2HUEB

Structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Anti-silencing protein 1
publication title Structural basis for the histone chaperone activity of asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hueB00
4WU8C 2CWEA 3A6ND 5BO0A 1P3PA 5B1LC 5AVBA 5F99B 4XUJC 4X23A 4J8WD 1M19C 3KUYA 1P3IC 1F66A 4QLCA 5B40A 3B0BA 1KX4B 5AVCC 2AROA 3MGPC 3MVDA 4NE6A 5JRGA 4J8VC 3V9RA 3X1UC 3MNNA 3REKD 1S32B 3REJB 5GT0B 3WTPD 3AV2C 5B0ZC 5GXQD 3X1VD 5CPJB 3X1SD 1M1AC 5BO0B 3B0CT 3UTBC 5AV8A 2CV5D 3KUYB 1F66B 1KX3B 4Z2MG 5B40B 3MGSC 5B2ID 5B24A 2AROB 1P3GC 4XZQA 4KGCA 3W96C 5B2JD 3LZ0B 1P3KC 3MGQA 4H9SA 1ZLAC 3MNNB 3VH6W 3AZND 3REHD 3AZJD 5CP6D 3AZHC 3C1CB 4Z5TC 5GT3D 1BH8A 5F99D 4R8PA 1AOIA 2NZDB 5BS7C 5AV8B 1EQZA 4EO5C 5KDMA 2FJ7A 1B67A 4XZQB 4KGCB 1P3OC 5CHLB 4JJNA 4J8UB 1S32D 1P3FB 3REJD 3KWQC 1TAFA 5GT0D 4G92B 1U35A 3AFAB 3AN2A 3WA9A 5CPJD 1TZYD 3WKJC 1A7WA 1AOIB 4R8PB 4NE5A 3KXBB 3AZLB 3VH5T 5AV9A 1KX3D 4ZUXA 1EQZB 1ID3A 5DNNA 3AZMC 2FJ7B 3B6GB 4KUDA 4LD9D 2AROD 5AV5A 1P3LB 3LZ0D 3MNND 5B31A 1TAFB 3W98A 3W99B 1P34C 1U35B 4UUZA 3WA9B 1M18A 3C1CD 5AV6C 3O62C 2YFVA 2L5AA 2NZDD 1H3OB 3A6NA 5AV9B 2IO5C 4ZUXB 4Z66B 5B31G 1ID3B 4KUDB 1HQ3C 4KGCD 4J8WA 4J8UD 1P3FD 5BNXA 5B31B 1P3MA 1BH9A 3AFAD 4UUZB 2F8NB 1AOID 4R8PD 3WTPA 2YFVB 3KXBD 3AZLD 5GXQA 2NQBC 3A6NB 3X1VA 4H9QA 3X1SA 1KX4C 1EQZD 3B6GD 4YM6B 1P3LD 2CV5A 4CAYA 3C1BC 4CSRA 1P3MB 3W99D 1KU5A 5B2IA 4YS3C 1P3PC 4G91B 5AVBC 3REHA 4X23C 3AZJA 5JA4B 2BYKA 3KUYC 4KHAA 5GXQB 1F66C 2PYOC 5AV9D 3REIC 3TU4B 4QLCC 5B40C 4Z66D 1ID3D 5GT3A 5F99A 3RELD 3MVDC 5JRGC 5B0YA 4E44A 3AV1A 2CV5B 4WZSB 3X1TC 4CSRB 5B32C 5B2IB 3LZ1B 2LY8A 1S32A 2F8ND 3REJA 3REHB 3AZJB 5AV8C 1ULYA 2BYKB 3VH6A 3AYWB 4KHAB 3MGRC 5CPJA 1TZYA 5B24C 5CPIC 4XZQC 5GT3B 3UTAD 4YM6D 3MGQC 4H9SC 5B0YB 3AV1B 1KX3A 5B1MB 4ZBJB 2BYMA 1P3MD 1F1EA 3AZKC 4LD9A 1BFMA 4AWLB 4E45A 3LZ0A 3UT9D 1P3AB 3TU4D 1TZYB 3B0DB 3C1CA 2FJ7C 3WAAB 4JJNC 2NZDA 5FUGA 3AZGD 3NQJA 2BYMB 4LD9B 1U35C 3AN2C 3LZ1D 3WA9C 5GSUC 3LELC 5E5AD 4J8UA 5DNMB 1P3FA 3LJAC 5CPKC 3AYWD 1KX5D 3W97D 3AFAA 4ZUXC 1JFIB 5B33C 5DNNC 4KUDC 1B6WA 2RVQD 5AV5C 3B6FB 3KXBA 5B0YD 3AZLA 3AV1D 5FUGB 5B31C 5B1MD 3W98C 3NQJB 2HUEC 3B6GA 3AZEA 4WU8A 2HIOB 5C3IB 1P3LA 1M18C 5B1LA 1P3AD 3W99A 4XUJA 3A6NC 4H9NA 4NFTA 4WU9B 4H9OA 4Z2MH 4J8WC 1P3BB 3WAAD 4J8VA 1H3OA 3AZFB 5AY8B 4Z66A 4J8XB 5B0ZA 3AZEB 3RELA 4HGAB 4WU8B 3REKC 5DNMD 5B1LB 3WTPC 4XUJB 5GXQC 3NQUB 1M19B 3X1VC 4H9NB 3X1SC 2F8NA 4H9RA 3B6FD 4H9OB 3MGPB 2CV5C 1ZLAA 4J8VB 1P3KA 5B2IC 3AV2B 5B0ZB 3RELB 2HIOD 5B2JC 4YM6A 3UTAA 1M1AB 3AZNC 3REHC 2F8NG 3AZJC 5CP6C 3UTBB 3AZID 4WU9D 3MGSB 5GT3C 5F99C 4H9RB 3UT9A 1P3BD 1P3GB 5JA4A 3W96B 1ZLAB 1P3KB 4ZBJC 5AY8D 3TU4A 3AZFD 5BT1D 4J8XD 3B0CW 3AZED 4AWLC 4WU8D 3UTAB 1S32C 3WKJA 3REJC 4Z5TB 5GT0C 5B1LD 3AZGA 4XUJD 3LZ1A 1M19D 5CPJC 1P3ID 1TZYC 5E5AA 3VH6T 5AVCD 3MGPD 3UT9B 3W97A 3AYWA 1P3OB 4J8VD 1KX5A 3X1UD 1KX3C 3KWQB 4LD9C 2JSSA 3AV2D 2AROC 5B0ZD 3LZ0C 3MNNC 1M1AD 3WKJB 5B1MA 3AZGB 1N1JB 3UTBD 3C1CC 5E5AB 3MGSD 3AZMB 1P3GD 1P3AA 2NZDC 3W96D 3W97B 1KX5B 1ZLAD 1P3KD 3VH5W 1P34B 4KGCC 3WAAA 3AZHD 4J8UC 1P3FC 4WV4B 5AV6B 4Z5TD 3O62B 4WNNB 4G92C 3AFAC 1HTAA 5DNMA 2IO5B 1AOIC 4R8PC 3KXBC 3AZLC 1P3OD 1JFIA 3KWQD 1EQZC 3B6GC 4HGAC 3B6FA 1P3LC 4YS3A 4NE3A 3WKJD 3W99C 2HIOA 2PYOA 2NQBB 3REIA 3WTPE 3AZMD 5BNVA 5AV9C 3X1TA 3AZIA 4Z66C 3C1BB 4H9PB 1R4VA 5B32A 4DRBA 4WU9A 1ID3C 1P34D 3RELC 1P3BA 4YS3B 5AV6D 1P3PB 3AZFA 5AY8A 5AVBB 3O62D 4J8XA 4X23B 2PYOB 3MGRA 3REIB 4QLCB 1WWIA 5B32G 5BNVB 4DRAA 1HQ3D 5CPIA 3MVDB 5JRGB 3V9RB 3NQUA 1M19A 3X1TB 1P3IA 3AZIB 5B32B 3AZKA 3UTAC 5AVCA 4YM6C 3MGPA 3X1UA 2F8NK 1P3MC 3AV2A 2NQBD 3MGRB 5G49A 1KX4D 4G91C 1M1AA 5B24B 3UT9C 5CPIB 3MGQB 3UTBA 3TU4C 1P3IB 3C1BD 3MGSA 3AZKB 5AVCB 1P3GA 2YFWA 5GSUA 4YS3D 3W96A 3LELA 3X1UB 1P3PD 3LJAA 5AVBD 1BH8B 3AZGC 4X23D 3R45A 3LZ1C 5CPKA 3KUYD 1F66D 2PYOD 5E5AC 3REID 4QLCD 5B40D 5G49B 5B33A 3AZHA 4Z5TA 5KDMB 3MVDD 3AYWC 1KX5C 3W97C 5JRGD 4JJNB 5BS7A 3X1TD 5B32D 2RVQC 3AN2B 5B0YC 2YFWB 5GSUB 3AV1C 1P3OA 3LELB 5B1MC 3KWQA 3LJAB 3R45B 1Q9CA 5AV8D 5CPKB 4M6BA 3MGRD 3AZHB 3VH5A 5DNNB 5B33B 5B24D 5AV5B 4XZQD 5CPID 1P3AC 1N1JA 3MGQD 3B0DC 3W98B 3AZKD 3AZMA 2HUEB 4EO5B 3WAAC 3REKA 1M18B 1P34A 2F8NH 5DNMC 5AV6A 2FJ7D 3O62A 4WNNA 4J8WB 4JJND 5BNXB 1U35D 3B6FC 1BH9B 3AN2D 1HQ3A 3WA9D 5GSUD 5B2JA 3REKB 3LELD 3LJAD 3AZNA 3WTPB 5CP6A 5CPKD 2HIOC 5C3IC 3X1VB 4ZUXD 4H9QB 3X1SB 5B33D 5DNND 4KUDD 5AV5D 1WWSA 2NQBA 3AZIC 4CAYB 5B31D 3W98D 4WU9C 1KX4A 3KSYA 1P3BC 1HQ3B 5B2JB 1M18D 3AZFC 5AY8C 5BT1C 5GT0A 4H9PA 3C1BA 4J8XC 3AZNB 3AZEC 5CP6B
chains in the Genus database with same CATH superfamily
4WU8C 2CWEA 3A6ND 2DQNC 5BO0A 1P3PA 3EPJA 5B1LC 2G5HC 5AVBA 5F99B 4XUJC 4X23A 4J8WD 1M19C 3KUYA 1P3IC 1F66A 4QLCA 5B40A 3B0BA 1KX4B 3IP4C 5AVCC 2AROA 3MGPC 3MVDA 4NE6A 5JRGA 4J8VC 3V9RA 3X1UC 3MNNA 3REKD 1S32B 3REJB 5GT0B 3WTPD 3AV2C 5B0ZC 5GXQD 2Y2KA 3X1VD 5CPJB 3X1SD 1M1AC 5BO0B 3B0CT 3UTBC 5AV8A 2CV5D 3KUYB 1F66B 1KX3B 4WJ3C 4Z2MG 5B40B 3MGSC 4UPKA 5B2ID 5B24A 2AROB 1P3GC 4XZQA 4KGCA 3W96C 5B2JD 3LZ0B 1P3KC 3MGQA 4H9SA 1ZLAC 3MNNB 3VH6W 3AZND 3REHD 3AZJD 2JE5A 5CP6D 3AZHC 3C1CB 4Z5TC 5GT3D 1BH8A 5F99D 4R8PA 1AOIA 3A1IA 5BS7C 2NZDB 5AV8B 1EQZA 4EO5C 5KDMA 2FJ7A 1B67A 4XZQB 4KGCB 1P3OC 5CHLB 4JJNA 4J8UB 1S32D 1P3FB 3REJD 3KWQC 1TAFA 5GT0D 4G92B 1U35A 3AFAB 3AN2A 3WA9A 3P5JB 5CPJD 1TZYD 3WKJC 3H0RC 1A7WA 1AOIB 2Y2IA 4R8PB 4NE5A 3EPHA 3KXBB 3AZLB 3VH5T 5AV9A 1KX3D 4ZUXA 1EQZB 1ID3A 5DNNA 3AZMC 2FJ7B 3B6GB 4KUDA 4LD9D 2AROD 5AV5A 1P3LB 3LZ0D 3MNND 5B31A 1TAFB 3W98A 3W99B 1P34C 3EPLA 1U35B 4UUZA 3WA9B 1M18A 3C1CD 5AV6C 3O62C 2YFVA 2L5AA 2NZDD 1H3OB 3A6NA 5AV9B 4ZUXB 2IO5C 4Z66B 1W2EA 5B31G 1ID3B 4KUDB 1HQ3C 2RIQA 4KGCD 4J8WA 4J8UD 1P3FD 5BNXA 5B31B 1P3MA 1BH9A 3AFAD 4UUZB 2F8NB 1AOID 4R8PD 3WTPA 2YFVB 3KXBD 3AZLD 2XD5A 5GXQA 2NQBC 3A6NB 3X1VA 4H9QA 3X1SA 1KX4C 1EQZD 3B6GD 2ZY4A 2Y2NA 4YM6B 1P3LD 2CV5A 4CAYA 3C1BC 4CSRA 1P3MB 3W99D 1KU5A 5B2IA 4YS3C 1P3PC 4G91B 5AVBC 2BG1A 3REHA 4X23C 3AZJA 5JA4B 2BYKA 3KUYC 4KHAA 5GXQB 1F66C 2PYOC 5AV9D 3REIC 3TU4B 4QLCC 5B40C 4Z66D 1ID3D 5GT3A 5F99A 3RELD 3MVDC 5JRGC 5B0YA 4E44A 3AV1A 2CV5B 4WZSB 3X1TC 4CSRB 5B32C 5B2IB 3LZ1B 2LY8A 2DF4C 1S32A 2F8ND 3REJA 3REHB 3AZJB 3H0LC 2Y2GA 5AV8C 1ULYA 2BYKB 3VH6A 3AYWB 4KHAB 3MGRC 5CPJA 1TZYA 5B24C 5CPIC 4XZQC 5GT3B 3UTAD 4YM6D 3MGQC 4H9SC 5B0YB 3AV1B 1KX3A 2JCHA 4ZBJB 2BYMA 5B1MB 1P3MD 1F1EA 3AZKC 4LD9A 1BFMA 4AWLB 4E45A 3LZ0A 3UT9D 1P3AB 3TU4D 1TZYB 3B0DB 3C1CA 2FJ7C 4DQYB 3WAAB 4JJNC 2NZDA 5FUGA 3AZGD 3NQJA 2BYMB 4LD9B 1U35C 3AN2C 3LZ1D 2W8SA 3WA9C 5GSUC 3LELC 5E5AD 4J8UA 5DNMB 1P3FA 3LJAC 2ZM5A 5CPKC 3AYWD 1KX5D 3W97D 3AFAA 4ZUXC 1JFIB 5B33C 5DNNC 4KUDC 1B6WA 2RVQD 5AV5C 3B6FB 3KXBA 5B0YD 3AZLA 3AV1D 5FUGB 5B31C 5B1MD 3W98C 3FDDA 3NQJB 2HUEC 3B6GA 3AZEA 4WU8A 2HIOB 2Y2LA 5C3IB 1P3LA 1M18C 1Z2CB 5B1LA 2Y2JA 1P3AD 3W99A 4XUJA 3A6NC 4H9NA 4NFTA 4WU9B 4H9OA 4Z2MH 4J8WC 1P3BB 3WAAD 4J8VA 1H3OA 3AZFB 5AY8B 4Z66A 4J8XB 5B0ZA 3AZEB 3RELA 4HGAB 4WU8B 3REKC 5DNMD 5B1LB 3WTPC 4XUJB 5GXQC 3NQUB 1M19B 3X1VC 4H9NB 3X1SC 2F8NA 4H9RA 3B6FD 4H9OB 3MGPB 2CV5C 2Y2PA 1ZLAA 4J8VB 1P3KA 5B2IC 3AV2B 5B0ZB 3RELB 2HIOD 5B2JC 4YM6A 3UTAA 1M1AB 3AZNC 3REHC 2F8NG 3AZJC 5CP6C 3UTBB 3AZID 4WU9D 3MGSB 5GT3C 5F99C 4H9RB 3UT9A 1P3BD 1P3GB 5JA4A 3W96B 1ZLAB 1P3KB 4ZBJC 5AY8D 3TU4A 3AZFD 5BT1D 4J8XD 3B0CW 3AZED 4AWLC 4WU8D 3UTAB 1PZRA 3EG5B 1S32C 3WKJA 3REJC 4Z5TB 5GT0C 5B1LD 3AZGA 2ZY3A 4XUJD 3LZ1A 1M19D 5CPJC 1P3ID 1TZYC 2XD1A 5E5AA 3VH6T 5AVCD 3MGPD 3UT9B 3W97A 3AYWA 1P3OB 4J8VD 1KX5A 3X1UD 1KX3C 3KWQB 4LD9C 2JSSA 3AV2D 2AROC 5B0ZD 3LZ0C 3MNNC 1M1AD 3WKJB 5B1MA 3AZGB 1N1JB 3UTBD 3C1CC 5E5AB 3MGSD 3AZMB 1P3GD 1P3AA 2NZDC 3W96D 3W97B 1KX5B 1ZLAD 1P3KD 3VH5W 2ZY2A 1P34B 4KGCC 3WAAA 3AZHD 4J8UC 1P3FC 4WV4B 5AV6B 4Z5TD 3O62B 4WNNB 2Y2QA 2ZY5A 4G92C 3AFAC 1HTAA 5DNMA 2IO5B 1AOIC 4R8PC 3KXBC 3AZLC 1P3OD 1JFIA 3KWQD 1EQZC 3B6GC 4HGAC 3B6FA 1P3LC 4YS3A 4NE3A 3WKJD 3W99C 3KFUG 2HIOA 2PYOA 2NQBB 3REIA 3WTPE 3AZMD 5BNVA 5AV9C 3X1TA 3AZIA 4Z66C 3C1BB 4H9PB 1R4VA 5B32A 4DRBA 4WU9A 1ID3C 1P34D 3RELC 1T3UA 1P3BA 4YS3B 5AV6D 1P3PB 3AZFA 5AY8A 5AVBB 2VQRA 3O62D 4J8XA 4X23B 2PYOB 3MGRA 3REIB 4QLCB 1WWIA 5B32G 5BNVB 2Y2MA 1HQ3D 4DRAA 5CPIA 3MVDB 5JRGB 3H0MC 3NQUA 3V9RB 1M19A 3EPKA 3X1TB 1P3IA 3AZIB 5B32B 2Y2OA 3AZKA 3UTAC 5AVCA 4YM6C 3MGPA 3X1UA 2F8NK 1P3MC 3AV2A 2NQBD 3MGRB 5G49A 1KX4D 4G91C 2G5IC 1M1AA 2UWXA 5B24B 3UT9C 5CPIB 3MGQB 3UTBA 3TU4C 1P3IB 3C1BD 3MGSA 3AZKB 5AVCB 1P3GA 5GSUA 2Y2HA 2YFWA 3W96A 4YS3D 3LELA 3X1UB 1P3PD 3LJAA 5AVBD 1BH8B 3AZGC 4X23D 3R45A 3LZ1C 5CPKA 3KUYD 1F66D 2PYOD 5E5AC 3REID 4QLCD 5B40D 5G49B 5B33A 3AZHA 4Z5TA 5KDMB 3MVDD 3AYWC 1KX5C 3W97C 5JRGD 4JJNB 5BS7A 3X1TD 5B32D 2J8PA 2RVQC 3AN2B 5B0YC 2YFWB 5GSUB 3AV1C 1P3OA 3LELB 5B1MC 3KWQA 3LJAB 1Q9CA 3R45B 5AV8D 5CPKB 4M6BA 3MGRD 3AZHB 3VH5A 5DNNB 5B33B 5B24D 5AV5B 4XZQD 5CPID 1P3AC 1N1JA 3MGQD 3B0DC 3W98B 3AZKD 3AZMA 2HUEB 4EO5B 3WAAC 3REKA 1M18B 2F2AC 1P34A 2F8NH 5DNMC 5AV6A 2FJ7D 3O62A 4WNNA 4J8WB 4JJND 5BNXB 1U35D 3B6FC 1BH9B 2FFFB 3AN2D 1HQ3A 3WA9D 5GSUD 5B2JA 3REKB 3LELD 3LJAD 3AZNA 3WTPB 5CP6A 5CPKD 2HIOC 5C3IC 3X1VB 4ZUXD 4H9QB 3X1SB 3AL0C 3F6TA 5DNND 5B33D 4KUDD 3A1KA 5AV5D 1WWSA 2NQBA 3AZIC 4CAYB 5B31D 3W98D 4WU9C 1KX4A 3KSYA 1P3BC 1HQ3B 5B2JB 1M18D 3AZFC 5AY8C 5BT1C 5GT0A 4H9PA 3C1BA 4J8XC 3AZNB 3AZEC 5CP6B
chains in the Genus database with same CATH topology
4WU8C 2CWEA 3A6ND 2DQNC 5BO0A 1P3PA 3EPJA 5B1LC 2G5HC 5AVBA 5F99B 4XUJC 4X23A 4J8WD 1M19C 3KUYA 1P3IC 1F66A 4QLCA 5B40A 3B0BA 1KX4B 3IP4C 5AVCC 2AROA 3MGPC 3MVDA 4NE6A 5JRGA 4J8VC 3V9RA 3X1UC 3MNNA 3REKD 1S32B 3REJB 5GT0B 3WTPD 3AV2C 5B0ZC 5GXQD 2Y2KA 3X1VD 5CPJB 3X1SD 1M1AC 5BO0B 3B0CT 3UTBC 5AV8A 2CV5D 3KUYB 1F66B 1KX3B 4WJ3C 4Z2MG 5B40B 3MGSC 4UPKA 5B2ID 5B24A 2AROB 1P3GC 4XZQA 4KGCA 3W96C 5B2JD 3LZ0B 1P3KC 3MGQA 4H9SA 1ZLAC 3MNNB 3VH6W 3AZND 3REHD 3AZJD 2JE5A 5CP6D 3AZHC 3C1CB 4Z5TC 5GT3D 1BH8A 5F99D 4R8PA 1AOIA 3A1IA 5BS7C 2NZDB 5AV8B 1EQZA 4EO5C 5KDMA 2FJ7A 1B67A 4XZQB 4KGCB 1P3OC 5CHLB 4JJNA 4J8UB 1S32D 1P3FB 3REJD 3KWQC 1TAFA 5GT0D 4G92B 1U35A 3AFAB 3AN2A 3WA9A 3P5JB 5CPJD 1TZYD 3WKJC 3H0RC 1A7WA 1AOIB 2Y2IA 4R8PB 4NE5A 3EPHA 3KXBB 3AZLB 3VH5T 5AV9A 1KX3D 4ZUXA 1EQZB 1ID3A 5DNNA 3AZMC 2FJ7B 3B6GB 4KUDA 4LD9D 2AROD 5AV5A 1P3LB 3LZ0D 3MNND 5B31A 1TAFB 3W98A 3W99B 1P34C 3EPLA 1U35B 4UUZA 3WA9B 1M18A 3C1CD 5AV6C 3O62C 2YFVA 2L5AA 2NZDD 1H3OB 3A6NA 5AV9B 4ZUXB 2IO5C 4Z66B 1W2EA 5B31G 1ID3B 4KUDB 1HQ3C 2RIQA 4KGCD 4J8WA 4J8UD 1P3FD 5BNXA 5B31B 1P3MA 1BH9A 3AFAD 4UUZB 2F8NB 1AOID 4R8PD 3WTPA 2YFVB 3KXBD 3AZLD 2XD5A 5GXQA 2NQBC 3A6NB 3X1VA 4H9QA 3X1SA 1KX4C 1EQZD 3B6GD 2ZY4A 2Y2NA 4YM6B 1P3LD 2CV5A 4CAYA 3C1BC 4CSRA 1P3MB 3W99D 1KU5A 5B2IA 4YS3C 1P3PC 4G91B 5AVBC 2BG1A 3REHA 4X23C 3AZJA 5JA4B 2BYKA 3KUYC 4KHAA 5GXQB 1F66C 2PYOC 5AV9D 3REIC 3TU4B 4QLCC 5B40C 4Z66D 1ID3D 5GT3A 5F99A 3RELD 3MVDC 5JRGC 5B0YA 4E44A 3AV1A 2CV5B 4WZSB 3X1TC 4CSRB 5B32C 5B2IB 3LZ1B 2LY8A 2DF4C 1S32A 2F8ND 3REJA 3REHB 3AZJB 3H0LC 2Y2GA 5AV8C 1ULYA 2BYKB 3VH6A 3AYWB 4KHAB 3MGRC 5CPJA 1TZYA 5B24C 5CPIC 4XZQC 5GT3B 3UTAD 4YM6D 3MGQC 4H9SC 5B0YB 3AV1B 1KX3A 2JCHA 4ZBJB 2BYMA 5B1MB 1P3MD 1F1EA 3AZKC 4LD9A 1BFMA 4AWLB 4E45A 3LZ0A 3UT9D 1P3AB 3TU4D 1TZYB 3B0DB 3C1CA 2FJ7C 4DQYB 3WAAB 4JJNC 2NZDA 5FUGA 3AZGD 3NQJA 2BYMB 4LD9B 1U35C 3AN2C 3LZ1D 2W8SA 3WA9C 5GSUC 3LELC 5E5AD 4J8UA 5DNMB 1P3FA 3LJAC 2ZM5A 5CPKC 3AYWD 1KX5D 3W97D 3AFAA 4ZUXC 1JFIB 5B33C 5DNNC 4KUDC 1B6WA 2RVQD 5AV5C 3B6FB 3KXBA 5B0YD 3AZLA 3AV1D 5FUGB 5B31C 5B1MD 3W98C 3FDDA 3NQJB 2HUEC 3B6GA 3AZEA 4WU8A 2HIOB 2Y2LA 5C3IB 1P3LA 1M18C 1Z2CB 5B1LA 2Y2JA 1P3AD 3W99A 4XUJA 3A6NC 4H9NA 4NFTA 4WU9B 4H9OA 4Z2MH 4J8WC 1P3BB 3WAAD 4J8VA 1H3OA 3AZFB 5AY8B 4Z66A 4J8XB 5B0ZA 3AZEB 3RELA 4HGAB 4WU8B 3REKC 5DNMD 5B1LB 3WTPC 4XUJB 5GXQC 3NQUB 1M19B 3X1VC 4H9NB 3X1SC 2F8NA 4H9RA 3B6FD 4H9OB 3MGPB 2CV5C 2Y2PA 1ZLAA 4J8VB 1P3KA 5B2IC 3AV2B 5B0ZB 3RELB 2HIOD 5B2JC 4YM6A 3UTAA 1M1AB 3AZNC 3REHC 2F8NG 3AZJC 5CP6C 3UTBB 3AZID 4WU9D 3MGSB 5GT3C 5F99C 4H9RB 3UT9A 1P3BD 1P3GB 5JA4A 3W96B 1ZLAB 1P3KB 4ZBJC 5AY8D 3TU4A 3AZFD 5BT1D 4J8XD 3B0CW 3AZED 4AWLC 4WU8D 3UTAB 1PZRA 3EG5B 1S32C 3WKJA 3REJC 4Z5TB 5GT0C 5B1LD 3AZGA 2ZY3A 4XUJD 3LZ1A 1M19D 5CPJC 1P3ID 1TZYC 2XD1A 5E5AA 3VH6T 5AVCD 3MGPD 3UT9B 3W97A 3AYWA 1P3OB 4J8VD 1KX5A 3X1UD 1KX3C 3KWQB 4LD9C 2JSSA 3AV2D 2AROC 5B0ZD 3LZ0C 3MNNC 1M1AD 3WKJB 5B1MA 3AZGB 1N1JB 3UTBD 3C1CC 5E5AB 3MGSD 3AZMB 1P3GD 1P3AA 2NZDC 3W96D 3W97B 1KX5B 1ZLAD 1P3KD 3VH5W 2ZY2A 1P34B 4KGCC 3WAAA 3AZHD 4J8UC 1P3FC 4WV4B 5AV6B 4Z5TD 3O62B 4WNNB 2Y2QA 2ZY5A 4G92C 3AFAC 1HTAA 5DNMA 2IO5B 1AOIC 4R8PC 3KXBC 3AZLC 1P3OD 1JFIA 3KWQD 1EQZC 3B6GC 4HGAC 3B6FA 1P3LC 4YS3A 4NE3A 3WKJD 3W99C 3KFUG 2HIOA 2PYOA 2NQBB 3REIA 3WTPE 3AZMD 5BNVA 5AV9C 3X1TA 3AZIA 4Z66C 3C1BB 4H9PB 1R4VA 5B32A 4DRBA 4WU9A 1ID3C 1P34D 3RELC 1T3UA 1P3BA 4YS3B 5AV6D 1P3PB 3AZFA 5AY8A 5AVBB 2VQRA 3O62D 4J8XA 4X23B 2PYOB 3MGRA 3REIB 4QLCB 1WWIA 5B32G 5BNVB 2Y2MA 1HQ3D 4DRAA 5CPIA 3MVDB 5JRGB 3H0MC 3NQUA 3V9RB 1M19A 3EPKA 3X1TB 1P3IA 3AZIB 5B32B 2Y2OA 3AZKA 3UTAC 5AVCA 4YM6C 3MGPA 3X1UA 2F8NK 1P3MC 3AV2A 2NQBD 3MGRB 5G49A 1KX4D 4G91C 2G5IC 1M1AA 2UWXA 5B24B 3UT9C 5CPIB 3MGQB 3UTBA 3TU4C 1P3IB 3C1BD 3MGSA 3AZKB 5AVCB 1P3GA 5GSUA 2Y2HA 2YFWA 3W96A 4YS3D 3LELA 3X1UB 1P3PD 3LJAA 5AVBD 1BH8B 3AZGC 4X23D 3R45A 3LZ1C 5CPKA 3KUYD 1F66D 2PYOD 5E5AC 3REID 4QLCD 5B40D 5G49B 5B33A 3AZHA 4Z5TA 5KDMB 3MVDD 3AYWC 1KX5C 3W97C 5JRGD 4JJNB 5BS7A 3X1TD 5B32D 2J8PA 2RVQC 3AN2B 5B0YC 2YFWB 5GSUB 3AV1C 1P3OA 3LELB 5B1MC 3KWQA 3LJAB 1Q9CA 3R45B 5AV8D 5CPKB 4M6BA 3MGRD 3AZHB 3VH5A 5DNNB 5B33B 5B24D 5AV5B 4XZQD 5CPID 1P3AC 1N1JA 3MGQD 3B0DC 3W98B 3AZKD 3AZMA 2HUEB 4EO5B 3WAAC 3REKA 1M18B 2F2AC 1P34A 2F8NH 5DNMC 5AV6A 2FJ7D 3O62A 4WNNA 4J8WB 4JJND 5BNXB 1U35D 3B6FC 1BH9B 2FFFB 3AN2D 1HQ3A 3WA9D 5GSUD 5B2JA 3REKB 3LELD 3LJAD 3AZNA 3WTPB 5CP6A 5CPKD 2HIOC 5C3IC 3X1VB 4ZUXD 4H9QB 3X1SB 3AL0C 3F6TA 5DNND 5B33D 4KUDD 3A1KA 5AV5D 1WWSA 2NQBA 3AZIC 4CAYB 5B31D 3W98D 4WU9C 1KX4A 3KSYA 1P3BC 1HQ3B 5B2JB 1M18D 3AZFC 5AY8C 5BT1C 5GT0A 4H9PA 3C1BA 4J8XC 3AZNB 3AZEC 5CP6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 C;  2CWE A;  3A6N D;  5BO0 A;  1P3P A;  5B1L C;  5AVB A;  5F99 B;  4XUJ C;  4X23 A;  4J8W D;  1M19 C;  3KUY A;  1P3I C;  1F66 A;  4QLC A;  5B40 A;  3B0B A;  1KX4 B;  5AVC C;  2ARO A;  3MGP C;  3MVD A;  4NE6 A;  5JRG A;  4J8V C;  3V9R A;  3X1U C;  3MNN A;  3REK D;  1S32 B;  3REJ B;  5GT0 B;  3WTP D;  3AV2 C;  5B0Z C;  5GXQ D;  3X1V D;  5CPJ B;  3X1S D;  1M1A C;  5BO0 B;  3B0C T;  3UTB C;  5AV8 A;  2CV5 D;  3KUY B;  1F66 B;  1KX3 B;  4Z2M G;  5B40 B;  3MGS C;  5B2I D;  5B24 A;  2ARO B;  1P3G C;  4XZQ A;  4KGC A;  3W96 C;  5B2J D;  3LZ0 B;  1P3K C;  3MGQ A;  4H9S A;  1ZLA C;  3MNN B;  3VH6 W;  3AZN D;  3REH D;  3AZJ D;  5CP6 D;  3AZH C;  3C1C B;  4Z5T C;  5GT3 D;  1BH8 A;  5F99 D;  4R8P A;  1AOI A;  2NZD B;  5BS7 C;  5AV8 B;  1EQZ A;  4EO5 C;  5KDM A;  2FJ7 A;  1B67 A;  4XZQ B;  4KGC B;  1P3O C;  5CHL B;  4JJN A;  4J8U B;  1S32 D;  1P3F B;  3REJ D;  3KWQ C;  1TAF A;  5GT0 D;  4G92 B;  1U35 A;  3AFA B;  3AN2 A;  3WA9 A;  5CPJ D;  1TZY D;  3WKJ C;  1A7W A;  1AOI B;  4R8P B;  4NE5 A;  3KXB B;  3AZL B;  3VH5 T;  5AV9 A;  1KX3 D;  4ZUX A;  1EQZ B;  1ID3 A;  5DNN A;  3AZM C;  2FJ7 B;  3B6G B;  4KUD A;  4LD9 D;  2ARO D;  5AV5 A;  1P3L B;  3LZ0 D;  3MNN D;  5B31 A;  1TAF B;  3W98 A;  3W99 B;  1P34 C;  1U35 B;  4UUZ A;  3WA9 B;  1M18 A;  3C1C D;  5AV6 C;  3O62 C;  2YFV A;  2L5A A;  2NZD D;  1H3O B;  3A6N A;  5AV9 B;  2IO5 C;  4ZUX B;  4Z66 B;  5B31 G;  1ID3 B;  4KUD B;  1HQ3 C;  4KGC D;  4J8W A;  4J8U D;  1P3F D;  5BNX A;  5B31 B;  1P3M A;  1BH9 A;  3AFA D;  4UUZ B;  2F8N B;  1AOI D;  4R8P D;  3WTP A;  2YFV B;  3KXB D;  3AZL D;  5GXQ A;  2NQB C;  3A6N B;  3X1V A;  4H9Q A;  3X1S A;  1KX4 C;  1EQZ D;  3B6G D;  4YM6 B;  1P3L D;  2CV5 A;  4CAY A;  3C1B C;  4CSR A;  1P3M B;  3W99 D;  1KU5 A;  5B2I A;  4YS3 C;  1P3P C;  4G91 B;  5AVB C;  3REH A;  4X23 C;  3AZJ A;  5JA4 B;  2BYK A;  3KUY C;  4KHA A;  5GXQ B;  1F66 C;  2PYO C;  5AV9 D;  3REI C;  3TU4 B;  4QLC C;  5B40 C;  4Z66 D;  1ID3 D;  5GT3 A;  5F99 A;  3REL D;  3MVD C;  5JRG C;  5B0Y A;  4E44 A;  3AV1 A;  2CV5 B;  4WZS B;  3X1T C;  4CSR B;  5B32 C;  5B2I B;  3LZ1 B;  2LY8 A;  1S32 A;  2F8N D;  3REJ A;  3REH B;  3AZJ B;  5AV8 C;  1ULY A;  2BYK B;  3VH6 A;  3AYW B;  4KHA B;  3MGR C;  5CPJ A;  1TZY A;  5B24 C;  5CPI C;  4XZQ C;  5GT3 B;  3UTA D;  4YM6 D;  3MGQ C;  4H9S C;  5B0Y B;  3AV1 B;  1KX3 A;  5B1M B;  4ZBJ B;  2BYM A;  1P3M D;  1F1E A;  3AZK C;  4LD9 A;  1BFM A;  4AWL B;  4E45 A;  3LZ0 A;  3UT9 D;  1P3A B;  3TU4 D;  1TZY B;  3B0D B;  3C1C A;  2FJ7 C;  3WAA B;  4JJN C;  2NZD A;  5FUG A;  3AZG D;  3NQJ A;  2BYM B;  4LD9 B;  1U35 C;  3AN2 C;  3LZ1 D;  3WA9 C;  5GSU C;  3LEL C;  5E5A D;  4J8U A;  5DNM B;  1P3F A;  3LJA C;  5CPK C;  3AYW D;  1KX5 D;  3W97 D;  3AFA A;  4ZUX C;  1JFI B;  5B33 C;  5DNN C;  4KUD C;  1B6W A;  2RVQ D;  5AV5 C;  3B6F B;  3KXB A;  5B0Y D;  3AZL A;  3AV1 D;  5FUG B;  5B31 C;  5B1M D;  3W98 C;  3NQJ B;  2HUE C;  3B6G A;  3AZE A;  4WU8 A;  2HIO B;  5C3I B;  1P3L A;  1M18 C;  5B1L A;  1P3A D;  3W99 A;  4XUJ A;  3A6N C;  4H9N A;  4NFT A;  4WU9 B;  4H9O A;  4Z2M H;  4J8W C;  1P3B B;  3WAA D;  4J8V A;  1H3O A;  3AZF B;  5AY8 B;  4Z66 A;  4J8X B;  5B0Z A;  3AZE B;  3REL A;  4HGA B;  4WU8 B;  3REK C;  5DNM D;  5B1L B;  3WTP C;  4XUJ B;  5GXQ C;  3NQU B;  1M19 B;  3X1V C;  4H9N B;  3X1S C;  2F8N A;  4H9R A;  3B6F D;  4H9O B;  3MGP B;  2CV5 C;  1ZLA A;  4J8V B;  1P3K A;  5B2I C;  3AV2 B;  5B0Z B;  3REL B;  2HIO D;  5B2J C;  4YM6 A;  3UTA A;  1M1A B;  3AZN C;  3REH C;  2F8N G;  3AZJ C;  5CP6 C;  3UTB B;  3AZI D;  4WU9 D;  3MGS B;  5GT3 C;  5F99 C;  4H9R B;  3UT9 A;  1P3B D;  1P3G B;  5JA4 A;  3W96 B;  1ZLA B;  1P3K B;  4ZBJ C;  5AY8 D;  3TU4 A;  3AZF D;  5BT1 D;  4J8X D;  3B0C W;  3AZE D;  4AWL C;  4WU8 D;  3UTA B;  1S32 C;  3WKJ A;  3REJ C;  4Z5T B;  5GT0 C;  5B1L D;  3AZG A;  4XUJ D;  3LZ1 A;  1M19 D;  5CPJ C;  1P3I D;  1TZY C;  5E5A A;  3VH6 T;  5AVC D;  3MGP D;  3UT9 B;  3W97 A;  3AYW A;  1P3O B;  4J8V D;  1KX5 A;  3X1U D;  1KX3 C;  3KWQ B;  4LD9 C;  2JSS A;  3AV2 D;  2ARO C;  5B0Z D;  3LZ0 C;  3MNN C;  1M1A D;  3WKJ B;  5B1M A;  3AZG B;  1N1J B;  3UTB D;  3C1C C;  5E5A B;  3MGS D;  3AZM B;  1P3G D;  1P3A A;  2NZD C;  3W96 D;  3W97 B;  1KX5 B;  1ZLA D;  1P3K D;  3VH5 W;  1P34 B;  4KGC C;  3WAA A;  3AZH D;  4J8U C;  1P3F C;  4WV4 B;  5AV6 B;  4Z5T D;  3O62 B;  4WNN B;  4G92 C;  3AFA C;  1HTA A;  5DNM A;  2IO5 B;  1AOI C;  4R8P C;  3KXB C;  3AZL C;  1P3O D;  1JFI A;  3KWQ D;  1EQZ C;  3B6G C;  4HGA C;  3B6F A;  1P3L C;  4YS3 A;  4NE3 A;  3WKJ D;  3W99 C;  2HIO A;  2PYO A;  2NQB B;  3REI A;  3WTP E;  3AZM D;  5BNV A;  5AV9 C;  3X1T A;  3AZI A;  4Z66 C;  3C1B B;  4H9P B;  1R4V A;  5B32 A;  4DRB A;  4WU9 A;  1ID3 C;  1P34 D;  3REL C;  1P3B A;  4YS3 B;  5AV6 D;  1P3P B;  3AZF A;  5AY8 A;  5AVB B;  3O62 D;  4J8X A;  4X23 B;  2PYO B;  3MGR A;  3REI B;  4QLC B;  1WWI A;  5B32 G;  5BNV B;  4DRA A;  1HQ3 D;  5CPI A;  3MVD B;  5JRG B;  3V9R B;  3NQU A;  1M19 A;  3X1T B;  1P3I A;  3AZI B;  5B32 B;  3AZK A;  3UTA C;  5AVC A;  4YM6 C;  3MGP A;  3X1U A;  2F8N K;  1P3M C;  3AV2 A;  2NQB D;  3MGR B;  5G49 A;  1KX4 D;  4G91 C;  1M1A A;  5B24 B;  3UT9 C;  5CPI B;  3MGQ B;  3UTB A;  3TU4 C;  1P3I B;  3C1B D;  3MGS A;  3AZK B;  5AVC B;  1P3G A;  2YFW A;  5GSU A;  4YS3 D;  3W96 A;  3LEL A;  3X1U B;  1P3P D;  3LJA A;  5AVB D;  1BH8 B;  3AZG C;  4X23 D;  3R45 A;  3LZ1 C;  5CPK A;  3KUY D;  1F66 D;  2PYO D;  5E5A C;  3REI D;  4QLC D;  5B40 D;  5G49 B;  5B33 A;  3AZH A;  4Z5T A;  5KDM B;  3MVD D;  3AYW C;  1KX5 C;  3W97 C;  5JRG D;  4JJN B;  5BS7 A;  3X1T D;  5B32 D;  2RVQ C;  3AN2 B;  5B0Y C;  2YFW B;  5GSU B;  3AV1 C;  1P3O A;  3LEL B;  5B1M C;  3KWQ A;  3LJA B;  3R45 B;  1Q9C A;  5AV8 D;  5CPK B;  4M6B A;  3MGR D;  3AZH B;  3VH5 A;  5DNN B;  5B33 B;  5B24 D;  5AV5 B;  4XZQ D;  5CPI D;  1P3A C;  1N1J A;  3MGQ D;  3B0D C;  3W98 B;  3AZK D;  3AZM A;  2HUE B;  4EO5 B;  3WAA C;  3REK A;  1M18 B;  1P34 A;  2F8N H;  5DNM C;  5AV6 A;  2FJ7 D;  3O62 A;  4WNN A;  4J8W B;  4JJN D;  5BNX B;  1U35 D;  3B6F C;  1BH9 B;  3AN2 D;  1HQ3 A;  3WA9 D;  5GSU D;  5B2J A;  3REK B;  3LEL D;  3LJA D;  3AZN A;  3WTP B;  5CP6 A;  5CPK D;  2HIO C;  5C3I C;  3X1V B;  4ZUX D;  4H9Q B;  3X1S B;  5B33 D;  5DNN D;  4KUD D;  5AV5 D;  1WWS A;  2NQB A;  3AZI C;  4CAY B;  5B31 D;  3W98 D;  4WU9 C;  1KX4 A;  3KSY A;  1P3B C;  1HQ3 B;  5B2J B;  1M18 D;  3AZF C;  5AY8 C;  5BT1 C;  5GT0 A;  4H9P A;  3C1B A;  4J8X C;  3AZN B;  3AZE C;  5CP6 B; 
#chains in the Genus database with same CATH topology
 4WU8 C;  2CWE A;  3A6N D;  2DQN C;  5BO0 A;  1P3P A;  3EPJ A;  5B1L C;  2G5H C;  5AVB A;  5F99 B;  4XUJ C;  4X23 A;  4J8W D;  1M19 C;  3KUY A;  1P3I C;  1F66 A;  4QLC A;  5B40 A;  3B0B A;  1KX4 B;  3IP4 C;  5AVC C;  2ARO A;  3MGP C;  3MVD A;  4NE6 A;  5JRG A;  4J8V C;  3V9R A;  3X1U C;  3MNN A;  3REK D;  1S32 B;  3REJ B;  5GT0 B;  3WTP D;  3AV2 C;  5B0Z C;  5GXQ D;  2Y2K A;  3X1V D;  5CPJ B;  3X1S D;  1M1A C;  5BO0 B;  3B0C T;  3UTB C;  5AV8 A;  2CV5 D;  3KUY B;  1F66 B;  1KX3 B;  4WJ3 C;  4Z2M G;  5B40 B;  3MGS C;  4UPK A;  5B2I D;  5B24 A;  2ARO B;  1P3G C;  4XZQ A;  4KGC A;  3W96 C;  5B2J D;  3LZ0 B;  1P3K C;  3MGQ A;  4H9S A;  1ZLA C;  3MNN B;  3VH6 W;  3AZN D;  3REH D;  3AZJ D;  2JE5 A;  5CP6 D;  3AZH C;  3C1C B;  4Z5T C;  5GT3 D;  1BH8 A;  5F99 D;  4R8P A;  1AOI A;  3A1I A;  5BS7 C;  2NZD B;  5AV8 B;  1EQZ A;  4EO5 C;  5KDM A;  2FJ7 A;  1B67 A;  4XZQ B;  4KGC B;  1P3O C;  5CHL B;  4JJN A;  4J8U B;  1S32 D;  1P3F B;  3REJ D;  3KWQ C;  1TAF A;  5GT0 D;  4G92 B;  1U35 A;  3AFA B;  3AN2 A;  3WA9 A;  3P5J B;  5CPJ D;  1TZY D;  3WKJ C;  3H0R C;  1A7W A;  1AOI B;  2Y2I A;  4R8P B;  4NE5 A;  3EPH A;  3KXB B;  3AZL B;  3VH5 T;  5AV9 A;  1KX3 D;  4ZUX A;  1EQZ B;  1ID3 A;  5DNN A;  3AZM C;  2FJ7 B;  3B6G B;  4KUD A;  4LD9 D;  2ARO D;  5AV5 A;  1P3L B;  3LZ0 D;  3MNN D;  5B31 A;  1TAF B;  3W98 A;  3W99 B;  1P34 C;  3EPL A;  1U35 B;  4UUZ A;  3WA9 B;  1M18 A;  3C1C D;  5AV6 C;  3O62 C;  2YFV A;  2L5A A;  2NZD D;  1H3O B;  3A6N A;  5AV9 B;  4ZUX B;  2IO5 C;  4Z66 B;  1W2E A;  5B31 G;  1ID3 B;  4KUD B;  1HQ3 C;  2RIQ A;  4KGC D;  4J8W A;  4J8U D;  1P3F D;  5BNX A;  5B31 B;  1P3M A;  1BH9 A;  3AFA D;  4UUZ B;  2F8N B;  1AOI D;  4R8P D;  3WTP A;  2YFV B;  3KXB D;  3AZL D;  2XD5 A;  5GXQ A;  2NQB C;  3A6N B;  3X1V A;  4H9Q A;  3X1S A;  1KX4 C;  1EQZ D;  3B6G D;  2ZY4 A;  2Y2N A;  4YM6 B;  1P3L D;  2CV5 A;  4CAY A;  3C1B C;  4CSR A;  1P3M B;  3W99 D;  1KU5 A;  5B2I A;  4YS3 C;  1P3P C;  4G91 B;  5AVB C;  2BG1 A;  3REH A;  4X23 C;  3AZJ A;  5JA4 B;  2BYK A;  3KUY C;  4KHA A;  5GXQ B;  1F66 C;  2PYO C;  5AV9 D;  3REI C;  3TU4 B;  4QLC C;  5B40 C;  4Z66 D;  1ID3 D;  5GT3 A;  5F99 A;  3REL D;  3MVD C;  5JRG C;  5B0Y A;  4E44 A;  3AV1 A;  2CV5 B;  4WZS B;  3X1T C;  4CSR B;  5B32 C;  5B2I B;  3LZ1 B;  2LY8 A;  2DF4 C;  1S32 A;  2F8N D;  3REJ A;  3REH B;  3AZJ B;  3H0L C;  2Y2G A;  5AV8 C;  1ULY A;  2BYK B;  3VH6 A;  3AYW B;  4KHA B;  3MGR C;  5CPJ A;  1TZY A;  5B24 C;  5CPI C;  4XZQ C;  5GT3 B;  3UTA D;  4YM6 D;  3MGQ C;  4H9S C;  5B0Y B;  3AV1 B;  1KX3 A;  2JCH A;  4ZBJ B;  2BYM A;  5B1M B;  1P3M D;  1F1E A;  3AZK C;  4LD9 A;  1BFM A;  4AWL B;  4E45 A;  3LZ0 A;  3UT9 D;  1P3A B;  3TU4 D;  1TZY B;  3B0D B;  3C1C A;  2FJ7 C;  4DQY B;  3WAA B;  4JJN C;  2NZD A;  5FUG A;  3AZG D;  3NQJ A;  2BYM B;  4LD9 B;  1U35 C;  3AN2 C;  3LZ1 D;  2W8S A;  3WA9 C;  5GSU C;  3LEL C;  5E5A D;  4J8U A;  5DNM B;  1P3F A;  3LJA C;  2ZM5 A;  5CPK C;  3AYW D;  1KX5 D;  3W97 D;  3AFA A;  4ZUX C;  1JFI B;  5B33 C;  5DNN C;  4KUD C;  1B6W A;  2RVQ D;  5AV5 C;  3B6F B;  3KXB A;  5B0Y D;  3AZL A;  3AV1 D;  5FUG B;  5B31 C;  5B1M D;  3W98 C;  3FDD A;  3NQJ B;  2HUE C;  3B6G A;  3AZE A;  4WU8 A;  2HIO B;  2Y2L A;  5C3I B;  1P3L A;  1M18 C;  1Z2C B;  5B1L A;  2Y2J A;  1P3A D;  3W99 A;  4XUJ A;  3A6N C;  4H9N A;  4NFT A;  4WU9 B;  4H9O A;  4Z2M H;  4J8W C;  1P3B B;  3WAA D;  4J8V A;  1H3O A;  3AZF B;  5AY8 B;  4Z66 A;  4J8X B;  5B0Z A;  3AZE B;  3REL A;  4HGA B;  4WU8 B;  3REK C;  5DNM D;  5B1L B;  3WTP C;  4XUJ B;  5GXQ C;  3NQU B;  1M19 B;  3X1V C;  4H9N B;  3X1S C;  2F8N A;  4H9R A;  3B6F D;  4H9O B;  3MGP B;  2CV5 C;  2Y2P A;  1ZLA A;  4J8V B;  1P3K A;  5B2I C;  3AV2 B;  5B0Z B;  3REL B;  2HIO D;  5B2J C;  4YM6 A;  3UTA A;  1M1A B;  3AZN C;  3REH C;  2F8N G;  3AZJ C;  5CP6 C;  3UTB B;  3AZI D;  4WU9 D;  3MGS B;  5GT3 C;  5F99 C;  4H9R B;  3UT9 A;  1P3B D;  1P3G B;  5JA4 A;  3W96 B;  1ZLA B;  1P3K B;  4ZBJ C;  5AY8 D;  3TU4 A;  3AZF D;  5BT1 D;  4J8X D;  3B0C W;  3AZE D;  4AWL C;  4WU8 D;  3UTA B;  1PZR A;  3EG5 B;  1S32 C;  3WKJ A;  3REJ C;  4Z5T B;  5GT0 C;  5B1L D;  3AZG A;  2ZY3 A;  4XUJ D;  3LZ1 A;  1M19 D;  5CPJ C;  1P3I D;  1TZY C;  2XD1 A;  5E5A A;  3VH6 T;  5AVC D;  3MGP D;  3UT9 B;  3W97 A;  3AYW A;  1P3O B;  4J8V D;  1KX5 A;  3X1U D;  1KX3 C;  3KWQ B;  4LD9 C;  2JSS A;  3AV2 D;  2ARO C;  5B0Z D;  3LZ0 C;  3MNN C;  1M1A D;  3WKJ B;  5B1M A;  3AZG B;  1N1J B;  3UTB D;  3C1C C;  5E5A B;  3MGS D;  3AZM B;  1P3G D;  1P3A A;  2NZD C;  3W96 D;  3W97 B;  1KX5 B;  1ZLA D;  1P3K D;  3VH5 W;  2ZY2 A;  1P34 B;  4KGC C;  3WAA A;  3AZH D;  4J8U C;  1P3F C;  4WV4 B;  5AV6 B;  4Z5T D;  3O62 B;  4WNN B;  2Y2Q A;  2ZY5 A;  4G92 C;  3AFA C;  1HTA A;  5DNM A;  2IO5 B;  1AOI C;  4R8P C;  3KXB C;  3AZL C;  1P3O D;  1JFI A;  3KWQ D;  1EQZ C;  3B6G C;  4HGA C;  3B6F A;  1P3L C;  4YS3 A;  4NE3 A;  3WKJ D;  3W99 C;  3KFU G;  2HIO A;  2PYO A;  2NQB B;  3REI A;  3WTP E;  3AZM D;  5BNV A;  5AV9 C;  3X1T A;  3AZI A;  4Z66 C;  3C1B B;  4H9P B;  1R4V A;  5B32 A;  4DRB A;  4WU9 A;  1ID3 C;  1P34 D;  3REL C;  1T3U A;  1P3B A;  4YS3 B;  5AV6 D;  1P3P B;  3AZF A;  5AY8 A;  5AVB B;  2VQR A;  3O62 D;  4J8X A;  4X23 B;  2PYO B;  3MGR A;  3REI B;  4QLC B;  1WWI A;  5B32 G;  5BNV B;  2Y2M A;  1HQ3 D;  4DRA A;  5CPI A;  3MVD B;  5JRG B;  3H0M C;  3NQU A;  3V9R B;  1M19 A;  3EPK A;  3X1T B;  1P3I A;  3AZI B;  5B32 B;  2Y2O A;  3AZK A;  3UTA C;  5AVC A;  4YM6 C;  3MGP A;  3X1U A;  2F8N K;  1P3M C;  3AV2 A;  2NQB D;  3MGR B;  5G49 A;  1KX4 D;  4G91 C;  2G5I C;  1M1A A;  2UWX A;  5B24 B;  3UT9 C;  5CPI B;  3MGQ B;  3UTB A;  3TU4 C;  1P3I B;  3C1B D;  3MGS A;  3AZK B;  5AVC B;  1P3G A;  5GSU A;  2Y2H A;  2YFW A;  3W96 A;  4YS3 D;  3LEL A;  3X1U B;  1P3P D;  3LJA A;  5AVB D;  1BH8 B;  3AZG C;  4X23 D;  3R45 A;  3LZ1 C;  5CPK A;  3KUY D;  1F66 D;  2PYO D;  5E5A C;  3REI D;  4QLC D;  5B40 D;  5G49 B;  5B33 A;  3AZH A;  4Z5T A;  5KDM B;  3MVD D;  3AYW C;  1KX5 C;  3W97 C;  5JRG D;  4JJN B;  5BS7 A;  3X1T D;  5B32 D;  2J8P A;  2RVQ C;  3AN2 B;  5B0Y C;  2YFW B;  5GSU B;  3AV1 C;  1P3O A;  3LEL B;  5B1M C;  3KWQ A;  3LJA B;  1Q9C A;  3R45 B;  5AV8 D;  5CPK B;  4M6B A;  3MGR D;  3AZH B;  3VH5 A;  5DNN B;  5B33 B;  5B24 D;  5AV5 B;  4XZQ D;  5CPI D;  1P3A C;  1N1J A;  3MGQ D;  3B0D C;  3W98 B;  3AZK D;  3AZM A;  2HUE B;  4EO5 B;  3WAA C;  3REK A;  1M18 B;  2F2A C;  1P34 A;  2F8N H;  5DNM C;  5AV6 A;  2FJ7 D;  3O62 A;  4WNN A;  4J8W B;  4JJN D;  5BNX B;  1U35 D;  3B6F C;  1BH9 B;  2FFF B;  3AN2 D;  1HQ3 A;  3WA9 D;  5GSU D;  5B2J A;  3REK B;  3LEL D;  3LJA D;  3AZN A;  3WTP B;  5CP6 A;  5CPK D;  2HIO C;  5C3I C;  3X1V B;  4ZUX D;  4H9Q B;  3X1S B;  3AL0 C;  3F6T A;  5DNN D;  5B33 D;  4KUD D;  3A1K A;  5AV5 D;  1WWS A;  2NQB A;  3AZI C;  4CAY B;  5B31 D;  3W98 D;  4WU9 C;  1KX4 A;  3KSY A;  1P3B C;  1HQ3 B;  5B2J B;  1M18 D;  3AZF C;  5AY8 C;  5BT1 C;  5GT0 A;  4H9P A;  3C1B A;  4J8X C;  3AZN B;  3AZE C;  5CP6 B; 
#chains in the Genus database with same CATH homology
 4WU8 C;  2CWE A;  3A6N D;  2DQN C;  5BO0 A;  1P3P A;  3EPJ A;  5B1L C;  2G5H C;  5AVB A;  5F99 B;  4XUJ C;  4X23 A;  4J8W D;  1M19 C;  3KUY A;  1P3I C;  1F66 A;  4QLC A;  5B40 A;  3B0B A;  1KX4 B;  3IP4 C;  5AVC C;  2ARO A;  3MGP C;  3MVD A;  4NE6 A;  5JRG A;  4J8V C;  3V9R A;  3X1U C;  3MNN A;  3REK D;  1S32 B;  3REJ B;  5GT0 B;  3WTP D;  3AV2 C;  5B0Z C;  5GXQ D;  2Y2K A;  3X1V D;  5CPJ B;  3X1S D;  1M1A C;  5BO0 B;  3B0C T;  3UTB C;  5AV8 A;  2CV5 D;  3KUY B;  1F66 B;  1KX3 B;  4WJ3 C;  4Z2M G;  5B40 B;  3MGS C;  4UPK A;  5B2I D;  5B24 A;  2ARO B;  1P3G C;  4XZQ A;  4KGC A;  3W96 C;  5B2J D;  3LZ0 B;  1P3K C;  3MGQ A;  4H9S A;  1ZLA C;  3MNN B;  3VH6 W;  3AZN D;  3REH D;  3AZJ D;  2JE5 A;  5CP6 D;  3AZH C;  3C1C B;  4Z5T C;  5GT3 D;  1BH8 A;  5F99 D;  4R8P A;  1AOI A;  3A1I A;  5BS7 C;  2NZD B;  5AV8 B;  1EQZ A;  4EO5 C;  5KDM A;  2FJ7 A;  1B67 A;  4XZQ B;  4KGC B;  1P3O C;  5CHL B;  4JJN A;  4J8U B;  1S32 D;  1P3F B;  3REJ D;  3KWQ C;  1TAF A;  5GT0 D;  4G92 B;  1U35 A;  3AFA B;  3AN2 A;  3WA9 A;  3P5J B;  5CPJ D;  1TZY D;  3WKJ C;  3H0R C;  1A7W A;  1AOI B;  2Y2I A;  4R8P B;  4NE5 A;  3EPH A;  3KXB B;  3AZL B;  3VH5 T;  5AV9 A;  1KX3 D;  4ZUX A;  1EQZ B;  1ID3 A;  5DNN A;  3AZM C;  2FJ7 B;  3B6G B;  4KUD A;  4LD9 D;  2ARO D;  5AV5 A;  1P3L B;  3LZ0 D;  3MNN D;  5B31 A;  1TAF B;  3W98 A;  3W99 B;  1P34 C;  3EPL A;  1U35 B;  4UUZ A;  3WA9 B;  1M18 A;  3C1C D;  5AV6 C;  3O62 C;  2YFV A;  2L5A A;  2NZD D;  1H3O B;  3A6N A;  5AV9 B;  4ZUX B;  2IO5 C;  4Z66 B;  1W2E A;  5B31 G;  1ID3 B;  4KUD B;  1HQ3 C;  2RIQ A;  4KGC D;  4J8W A;  4J8U D;  1P3F D;  5BNX A;  5B31 B;  1P3M A;  1BH9 A;  3AFA D;  4UUZ B;  2F8N B;  1AOI D;  4R8P D;  3WTP A;  2YFV B;  3KXB D;  3AZL D;  2XD5 A;  5GXQ A;  2NQB C;  3A6N B;  3X1V A;  4H9Q A;  3X1S A;  1KX4 C;  1EQZ D;  3B6G D;  2ZY4 A;  2Y2N A;  4YM6 B;  1P3L D;  2CV5 A;  4CAY A;  3C1B C;  4CSR A;  1P3M B;  3W99 D;  1KU5 A;  5B2I A;  4YS3 C;  1P3P C;  4G91 B;  5AVB C;  2BG1 A;  3REH A;  4X23 C;  3AZJ A;  5JA4 B;  2BYK A;  3KUY C;  4KHA A;  5GXQ B;  1F66 C;  2PYO C;  5AV9 D;  3REI C;  3TU4 B;  4QLC C;  5B40 C;  4Z66 D;  1ID3 D;  5GT3 A;  5F99 A;  3REL D;  3MVD C;  5JRG C;  5B0Y A;  4E44 A;  3AV1 A;  2CV5 B;  4WZS B;  3X1T C;  4CSR B;  5B32 C;  5B2I B;  3LZ1 B;  2LY8 A;  2DF4 C;  1S32 A;  2F8N D;  3REJ A;  3REH B;  3AZJ B;  3H0L C;  2Y2G A;  5AV8 C;  1ULY A;  2BYK B;  3VH6 A;  3AYW B;  4KHA B;  3MGR C;  5CPJ A;  1TZY A;  5B24 C;  5CPI C;  4XZQ C;  5GT3 B;  3UTA D;  4YM6 D;  3MGQ C;  4H9S C;  5B0Y B;  3AV1 B;  1KX3 A;  2JCH A;  4ZBJ B;  2BYM A;  5B1M B;  1P3M D;  1F1E A;  3AZK C;  4LD9 A;  1BFM A;  4AWL B;  4E45 A;  3LZ0 A;  3UT9 D;  1P3A B;  3TU4 D;  1TZY B;  3B0D B;  3C1C A;  2FJ7 C;  4DQY B;  3WAA B;  4JJN C;  2NZD A;  5FUG A;  3AZG D;  3NQJ A;  2BYM B;  4LD9 B;  1U35 C;  3AN2 C;  3LZ1 D;  2W8S A;  3WA9 C;  5GSU C;  3LEL C;  5E5A D;  4J8U A;  5DNM B;  1P3F A;  3LJA C;  2ZM5 A;  5CPK C;  3AYW D;  1KX5 D;  3W97 D;  3AFA A;  4ZUX C;  1JFI B;  5B33 C;  5DNN C;  4KUD C;  1B6W A;  2RVQ D;  5AV5 C;  3B6F B;  3KXB A;  5B0Y D;  3AZL A;  3AV1 D;  5FUG B;  5B31 C;  5B1M D;  3W98 C;  3FDD A;  3NQJ B;  2HUE C;  3B6G A;  3AZE A;  4WU8 A;  2HIO B;  2Y2L A;  5C3I B;  1P3L A;  1M18 C;  1Z2C B;  5B1L A;  2Y2J A;  1P3A D;  3W99 A;  4XUJ A;  3A6N C;  4H9N A;  4NFT A;  4WU9 B;  4H9O A;  4Z2M H;  4J8W C;  1P3B B;  3WAA D;  4J8V A;  1H3O A;  3AZF B;  5AY8 B;  4Z66 A;  4J8X B;  5B0Z A;  3AZE B;  3REL A;  4HGA B;  4WU8 B;  3REK C;  5DNM D;  5B1L B;  3WTP C;  4XUJ B;  5GXQ C;  3NQU B;  1M19 B;  3X1V C;  4H9N B;  3X1S C;  2F8N A;  4H9R A;  3B6F D;  4H9O B;  3MGP B;  2CV5 C;  2Y2P A;  1ZLA A;  4J8V B;  1P3K A;  5B2I C;  3AV2 B;  5B0Z B;  3REL B;  2HIO D;  5B2J C;  4YM6 A;  3UTA A;  1M1A B;  3AZN C;  3REH C;  2F8N G;  3AZJ C;  5CP6 C;  3UTB B;  3AZI D;  4WU9 D;  3MGS B;  5GT3 C;  5F99 C;  4H9R B;  3UT9 A;  1P3B D;  1P3G B;  5JA4 A;  3W96 B;  1ZLA B;  1P3K B;  4ZBJ C;  5AY8 D;  3TU4 A;  3AZF D;  5BT1 D;  4J8X D;  3B0C W;  3AZE D;  4AWL C;  4WU8 D;  3UTA B;  1PZR A;  3EG5 B;  1S32 C;  3WKJ A;  3REJ C;  4Z5T B;  5GT0 C;  5B1L D;  3AZG A;  2ZY3 A;  4XUJ D;  3LZ1 A;  1M19 D;  5CPJ C;  1P3I D;  1TZY C;  2XD1 A;  5E5A A;  3VH6 T;  5AVC D;  3MGP D;  3UT9 B;  3W97 A;  3AYW A;  1P3O B;  4J8V D;  1KX5 A;  3X1U D;  1KX3 C;  3KWQ B;  4LD9 C;  2JSS A;  3AV2 D;  2ARO C;  5B0Z D;  3LZ0 C;  3MNN C;  1M1A D;  3WKJ B;  5B1M A;  3AZG B;  1N1J B;  3UTB D;  3C1C C;  5E5A B;  3MGS D;  3AZM B;  1P3G D;  1P3A A;  2NZD C;  3W96 D;  3W97 B;  1KX5 B;  1ZLA D;  1P3K D;  3VH5 W;  2ZY2 A;  1P34 B;  4KGC C;  3WAA A;  3AZH D;  4J8U C;  1P3F C;  4WV4 B;  5AV6 B;  4Z5T D;  3O62 B;  4WNN B;  2Y2Q A;  2ZY5 A;  4G92 C;  3AFA C;  1HTA A;  5DNM A;  2IO5 B;  1AOI C;  4R8P C;  3KXB C;  3AZL C;  1P3O D;  1JFI A;  3KWQ D;  1EQZ C;  3B6G C;  4HGA C;  3B6F A;  1P3L C;  4YS3 A;  4NE3 A;  3WKJ D;  3W99 C;  3KFU G;  2HIO A;  2PYO A;  2NQB B;  3REI A;  3WTP E;  3AZM D;  5BNV A;  5AV9 C;  3X1T A;  3AZI A;  4Z66 C;  3C1B B;  4H9P B;  1R4V A;  5B32 A;  4DRB A;  4WU9 A;  1ID3 C;  1P34 D;  3REL C;  1T3U A;  1P3B A;  4YS3 B;  5AV6 D;  1P3P B;  3AZF A;  5AY8 A;  5AVB B;  2VQR A;  3O62 D;  4J8X A;  4X23 B;  2PYO B;  3MGR A;  3REI B;  4QLC B;  1WWI A;  5B32 G;  5BNV B;  2Y2M A;  1HQ3 D;  4DRA A;  5CPI A;  3MVD B;  5JRG B;  3H0M C;  3NQU A;  3V9R B;  1M19 A;  3EPK A;  3X1T B;  1P3I A;  3AZI B;  5B32 B;  2Y2O A;  3AZK A;  3UTA C;  5AVC A;  4YM6 C;  3MGP A;  3X1U A;  2F8N K;  1P3M C;  3AV2 A;  2NQB D;  3MGR B;  5G49 A;  1KX4 D;  4G91 C;  2G5I C;  1M1A A;  2UWX A;  5B24 B;  3UT9 C;  5CPI B;  3MGQ B;  3UTB A;  3TU4 C;  1P3I B;  3C1B D;  3MGS A;  3AZK B;  5AVC B;  1P3G A;  5GSU A;  2Y2H A;  2YFW A;  3W96 A;  4YS3 D;  3LEL A;  3X1U B;  1P3P D;  3LJA A;  5AVB D;  1BH8 B;  3AZG C;  4X23 D;  3R45 A;  3LZ1 C;  5CPK A;  3KUY D;  1F66 D;  2PYO D;  5E5A C;  3REI D;  4QLC D;  5B40 D;  5G49 B;  5B33 A;  3AZH A;  4Z5T A;  5KDM B;  3MVD D;  3AYW C;  1KX5 C;  3W97 C;  5JRG D;  4JJN B;  5BS7 A;  3X1T D;  5B32 D;  2J8P A;  2RVQ C;  3AN2 B;  5B0Y C;  2YFW B;  5GSU B;  3AV1 C;  1P3O A;  3LEL B;  5B1M C;  3KWQ A;  3LJA B;  1Q9C A;  3R45 B;  5AV8 D;  5CPK B;  4M6B A;  3MGR D;  3AZH B;  3VH5 A;  5DNN B;  5B33 B;  5B24 D;  5AV5 B;  4XZQ D;  5CPI D;  1P3A C;  1N1J A;  3MGQ D;  3B0D C;  3W98 B;  3AZK D;  3AZM A;  2HUE B;  4EO5 B;  3WAA C;  3REK A;  1M18 B;  2F2A C;  1P34 A;  2F8N H;  5DNM C;  5AV6 A;  2FJ7 D;  3O62 A;  4WNN A;  4J8W B;  4JJN D;  5BNX B;  1U35 D;  3B6F C;  1BH9 B;  2FFF B;  3AN2 D;  1HQ3 A;  3WA9 D;  5GSU D;  5B2J A;  3REK B;  3LEL D;  3LJA D;  3AZN A;  3WTP B;  5CP6 A;  5CPK D;  2HIO C;  5C3I C;  3X1V B;  4ZUX D;  4H9Q B;  3X1S B;  3AL0 C;  3F6T A;  5DNN D;  5B33 D;  4KUD D;  3A1K A;  5AV5 D;  1WWS A;  2NQB A;  3AZI C;  4CAY B;  5B31 D;  3W98 D;  4WU9 C;  1KX4 A;  3KSY A;  1P3B C;  1HQ3 B;  5B2J B;  1M18 D;  3AZF C;  5AY8 C;  5BT1 C;  5GT0 A;  4H9P A;  3C1B A;  4J8X C;  3AZN B;  3AZE C;  5CP6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...