A;  5AY8 B;  1M1A A;  3AYW A;  3AZI C;  3A1I A;  2F8N D;  5CPI D;  4Z66 D;  5CPK A;  3MGR D;  2NQB A;  3UTA B;  1U35 B;  5B33 D;  4QLC B;  3AZE C;  3B0B A;  5E5A D;  3AYW B;  4Z5T C;  3UTA C;  1P3K A;  2Y2J A;  2ZY2 A;  5AV6 A;  2XD1 A;  5CP6 C;  5CPK B;  1P3I C;  3LZ0 C;  1P3P C;  2NQB B;  3MNN D;  1KU5 A;  3AV1 A;  3KUY C;  3AZM C;  1P3M A;  5BT1 C;  1P3K B;  5FUG A;  1F66 D;  1P3F D;  1P34 D;  1M18 C;  3MGP D;  5B2I C;  3UT9 A;  3REK C;  1P3L D;  3C1B A;  2PYO A;  2F8N A;  3A6N D;  1BH8 A;  4HGA C;  3AV1 B;  1P3M B;  4H9N B;  5FUG B;  5BNV A;  4G91 C;  3A1K A;  5B33 A;  3WAA A;  1TAF A;  3UT9 B;  2F8N K;  4J8X A;  2PYO B;  1Z2C B;  3AZK D;  2F8N B;  3B6G D;  2G5I C;  1ZLA A;  5B0Y A;  3B6F D;  1HQ3 D;  5BNV B;  5CPI C;  4H9O A;  1JFI A;  5B33 B;  1EQZ A;  4Z66 C;  1B67 A;  5GXQ C;  3MGR C;  1TAF B;  3C1C A;  4J8X B;  5GT3 A;  1P3F A;  1P34 A;  5E5A C;  5B0Y B;  4H9O B;  5DNM D;  1EQZ B;  3C1C B;  5GT3 B;  2IO5 C;  3AV2 C;  3MNN C;  1P3F B;  1P34 B;  1F66 C;  1P3F C;  3H0L C;  5JRG D;  3MVD D;  3MGP C;  4YM6 A;  3AN2 D;  1P3L C;  1HQ3 A;  4E45 A;  3A6N C;  5B32 G;  2J8P A;  3V9R A;  3AZK B;  3B6G B;  2YFW A;  3REI D;  4YM6 B;  3AZK C;  1HQ3 B;  3B6G C;  2Y2G A;  4YS3 A;  2Y2L A;  3V9R B;  3LJA A;  3B6F C;  1HQ3 C;  1P3A D;  2JE5 A;  2YFW B;  5AVC D;  1M19 D;  4NE6 A;  3X1S A;  4AWL B;  4WNN A;  3UTB A;  4YS3 B;  2Y2N A;  4AWL C;  3AN2 A;  1P3G D;  5DNM C;  3MGQ C;  2NZD D;  3X1S B;  3WA9 D;  5B1L A;  4WNN B;  3H0M C;  5AY8 D;  4EO5 B;  3AFA C;  3REJ A;  3UTB B;  4KHA A;  1N1J A;  3REI A;  2HIO D;  3AN2 B;  4ZUX C;  3EPJ A;  4EO5 C;  5DNN D;  3REL A;  5JRG C;  3MVD C;  5BNX B;  4JJN A;  5B1L B;  3LEL A;  3REJ B;  1P3A A;  3AYW D;  1M1A D;  2Y2Q A;  4KHA B;  4R8P A;  1N1J B;  3P5J B;  1KX5 D;  3REI B;  5AVC A;  3WTP E;  3REL B;  5B31 G;  5B32 A;  4JJN B;  1BH9 B;  2RIQ A;  3LEL B;  3KWQ A;  4Z2M H;  1P3A B;  4R8P B;  1P3K D;  5AVC B;  3H0R C;  5AV6 D;  4J8V A;  3X1T C;  1M19 B;  1P3A C;  3WA9 A;  3WTP C;  3X1V A;  3NQJ A;  1M19 C;  5B24 D;  1Q9C A;  5B32 B;  3AZJ C;  2HIO A;  3KWQ B;  5G49 A;  3AV1 D;  5C3I B;  1P3M D;  5DNN A;  4J8V B;  3EPH A;  3WA9 B;  1P3G C;  5C3I C;  4DRA A;  2NZD C;  3UT9 D;  3C1B D;  1KX5 A;  2PYO D;  2HIO B;  5G49 B;  5AY8 C;  5DNN B;  4X23 A;  1M1A B;  3WAA D;  4J8X D;  1KX5 B;  1U35 C;  4QLC C;  1M1A C;  3AYW C;  1ZLA D;  2ZM5 A;  5B0Y D;  1WWI A;  5B24 A;  4Z2M G;  4X23 B;  1EQZ D;  5CPK C;  3X1U D;  1P3B A;  3C1C D;  2NQB C;  5GT3 D;  5AV6 B;  5AV9 A;  2JCH A;  1P3K C;  5AV6 C;  5B24 B;  3W98 A;  5B31 A;  3MGS D;  3AV1 C;  1P3M C;  4XZQ A;  3C1B B;  1WWS A;  1BH8 B;  2YFV A;  4YM6 D;  3UT9 C;  3C1B C;  2PYO C;  4H9S A;  4UPK A;  3X1U A;  3WAA B;  3LZ1 A;  5B0Z A;  5B33 C;  2YFV B;  3AZN A;  3WAA C;  1ZLA B;  3AZL A;  4J8X C;  3B0C W;  2HUE B;  1JFI B;  4YS3 D;  5BS7 A;  1ZLA C;  3X1U B;  1S32 A;  5B0Y C;  3LJA D;  3MGS A;  5B0Z B;  1PZR A;  1EQZ C;  3AZN B;  3AZG A;  3REH D;  3C1C C;  3X1S D;  3AZL B;  5GT3 C;  3UTB D;  1P34 C;  2G5H C;  1B6W A;  3MGS B;  3FDD A;  4M6B A;  5F99 D;  4CAY A;  5B1L D;  3REJ D;  3W99 A;  5AVB D;  3REL D;  2ZY3 A;  4NFT A;  4YM6 C;  4JJN D;  3LEL D;  2FJ7 A;  4R8P D;  3AZF A;  3REH A;  4KUD D;  3VH6 W;  5B32 D;  3LJA B;  3KWQ D;  5GT0 A;  4J8W A;  4YS3 C;  1ID3 D;  1AOI A;  2FJ7 B;  5F99 A;  4WU9 D;  3AZF B;  3LJA C;  4WU8 A;  4J8V D;  3REH B;  1P3O A;  3X1V D;  4H9Q A;  5CPJ A;  1KX4 D;  4J8U D;  1BFM A;  3X1S C;  4G92 B;  5GT0 B;  5AVB A;  4J8W B;  3UTB C;  5GSU A;  5B40 A;  1AOI B;  5F99 B;  2F8N H;  4G92 C;  3AN2 C;  4H9Q B;  5F99 C;  5CPJ B;  4LD9 A;  5AV5 A;  5B1L C;  4XUJ A;  4E44 A;  5AVB B;  3REJ C;  4KUD A;  5GSU B;  5B40 B;  3REI C;  1W2E A;  5B2J A;  5AVB C;  3REL C;  4X23 D;  1ID3 A;  5AV8 A;  4LD9 B;  3W97 A;  2ZY5 A;  4JJN C;  4WU9 A;  3LEL C;  4XUJ B;  4KUD B;  4R8P C;  3AZH A;  5B1M A;  5AVC C;  5B2J B;  4J8U A;  1KX4 A;  2W8S A;  2Y2O A;  4KGC A;  2UWX A;  1P3B D;  1ID3 B;  5AV8 B;  2ARO A;  5B32 C;  4WU9 B;  5CP6 D;  3KWQ C;  3W96 A;  2CV5 A;  1ID3 C;  5AV9 D;  3X1V B;  3NQJ B;  1P3P D;  3B0C T;  5B1M B;  2Y2P A;  4J8V C;  4J8U B;  1KX4 B;  3WA9 C;  2XD5 A;  5B31 D;  2BG1 A;  3W98 D;  3X1V C;  3O62 A;  3KUY D;  4KGC B;  5BT1 D;  1TZY A;  2ARO B;  2DF4 C;  2BYM A;  2CWE A;  2HIO C;  2CV5 B;  3AZI A;  5DNN C;  4XZQ D;  3B0D B;  3O62 B;  1TZY B;  2RVQ D;  1KX5 C;  3AZE A;  1R4V A;  4Z5T A;  3UTA A;  2DQN C;  3NQU A;  3LZ1 D;  5B0Z D;  5CP6 A;  4X23 C;  3AZN D;  1P3I A;  3LZ0 A;  3AZL D;  1P3P A;  3AZE B;  5GXQ D;  4DRB A;  3KUY A;  3AZM A;  1S32 D;  1P3B B;  4Z5T B;  3NQU B;  5B24 C;  4UUZ A;  3WKJ D;  1M18 A;  5CP6 B;  3AZG D;  1P3B C;  5B2I A;  1P3I B;  5AV9 B;  3LZ0 B;  1P3P B;  3VH6 T;  3REK A;  3W98 B;  5B31 B;  5AV9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...