2HUEB

Structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structural basis for the histone chaperone activity of asf1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hueB00
1P3ID 1N1JB 4J8XB 3AZIA 1Q9CA 3W98D 3W99C 3AZLA 3R45A 1P3FD 1KX3C 3UT9B 5AV8B 3LJAD 2F8NH 3MNND 1P3OB 5B24A 4J8XD 1M18C 3W96A 3MGRA 3C1CA 3UT9D 5AV8D 4JJNA 3KWQB 2HIOA 4ZBJC 5JRGB 3B6FC 1ZLAC 1M1AA 5B40C 3AZGC 1BH9B 5CP6A 2F8NB 5F99A 3REHB 4AWLC 3KWQD 4H9PB 1P3LB 3X1TA 1EQZB 4H9SA 4KGCC 3WAAB 3RELB 1H3OB 3B0BA 2F8ND 3AZNB 1M19C 2PYOA 3B0CT 3REHD 3AZEA 1AOIB 1P3LD 1EQZD 3MGSA 3WAAD 3RELD 2CWEA 5AV5C 5AY8B 3AZND 4H9OA 5B32B 3MGPC 4XUJB 1AOID 3B6GA 4XZQC 4QLCC 3MGQB 5B33B 5E5AC 5BO0A 3X1SB 5FUGA 1TZYC 1B6WA 4G91C 4WU8B 5AY8D 3WKJB 1F1EA 2BYKB 5B32D 4XUJD 3WA9C 4NFTA 3AYWC 1P3GC 3V9RA 5GT3C 3MGQD 5B33D 3X1SD 3LELC 5B0YB 5AV6C 4WU8D 1S32C 3WKJD 4Z5TC 3B6FA 3KUYC 3AZGA 5DNMD 3LZ0B 5B0YD 3C1BB 4H9QA 3KSYA 5B1LB 4EO5C 1BH8A 3MVDB 5GSUA 4KGCA 1P3MB 3AZIB 5B2IC 3AZJA 3LZ0D 3AZLB 3R45B 1M19A 3C1BD 5CPIC 5B1LD 3AZFA 3MVDD 2NQBC 3VH5T 4E44A 5B24B 3O62C 5CPKC 1P3MD 5AVBC 3REKC 3AZID 1F66C 4Z66C 5GT0C 2HUEC 5AV5A 3W96B 3MGRB 3C1CB 3AZLD 3MGPA 5CHLB 4R8PC 4JJNB 1P3KC 2HIOB 4XZQA 4QLCA 4Z2MH 4YM6A 5E5AA 5B24D 1M1AB 1TZYA 5CP6B 3W96D 1P3BC 3MGRD 3X1VC 3C1CD 5C3IC 4JJND 5BT1D 3WA9A 2HIOD 3X1TB 3AYWA 1ULYA 5GT3A 3LELA 1M1AD 3UTAC 5CP6D 5AV6A 3LZ1C 5F99D 2PYOB 1S32A 4Z5TA 3X1TD 5B31G 3WTPC 5G49A 3KUYA 4J8UC 3MGSB 5CPJC 4H9OB 5JA4A 2PYOD 5B2JC 3VH5W 5BO0B 3MGSD 4CSRA 5FUGB 1KX5C 2NQBA 3O62A 5CPKA 5KDMA 5AVBA 3REJC 3REKA 1F66A 4DRBA 4ZUXA 4Z66A 2AROC 4R8PA 1P3KA 3B6FB 3AV1C 3AZGB 1KX4C 2YFVA 3X1VA 3A6NC 4H9QB 3AZMB 1WWIA 3KXBC 1BH8B 3AN2C 4J8WC 5GSUB 4KGCB 4X23A 3B6FD 4WU9A 3UTAA 3AZGD 3LZ1A 3AZJB 4J8VA 3WTPE 1M19B 3AZMD 4UUZA 1P34A 3AZFB 4J8XC 5GSUD 4J8UA 4KGCD 3X1UC 5BS7C 5CPJA 5AV5B 3AZJD 1R4VA 1M19D 5B2JA 3MGPB 1P3OC 3AZFD 4XZQB 4QLCB 1A7WA 2NZDC 5B0ZC 4YM6B 1KX5A 5AV5D 3KWQC 1P3AC 3MGPD 2YFWA 3WA9B 5JRGC 3AYWB 4XZQD 1HTAA 4QLCD 3AFAC 3W99A 1KX3A 4YM6D 3VH5A 5E5AD 3LELB 2AROA 3NQUA 3TU4C 5AV6B 1S32B 3AZHB 2L5AA 3WA9D 5DNMB 1M18A 4LD9C 3AV1A 3AYWD 3WAAC 5G49B 3KUYB 3AV2C 1BFMA 1KX4A 3LELD 3AZNC 3A6NA 5AV6D 3KXBA 1AOIC 4EO5B 3AN2A 1S32D 4J8WA 3AZHD 5B1MC 1ZLAA 1HQ3C 5B40A 5DNNC 3W97C 3KUYD 5AV9C 5AY8C 5GXQC 5B31B 1TAFA 2NQBB 3X1UA 5B33C 3X1SC 3O62B 5CPKB 5BS7A 5KDMB 5AVBB 3REKB 1F66B 4ZUXB 2HUEB 3WKJC 5BNVA 1WWSA 5B31D 4H9RA 4R8PB 1P3OA 1P3KB 3AZKC 2NQBD 2NZDA 5B0ZA 3O62D 5CPKD 5AVBD 3REKD 1F66D 4ZUXD 4Z66D 2YFVB 1P3AA 4R8PD 1P3KD 5JRGA 4HGAC 4X23B 3AFAA 2F8NA 5F99B 4WU9B 1JFIA 3UTAB 3C1BC 3LZ1B 3TU4A 4J8VB 1P34B 1P3GA 4LD9A 1P3MC 3AV2A 4J8UB 4X23D 3AZNA 4WU9D 3UTAD 5CPJB 3LZ1D 3AZEB 4J8VD 3B0DC 5B2JB 3REIC 2CV5C 3UTBC 5B1MA 1P34D 1HQ3A 4YS3C 5DNNA 3W97A 4J8UD 5AV9A 3C1CC 5GXQA 1KX5B 4WZSB 5CPJD 3AZED 3B6GB 1U35C 2HIOC 5B2JD 2YFWB 4G92C 2BYMA 3X1SA 5B2IA 2FJ7C 3W99B 3NQJA 1KX3B 2AROB 5AVCC 4KHAA 3NQUB 5CPIA 1KX5D 4KUDC 3B6GD 3AZKA 5BNXA 4WNNA 4H9SC 3X1TC 3V9RB 3VH6W 1M18B 3AV1B 5GT0A 1KX4B 3W99D 1KX3D 1ID3C 4H9NA 4NE3A 2AROD 4ZBJB 3KXBB 2RVQC 4J8WB 1ZLAB 5B40B 4NE6A 1M18D 3AV1D 1P3BA 1P3PC 2IO5C 1KX4D 1KU5A 4AWLB 3A6ND 1P3IC 3KXBD 1TAFB 4J8WD 1P3MA 3W98C 1ZLAD 1P3FC 5B40D 3X1UB 3LJAC 3MNNC 5BNVB 3REIA 2CV5A 4H9RB 3UTBA 3WTPA 4YS3A 2NZDB 5B0ZB 3X1UD 3UT9C 5AV8C 1U35A 1P3AB 1P3OD 5E5AB 4Z2MG 2FJ7A 3AFAB 1TZYB 2NZDD 5B0ZD 4G91B 1JFIB 5AVCA 3TU4B 3AZMC 4KUDA 1P3AD 5GSUC 4CAYA 1P3GB 3REJA 5GT3B 5JRGD 4LD9B 3AV2B 3AFAD 1TZYD 3REHC 1ID3A 4E45A 3AZJC 3TU4D 1P3LC 1EQZC 4Z5TB 3AZFC 5B1MB 1HQ3B 3RELC 1P3GD 5DNNB 5GT3D 4LD9D 3W97B 3AV2D 1P3PA 3VH6A 5AV9B 5GXQB 5JA4B 1P3IA 4Z5TD 5B1MD 3W98A 1P3FA 1HQ3D 2BYMB 4YM6C 5DNND 4CSRB 5B2IB 3W97D 3LJAA 3NQJB 5B32C 2LY8A 3MNNA 4XUJC 5AV9D 4KHAB 5CPIB 5GXQD 4DRAA 1N1JA 4J8XA 3AZKB 3MGQC 5BNXB 4WNNB 2JSSA 4Z66B 5GT0B 5B2ID 5AV8A 3UT9A 4WU8C 4H9NB 5CPID 2F8NG 3AZHC 5DNMC 3AZKD 5B0YC 4HGAB 4NE5A 1P3BB 5GT0D 3KWQA 3X1VB 3B0CW 3AZMA 5C3IB 3VH6T 1BH9A 3LZ0C 3REHA 1P3BD 5B1LC 3X1VD 4H9PA 5B31C 3MVDC 1P3LA 4UUZB 1EQZA 3B0DB 3REIB 2CV5B 5B32G 3UTBB 3WTPB 3WAAA 3RELA 1H3OA 3AZIC 4YS3B 3AZLC 4ZUXC 1AOIA 4WV4B 1U35B 3REID 2CV5D 5B24C 3UTBD 3WTPD 4G92B 3W96C 4YS3D 1B67A 5AY8A 3MGRC 2FJ7B 5B32A 4XUJA 4JJNC 5AVCB 5BT1C 4KUDB 1U35D 3MGQA 5B33A 4CAYB 1M1AC 4X23C 3REJB 5CP6C 5F99C 4WU8A 4WU9C 2FJ7D 3WKJA 1ID3B 2BYKA 4J8VC 5AVCD 3AZHA 4KUDD 1P34C 5DNMA 5B0YA 3REJD 2F8NK 1P3PB 2IO5B 2PYOC 4M6BA 3A6NB 1ID3D 3AZEC 3AN2B 1P3IB 2RVQD 3MGSC 3W98B 3LZ0A 1P3FB 3C1BA 3LJAB 5B1LA 1P3PD 3MNNB 5B31A 3MVDA 3B6GC 3AN2D
chains in the Genus database with same CATH superfamily
1P3ID 1N1JB 4J8XB 3AZIA 1Q9CA 3W98D 3W99C 3AZLA 3R45A 1P3FD 1KX3C 3UT9B 5AV8B 3LJAD 2F8NH 3MNND 1P3OB 5B24A 4J8XD 1M18C 3W96A 4DQYB 3MGRA 3C1CA 3UT9D 5AV8D 4JJNA 3KWQB 2HIOA 4ZBJC 5JRGB 3B6FC 1ZLAC 1M1AA 5B40C 3AZGC 1BH9B 5CP6A 2F8NB 5F99A 3REHB 4AWLC 2XD1A 3KWQD 4H9PB 2Y2OA 1P3LB 3X1TA 1EQZB 4H9SA 4KGCC 3WAAB 3RELB 1H3OB 3B0BA 2F8ND 3AZNB 1M19C 2PYOA 3B0CT 2Y2QA 3REHD 3AZEA 1AOIB 1P3LD 1EQZD 3MGSA 3WAAD 3H0MC 3RELD 2CWEA 5AV5C 5AY8B 3AZND 4H9OA 5B32B 3MGPC 4XUJB 1AOID 3B6GA 2ZY5A 4XZQC 4QLCC 3MGQB 5B33B 5E5AC 5BO0A 3X1SB 5FUGA 1TZYC 1B6WA 4G91C 4WU8B 5AY8D 3WKJB 1F1EA 2BYKB 5B32D 4XUJD 3WA9C 4NFTA 3AYWC 1P3GC 3V9RA 5GT3C 3MGQD 5B33D 3X1SD 3LELC 5B0YB 5AV6C 4WU8D 1S32C 3WKJD 4Z5TC 3B6FA 3KUYC 3AZGA 2Y2LA 1T3UA 5DNMD 3LZ0B 5B0YD 3C1BB 4H9QA 3KSYA 5B1LB 4EO5C 1BH8A 3MVDB 5GSUA 4KGCA 1P3MB 3AZIB 5B2IC 3AZJA 3LZ0D 3AZLB 3R45B 1M19A 3C1BD 5CPIC 5B1LD 3AZFA 3MVDD 2NQBC 3VH5T 4E44A 5B24B 3O62C 5CPKC 1P3MD 5AVBC 3REKC 3AZID 1F66C 4Z66C 5GT0C 2HUEC 5AV5A 3W96B 3MGRB 3C1CB 3AZLD 3MGPA 5CHLB 4R8PC 4JJNB 1P3KC 1W2EA 2HIOB 4XZQA 4QLCA 4Z2MH 4YM6A 5E5AA 5B24D 1M1AB 1TZYA 5CP6B 3W96D 1P3BC 3MGRD 3X1VC 3C1CD 4WJ3C 5C3IC 4JJND 5BT1D 2Y2NA 3WA9A 2HIOD 3X1TB 3AYWA 1ULYA 5GT3A 3LELA 1M1AD 3UTAC 5CP6D 5AV6A 3LZ1C 5F99D 2PYOB 1S32A 2UWXA 4Z5TA 3X1TD 5B31G 3WTPC 5G49A 3KUYA 4J8UC 3MGSB 5CPJC 4H9OB 5JA4A 2PYOD 5B2JC 3VH5W 5BO0B 3MGSD 4CSRA 5FUGB 1KX5C 2Y2HA 2NQBA 3O62A 5CPKA 5KDMA 5AVBA 3REJC 3REKA 1F66A 4DRBA 4ZUXA 4Z66A 2AROC 3AL0C 4R8PA 1P3KA 2VQRA 3B6FB 3AV1C 3AZGB 2ZM5A 1KX4C 2ZY4A 2F2AC 2YFVA 3X1VA 3A6NC 4H9QB 3AZMB 1WWIA 3KXBC 1BH8B 3AN2C 4J8WC 5GSUB 2Y2KA 4X23A 4KGCB 3B6FD 4WU9A 3UTAA 3AZGD 3LZ1A 3AZJB 4J8VA 3WTPE 1M19B 3AZMD 4UUZA 1P34A 3F6TA 3AZFB 4J8XC 5GSUD 4J8UA 4KGCD 3X1UC 5BS7C 5CPJA 5AV5B 3AZJD 1R4VA 1M19D 5B2JA 3MGPB 1P3OC 1PZRA 3AZFD 4XZQB 4QLCB 1A7WA 2NZDC 5B0ZC 4YM6B 1KX5A 3EPJA 5AV5D 3KWQC 1P3AC 3MGPD 2YFWA 3WA9B 5JRGC 3AYWB 4XZQD 1HTAA 4QLCD 3AFAC 3W99A 1KX3A 4YM6D 3VH5A 5E5AD 3LELB 2AROA 3NQUA 3TU4C 5AV6B 1S32B 3AZHB 2L5AA 3WA9D 5DNMB 1M18A 4LD9C 3AV1A 3AYWD 3WAAC 5G49B 3KUYB 3AV2C 1BFMA 1KX4A 3LELD 3AZNC 2JE5A 3A6NA 5AV6D 3KXBA 1AOIC 4EO5B 3AN2A 1S32D 4J8WA 3AZHD 5B1MC 1ZLAA 1HQ3C 5B40A 5DNNC 3W97C 3KUYD 3H0LC 5AY8C 5AV9C 5GXQC 5B31B 1TAFA 2NQBB 3X1UA 5B33C 3X1SC 3EPHA 3O62B 5CPKB 5BS7A 5KDMB 5AVBB 3REKB 1F66B 4ZUXB 2HUEB 3EG5B 3WKJC 5BNVA 1WWSA 5B31D 4H9RA 4R8PB 1P3OA 1P3KB 3AZKC 2NQBD 2NZDA 5B0ZA 3O62D 5CPKD 5AVBD 3REKD 1F66D 4ZUXD 4Z66D 2YFVB 1P3AA 4R8PD 1P3KD 5JRGA 4HGAC 4X23B 3AFAA 2F8NA 5F99B 4WU9B 2G5HC 3UTAB 1JFIA 3C1BC 3LZ1B 3A1IA 3TU4A 4J8VB 1P34B 1P3GA 4LD9A 1P3MC 3AV2A 4J8UB 4X23D 3AZNA 4WU9D 3UTAD 5CPJB 3LZ1D 3KFUG 3AZEB 4J8VD 3B0DC 5B2JB 3REIC 2CV5C 3UTBC 5B1MA 1P34D 1HQ3A 4YS3C 2DF4C 5DNNA 3W97A 4J8UD 5AV9A 3C1CC 5GXQA 1KX5B 4WZSB 5CPJD 3AZED 3B6GB 2FFFB 1U35C 2HIOC 5B2JD 2YFWB 4G92C 2BYMA 3X1SA 3EPLA 5B2IA 2RIQA 2FJ7C 2Y2GA 3NQJA 1KX3B 3W99B 2AROB 4KHAA 5AVCC 3NQUB 5CPIA 1KX5D 4KUDC 3EPKA 3A1KA 3B6GD 3AZKA 2Y2IA 4WNNA 4H9SC 5BNXA 3X1TC 3V9RB 3VH6W 1M18B 3AV1B 5GT0A 1KX4B 3W99D 1KX3D 1ID3C 4H9NA 4NE3A 2AROD 4ZBJB 3KXBB 2RVQC 4J8WB 1ZLAB 5B40B 4NE6A 1M18D 3AV1D 1P3BA 1P3PC 2IO5C 1KX4D 1KU5A 2ZY2A 4AWLB 2G5IC 3A6ND 1P3IC 3KXBD 1TAFB 4J8WD 1P3MA 3W98C 1ZLAD 1P3FC 5B40D 3IP4C 3X1UB 3LJAC 3P5JB 3MNNC 5BNVB 3REIA 2CV5A 4H9RB 3UTBA 2ZY3A 3WTPA 4YS3A 2NZDB 5B0ZB 3X1UD 3UT9C 5AV8C 2Y2MA 1U35A 2J8PA 1P3AB 1P3OD 5E5AB 4Z2MG 2FJ7A 3AFAB 1TZYB 2NZDD 5B0ZD 4G91B 1JFIB 5AVCA 3TU4B 2W8SA 3AZMC 4KUDA 1P3AD 5GSUC 4CAYA 1P3GB 3REJA 5GT3B 5JRGD 4LD9B 3AV2B 2Y2PA 1TZYD 3AFAD 3REHC 1ID3A 4E45A 3AZJC 3TU4D 1P3LC 1EQZC 4Z5TB 3AZFC 5B1MB 1Z2CB 4UPKA 1HQ3B 3RELC 1P3GD 5DNNB 5GT3D 4LD9D 3W97B 3AV2D 1P3PA 3VH6A 5AV9B 5GXQB 5JA4B 1P3IA 4Z5TD 3FDDA 3H0RC 5B1MD 3W98A 1P3FA 1HQ3D 2BYMB 4YM6C 5DNND 4CSRB 5B2IB 3W97D 3LJAA 3NQJB 5B32C 2LY8A 3MNNA 4XUJC 5AV9D 4KHAB 5CPIB 5GXQD 4DRAA 1N1JA 4J8XA 3AZKB 3MGQC 5BNXB 4WNNB 2JSSA 4Z66B 5GT0B 5B2ID 5AV8A 3UT9A 4WU8C 4H9NB 5CPID 2F8NG 3AZHC 5DNMC 3AZKD 2DQNC 5B0YC 4HGAB 4NE5A 1P3BB 5GT0D 3KWQA 3X1VB 3B0CW 3AZMA 5C3IB 2Y2JA 3VH6T 1BH9A 3LZ0C 3REHA 1P3BD 5B1LC 3X1VD 4H9PA 5B31C 3MVDC 1P3LA 4UUZB 1EQZA 3B0DB 3REIB 2CV5B 5B32G 3UTBB 3WTPB 3WAAA 3RELA 1H3OA 3AZIC 4YS3B 3AZLC 4ZUXC 1AOIA 4WV4B 1U35B 3REID 2CV5D 5B24C 3UTBD 3WTPD 2JCHA 4G92B 3W96C 4YS3D 1B67A 5AY8A 3MGRC 2FJ7B 5B32A 4XUJA 4JJNC 5AVCB 5BT1C 4KUDB 1U35D 3MGQA 5B33A 4CAYB 1M1AC 4X23C 3REJB 5CP6C 2BG1A 5F99C 4WU8A 4WU9C 2FJ7D 3WKJA 1ID3B 2BYKA 4J8VC 5AVCD 3AZHA 4KUDD 1P34C 5DNMA 5B0YA 3REJD 2F8NK 1P3PB 2IO5B 2XD5A 2PYOC 4M6BA 3A6NB 1ID3D 3AZEC 3AN2B 1P3IB 2RVQD 3MGSC 3W98B 3LZ0A 1P3FB 3C1BA 3LJAB 5B1LA 1P3PD 3MNNB 5B31A 3MVDA 3B6GC 3AN2D
chains in the Genus database with same CATH topology
1P3ID 1N1JB 4J8XB 3AZIA 1Q9CA 3W98D 3W99C 3AZLA 3R45A 1P3FD 1KX3C 3UT9B 5AV8B 3LJAD 2F8NH 3MNND 1P3OB 5B24A 4J8XD 1M18C 3W96A 4DQYB 3MGRA 3C1CA 3UT9D 5AV8D 4JJNA 3KWQB 2HIOA 4ZBJC 5JRGB 3B6FC 1ZLAC 1M1AA 5B40C 3AZGC 1BH9B 5CP6A 2F8NB 5F99A 3REHB 4AWLC 2XD1A 3KWQD 4H9PB 2Y2OA 1P3LB 3X1TA 1EQZB 4H9SA 4KGCC 3WAAB 3RELB 1H3OB 3B0BA 2F8ND 3AZNB 1M19C 2PYOA 3B0CT 2Y2QA 3REHD 3AZEA 1AOIB 1P3LD 1EQZD 3MGSA 3WAAD 3H0MC 3RELD 2CWEA 5AV5C 5AY8B 3AZND 4H9OA 5B32B 3MGPC 4XUJB 1AOID 3B6GA 2ZY5A 4XZQC 4QLCC 3MGQB 5B33B 5E5AC 5BO0A 3X1SB 5FUGA 1TZYC 1B6WA 4G91C 4WU8B 5AY8D 3WKJB 1F1EA 2BYKB 5B32D 4XUJD 3WA9C 4NFTA 3AYWC 1P3GC 3V9RA 5GT3C 3MGQD 5B33D 3X1SD 3LELC 5B0YB 5AV6C 4WU8D 1S32C 3WKJD 4Z5TC 3B6FA 3KUYC 3AZGA 2Y2LA 1T3UA 5DNMD 3LZ0B 5B0YD 3C1BB 4H9QA 3KSYA 5B1LB 4EO5C 1BH8A 3MVDB 5GSUA 4KGCA 1P3MB 3AZIB 5B2IC 3AZJA 3LZ0D 3AZLB 3R45B 1M19A 3C1BD 5CPIC 5B1LD 3AZFA 3MVDD 2NQBC 3VH5T 4E44A 5B24B 3O62C 5CPKC 1P3MD 5AVBC 3REKC 3AZID 1F66C 4Z66C 5GT0C 2HUEC 5AV5A 3W96B 3MGRB 3C1CB 3AZLD 3MGPA 5CHLB 4R8PC 4JJNB 1P3KC 1W2EA 2HIOB 4XZQA 4QLCA 4Z2MH 4YM6A 5E5AA 5B24D 1M1AB 1TZYA 5CP6B 3W96D 1P3BC 3MGRD 3X1VC 3C1CD 4WJ3C 5C3IC 4JJND 5BT1D 2Y2NA 3WA9A 2HIOD 3X1TB 3AYWA 1ULYA 5GT3A 3LELA 1M1AD 3UTAC 5CP6D 5AV6A 3LZ1C 5F99D 2PYOB 1S32A 2UWXA 4Z5TA 3X1TD 5B31G 3WTPC 5G49A 3KUYA 4J8UC 3MGSB 5CPJC 4H9OB 5JA4A 2PYOD 5B2JC 3VH5W 5BO0B 3MGSD 4CSRA 5FUGB 1KX5C 2Y2HA 2NQBA 3O62A 5CPKA 5KDMA 5AVBA 3REJC 3REKA 1F66A 4DRBA 4ZUXA 4Z66A 2AROC 3AL0C 4R8PA 1P3KA 2VQRA 3B6FB 3AV1C 3AZGB 2ZM5A 1KX4C 2ZY4A 2F2AC 2YFVA 3X1VA 3A6NC 4H9QB 3AZMB 1WWIA 3KXBC 1BH8B 3AN2C 4J8WC 5GSUB 2Y2KA 4X23A 4KGCB 3B6FD 4WU9A 3UTAA 3AZGD 3LZ1A 3AZJB 4J8VA 3WTPE 1M19B 3AZMD 4UUZA 1P34A 3F6TA 3AZFB 4J8XC 5GSUD 4J8UA 4KGCD 3X1UC 5BS7C 5CPJA 5AV5B 3AZJD 1R4VA 1M19D 5B2JA 3MGPB 1P3OC 1PZRA 3AZFD 4XZQB 4QLCB 1A7WA 2NZDC 5B0ZC 4YM6B 1KX5A 3EPJA 5AV5D 3KWQC 1P3AC 3MGPD 2YFWA 3WA9B 5JRGC 3AYWB 4XZQD 1HTAA 4QLCD 3AFAC 3W99A 1KX3A 4YM6D 3VH5A 5E5AD 3LELB 2AROA 3NQUA 3TU4C 5AV6B 1S32B 3AZHB 2L5AA 3WA9D 5DNMB 1M18A 4LD9C 3AV1A 3AYWD 3WAAC 5G49B 3KUYB 3AV2C 1BFMA 1KX4A 3LELD 3AZNC 2JE5A 3A6NA 5AV6D 3KXBA 1AOIC 4EO5B 3AN2A 1S32D 4J8WA 3AZHD 5B1MC 1ZLAA 1HQ3C 5B40A 5DNNC 3W97C 3KUYD 3H0LC 5AY8C 5AV9C 5GXQC 5B31B 1TAFA 2NQBB 3X1UA 5B33C 3X1SC 3EPHA 3O62B 5CPKB 5BS7A 5KDMB 5AVBB 3REKB 1F66B 4ZUXB 2HUEB 3EG5B 3WKJC 5BNVA 1WWSA 5B31D 4H9RA 4R8PB 1P3OA 1P3KB 3AZKC 2NQBD 2NZDA 5B0ZA 3O62D 5CPKD 5AVBD 3REKD 1F66D 4ZUXD 4Z66D 2YFVB 1P3AA 4R8PD 1P3KD 5JRGA 4HGAC 4X23B 3AFAA 2F8NA 5F99B 4WU9B 2G5HC 3UTAB 1JFIA 3C1BC 3LZ1B 3A1IA 3TU4A 4J8VB 1P34B 1P3GA 4LD9A 1P3MC 3AV2A 4J8UB 4X23D 3AZNA 4WU9D 3UTAD 5CPJB 3LZ1D 3KFUG 3AZEB 4J8VD 3B0DC 5B2JB 3REIC 2CV5C 3UTBC 5B1MA 1P34D 1HQ3A 4YS3C 2DF4C 5DNNA 3W97A 4J8UD 5AV9A 3C1CC 5GXQA 1KX5B 4WZSB 5CPJD 3AZED 3B6GB 2FFFB 1U35C 2HIOC 5B2JD 2YFWB 4G92C 2BYMA 3X1SA 3EPLA 5B2IA 2RIQA 2FJ7C 2Y2GA 3NQJA 1KX3B 3W99B 2AROB 4KHAA 5AVCC 3NQUB 5CPIA 1KX5D 4KUDC 3EPKA 3A1KA 3B6GD 3AZKA 2Y2IA 4WNNA 4H9SC 5BNXA 3X1TC 3V9RB 3VH6W 1M18B 3AV1B 5GT0A 1KX4B 3W99D 1KX3D 1ID3C 4H9NA 4NE3A 2AROD 4ZBJB 3KXBB 2RVQC 4J8WB 1ZLAB 5B40B 4NE6A 1M18D 3AV1D 1P3BA 1P3PC 2IO5C 1KX4D 1KU5A 2ZY2A 4AWLB 2G5IC 3A6ND 1P3IC 3KXBD 1TAFB 4J8WD 1P3MA 3W98C 1ZLAD 1P3FC 5B40D 3IP4C 3X1UB 3LJAC 3P5JB 3MNNC 5BNVB 3REIA 2CV5A 4H9RB 3UTBA 2ZY3A 3WTPA 4YS3A 2NZDB 5B0ZB 3X1UD 3UT9C 5AV8C 2Y2MA 1U35A 2J8PA 1P3AB 1P3OD 5E5AB 4Z2MG 2FJ7A 3AFAB 1TZYB 2NZDD 5B0ZD 4G91B 1JFIB 5AVCA 3TU4B 2W8SA 3AZMC 4KUDA 1P3AD 5GSUC 4CAYA 1P3GB 3REJA 5GT3B 5JRGD 4LD9B 3AV2B 2Y2PA 1TZYD 3AFAD 3REHC 1ID3A 4E45A 3AZJC 3TU4D 1P3LC 1EQZC 4Z5TB 3AZFC 5B1MB 1Z2CB 4UPKA 1HQ3B 3RELC 1P3GD 5DNNB 5GT3D 4LD9D 3W97B 3AV2D 1P3PA 3VH6A 5AV9B 5GXQB 5JA4B 1P3IA 4Z5TD 3FDDA 3H0RC 5B1MD 3W98A 1P3FA 1HQ3D 2BYMB 4YM6C 5DNND 4CSRB 5B2IB 3W97D 3LJAA 3NQJB 5B32C 2LY8A 3MNNA 4XUJC 5AV9D 4KHAB 5CPIB 5GXQD 4DRAA 1N1JA 4J8XA 3AZKB 3MGQC 5BNXB 4WNNB 2JSSA 4Z66B 5GT0B 5B2ID 5AV8A 3UT9A 4WU8C 4H9NB 5CPID 2F8NG 3AZHC 5DNMC 3AZKD 2DQNC 5B0YC 4HGAB 4NE5A 1P3BB 5GT0D 3KWQA 3X1VB 3B0CW 3AZMA 5C3IB 2Y2JA 3VH6T 1BH9A 3LZ0C 3REHA 1P3BD 5B1LC 3X1VD 4H9PA 5B31C 3MVDC 1P3LA 4UUZB 1EQZA 3B0DB 3REIB 2CV5B 5B32G 3UTBB 3WTPB 3WAAA 3RELA 1H3OA 3AZIC 4YS3B 3AZLC 4ZUXC 1AOIA 4WV4B 1U35B 3REID 2CV5D 5B24C 3UTBD 3WTPD 2JCHA 4G92B 3W96C 4YS3D 1B67A 5AY8A 3MGRC 2FJ7B 5B32A 4XUJA 4JJNC 5AVCB 5BT1C 4KUDB 1U35D 3MGQA 5B33A 4CAYB 1M1AC 4X23C 3REJB 5CP6C 2BG1A 5F99C 4WU8A 4WU9C 2FJ7D 3WKJA 1ID3B 2BYKA 4J8VC 5AVCD 3AZHA 4KUDD 1P34C 5DNMA 5B0YA 3REJD 2F8NK 1P3PB 2IO5B 2XD5A 2PYOC 4M6BA 3A6NB 1ID3D 3AZEC 3AN2B 1P3IB 2RVQD 3MGSC 3W98B 3LZ0A 1P3FB 3C1BA 3LJAB 5B1LA 1P3PD 3MNNB 5B31A 3MVDA 3B6GC 3AN2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I D;  1N1J B;  4J8X B;  3AZI A;  1Q9C A;  3W98 D;  3W99 C;  3AZL A;  3R45 A;  1P3F D;  1KX3 C;  3UT9 B;  5AV8 B;  3LJA D;  2F8N H;  3MNN D;  1P3O B;  5B24 A;  4J8X D;  1M18 C;  3W96 A;  3MGR A;  3C1C A;  3UT9 D;  5AV8 D;  4JJN A;  3KWQ B;  2HIO A;  4ZBJ C;  5JRG B;  3B6F C;  1ZLA C;  1M1A A;  5B40 C;  3AZG C;  1BH9 B;  5CP6 A;  2F8N B;  5F99 A;  3REH B;  4AWL C;  3KWQ D;  4H9P B;  1P3L B;  3X1T A;  1EQZ B;  4H9S A;  4KGC C;  3WAA B;  3REL B;  1H3O B;  3B0B A;  2F8N D;  3AZN B;  1M19 C;  2PYO A;  3B0C T;  3REH D;  3AZE A;  1AOI B;  1P3L D;  1EQZ D;  3MGS A;  3WAA D;  3REL D;  2CWE A;  5AV5 C;  5AY8 B;  3AZN D;  4H9O A;  5B32 B;  3MGP C;  4XUJ B;  1AOI D;  3B6G A;  4XZQ C;  4QLC C;  3MGQ B;  5B33 B;  5E5A C;  5BO0 A;  3X1S B;  5FUG A;  1TZY C;  1B6W A;  4G91 C;  4WU8 B;  5AY8 D;  3WKJ B;  1F1E A;  2BYK B;  5B32 D;  4XUJ D;  3WA9 C;  4NFT A;  3AYW C;  1P3G C;  3V9R A;  5GT3 C;  3MGQ D;  5B33 D;  3X1S D;  3LEL C;  5B0Y B;  5AV6 C;  4WU8 D;  1S32 C;  3WKJ D;  4Z5T C;  3B6F A;  3KUY C;  3AZG A;  5DNM D;  3LZ0 B;  5B0Y D;  3C1B B;  4H9Q A;  3KSY A;  5B1L B;  4EO5 C;  1BH8 A;  3MVD B;  5GSU A;  4KGC A;  1P3M B;  3AZI B;  5B2I C;  3AZJ A;  3LZ0 D;  3AZL B;  3R45 B;  1M19 A;  3C1B D;  5CPI C;  5B1L D;  3AZF A;  3MVD D;  2NQB C;  3VH5 T;  4E44 A;  5B24 B;  3O62 C;  5CPK C;  1P3M D;  5AVB C;  3REK C;  3AZI D;  1F66 C;  4Z66 C;  5GT0 C;  2HUE C;  5AV5 A;  3W96 B;  3MGR B;  3C1C B;  3AZL D;  3MGP A;  5CHL B;  4R8P C;  4JJN B;  1P3K C;  2HIO B;  4XZQ A;  4QLC A;  4Z2M H;  4YM6 A;  5E5A A;  5B24 D;  1M1A B;  1TZY A;  5CP6 B;  3W96 D;  1P3B C;  3MGR D;  3X1V C;  3C1C D;  5C3I C;  4JJN D;  5BT1 D;  3WA9 A;  2HIO D;  3X1T B;  3AYW A;  1ULY A;  5GT3 A;  3LEL A;  1M1A D;  3UTA C;  5CP6 D;  5AV6 A;  3LZ1 C;  5F99 D;  2PYO B;  1S32 A;  4Z5T A;  3X1T D;  5B31 G;  3WTP C;  5G49 A;  3KUY A;  4J8U C;  3MGS B;  5CPJ C;  4H9O B;  5JA4 A;  2PYO D;  5B2J C;  3VH5 W;  5BO0 B;  3MGS D;  4CSR A;  5FUG B;  1KX5 C;  2NQB A;  3O62 A;  5CPK A;  5KDM A;  5AVB A;  3REJ C;  3REK A;  1F66 A;  4DRB A;  4ZUX A;  4Z66 A;  2ARO C;  4R8P A;  1P3K A;  3B6F B;  3AV1 C;  3AZG B;  1KX4 C;  2YFV A;  3X1V A;  3A6N C;  4H9Q B;  3AZM B;  1WWI A;  3KXB C;  1BH8 B;  3AN2 C;  4J8W C;  5GSU B;  4KGC B;  4X23 A;  3B6F D;  4WU9 A;  3UTA A;  3AZG D;  3LZ1 A;  3AZJ B;  4J8V A;  3WTP E;  1M19 B;  3AZM D;  4UUZ A;  1P34 A;  3AZF B;  4J8X C;  5GSU D;  4J8U A;  4KGC D;  3X1U C;  5BS7 C;  5CPJ A;  5AV5 B;  3AZJ D;  1R4V A;  1M19 D;  5B2J A;  3MGP B;  1P3O C;  3AZF D;  4XZQ B;  4QLC B;  1A7W A;  2NZD C;  5B0Z C;  4YM6 B;  1KX5 A;  5AV5 D;  3KWQ C;  1P3A C;  3MGP D;  2YFW A;  3WA9 B;  5JRG C;  3AYW B;  4XZQ D;  1HTA A;  4QLC D;  3AFA C;  3W99 A;  1KX3 A;  4YM6 D;  3VH5 A;  5E5A D;  3LEL B;  2ARO A;  3NQU A;  3TU4 C;  5AV6 B;  1S32 B;  3AZH B;  2L5A A;  3WA9 D;  5DNM B;  1M18 A;  4LD9 C;  3AV1 A;  3AYW D;  3WAA C;  5G49 B;  3KUY B;  3AV2 C;  1BFM A;  1KX4 A;  3LEL D;  3AZN C;  3A6N A;  5AV6 D;  3KXB A;  1AOI C;  4EO5 B;  3AN2 A;  1S32 D;  4J8W A;  3AZH D;  5B1M C;  1ZLA A;  1HQ3 C;  5B40 A;  5DNN C;  3W97 C;  3KUY D;  5AV9 C;  5AY8 C;  5GXQ C;  5B31 B;  1TAF A;  2NQB B;  3X1U A;  5B33 C;  3X1S C;  3O62 B;  5CPK B;  5BS7 A;  5KDM B;  5AVB B;  3REK B;  1F66 B;  4ZUX B;  2HUE B;  3WKJ C;  5BNV A;  1WWS A;  5B31 D;  4H9R A;  4R8P B;  1P3O A;  1P3K B;  3AZK C;  2NQB D;  2NZD A;  5B0Z A;  3O62 D;  5CPK D;  5AVB D;  3REK D;  1F66 D;  4ZUX D;  4Z66 D;  2YFV B;  1P3A A;  4R8P D;  1P3K D;  5JRG A;  4HGA C;  4X23 B;  3AFA A;  2F8N A;  5F99 B;  4WU9 B;  1JFI A;  3UTA B;  3C1B C;  3LZ1 B;  3TU4 A;  4J8V B;  1P34 B;  1P3G A;  4LD9 A;  1P3M C;  3AV2 A;  4J8U B;  4X23 D;  3AZN A;  4WU9 D;  3UTA D;  5CPJ B;  3LZ1 D;  3AZE B;  4J8V D;  3B0D C;  5B2J B;  3REI C;  2CV5 C;  3UTB C;  5B1M A;  1P34 D;  1HQ3 A;  4YS3 C;  5DNN A;  3W97 A;  4J8U D;  5AV9 A;  3C1C C;  5GXQ A;  1KX5 B;  4WZS B;  5CPJ D;  3AZE D;  3B6G B;  1U35 C;  2HIO C;  5B2J D;  2YFW B;  4G92 C;  2BYM A;  3X1S A;  5B2I A;  2FJ7 C;  3W99 B;  3NQJ A;  1KX3 B;  2ARO B;  5AVC C;  4KHA A;  3NQU B;  5CPI A;  1KX5 D;  4KUD C;  3B6G D;  3AZK A;  5BNX A;  4WNN A;  4H9S C;  3X1T C;  3V9R B;  3VH6 W;  1M18 B;  3AV1 B;  5GT0 A;  1KX4 B;  3W99 D;  1KX3 D;  1ID3 C;  4H9N A;  4NE3 A;  2ARO D;  4ZBJ B;  3KXB B;  2RVQ C;  4J8W B;  1ZLA B;  5B40 B;  4NE6 A;  1M18 D;  3AV1 D;  1P3B A;  1P3P C;  2IO5 C;  1KX4 D;  1KU5 A;  4AWL B;  3A6N D;  1P3I C;  3KXB D;  1TAF B;  4J8W D;  1P3M A;  3W98 C;  1ZLA D;  1P3F C;  5B40 D;  3X1U B;  3LJA C;  3MNN C;  5BNV B;  3REI A;  2CV5 A;  4H9R B;  3UTB A;  3WTP A;  4YS3 A;  2NZD B;  5B0Z B;  3X1U D;  3UT9 C;  5AV8 C;  1U35 A;  1P3A B;  1P3O D;  5E5A B;  4Z2M G;  2FJ7 A;  3AFA B;  1TZY B;  2NZD D;  5B0Z D;  4G91 B;  1JFI B;  5AVC A;  3TU4 B;  3AZM C;  4KUD A;  1P3A D;  5GSU C;  4CAY A;  1P3G B;  3REJ A;  5GT3 B;  5JRG D;  4LD9 B;  3AV2 B;  3AFA D;  1TZY D;  3REH C;  1ID3 A;  4E45 A;  3AZJ C;  3TU4 D;  1P3L C;  1EQZ C;  4Z5T B;  3AZF C;  5B1M B;  1HQ3 B;  3REL C;  1P3G D;  5DNN B;  5GT3 D;  4LD9 D;  3W97 B;  3AV2 D;  1P3P A;  3VH6 A;  5AV9 B;  5GXQ B;  5JA4 B;  1P3I A;  4Z5T D;  5B1M D;  3W98 A;  1P3F A;  1HQ3 D;  2BYM B;  4YM6 C;  5DNN D;  4CSR B;  5B2I B;  3W97 D;  3LJA A;  3NQJ B;  5B32 C;  2LY8 A;  3MNN A;  4XUJ C;  5AV9 D;  4KHA B;  5CPI B;  5GXQ D;  4DRA A;  1N1J A;  4J8X A;  3AZK B;  3MGQ C;  5BNX B;  4WNN B;  2JSS A;  4Z66 B;  5GT0 B;  5B2I D;  5AV8 A;  3UT9 A;  4WU8 C;  4H9N B;  5CPI D;  2F8N G;  3AZH C;  5DNM C;  3AZK D;  5B0Y C;  4HGA B;  4NE5 A;  1P3B B;  5GT0 D;  3KWQ A;  3X1V B;  3B0C W;  3AZM A;  5C3I B;  3VH6 T;  1BH9 A;  3LZ0 C;  3REH A;  1P3B D;  5B1L C;  3X1V D;  4H9P A;  5B31 C;  3MVD C;  1P3L A;  4UUZ B;  1EQZ A;  3B0D B;  3REI B;  2CV5 B;  5B32 G;  3UTB B;  3WTP B;  3WAA A;  3REL A;  1H3O A;  3AZI C;  4YS3 B;  3AZL C;  4ZUX C;  1AOI A;  4WV4 B;  1U35 B;  3REI D;  2CV5 D;  5B24 C;  3UTB D;  3WTP D;  4G92 B;  3W96 C;  4YS3 D;  1B67 A;  5AY8 A;  3MGR C;  2FJ7 B;  5B32 A;  4XUJ A;  4JJN C;  5AVC B;  5BT1 C;  4KUD B;  1U35 D;  3MGQ A;  5B33 A;  4CAY B;  1M1A C;  4X23 C;  3REJ B;  5CP6 C;  5F99 C;  4WU8 A;  4WU9 C;  2FJ7 D;  3WKJ A;  1ID3 B;  2BYK A;  4J8V C;  5AVC D;  3AZH A;  4KUD D;  1P34 C;  5DNM A;  5B0Y A;  3REJ D;  2F8N K;  1P3P B;  2IO5 B;  2PYO C;  4M6B A;  3A6N B;  1ID3 D;  3AZE C;  3AN2 B;  1P3I B;  2RVQ D;  3MGS C;  3W98 B;  3LZ0 A;  1P3F B;  3C1B A;  3LJA B;  5B1L A;  1P3P D;  3MNN B;  5B31 A;  3MVD A;  3B6G C;  3AN2 D; 
#chains in the Genus database with same CATH topology
 1P3I D;  1N1J B;  4J8X B;  3AZI A;  1Q9C A;  3W98 D;  3W99 C;  3AZL A;  3R45 A;  1P3F D;  1KX3 C;  3UT9 B;  5AV8 B;  3LJA D;  2F8N H;  3MNN D;  1P3O B;  5B24 A;  4J8X D;  1M18 C;  3W96 A;  4DQY B;  3MGR A;  3C1C A;  3UT9 D;  5AV8 D;  4JJN A;  3KWQ B;  2HIO A;  4ZBJ C;  5JRG B;  3B6F C;  1ZLA C;  1M1A A;  5B40 C;  3AZG C;  1BH9 B;  5CP6 A;  2F8N B;  5F99 A;  3REH B;  4AWL C;  2XD1 A;  3KWQ D;  4H9P B;  2Y2O A;  1P3L B;  3X1T A;  1EQZ B;  4H9S A;  4KGC C;  3WAA B;  3REL B;  1H3O B;  3B0B A;  2F8N D;  3AZN B;  1M19 C;  2PYO A;  3B0C T;  2Y2Q A;  3REH D;  3AZE A;  1AOI B;  1P3L D;  1EQZ D;  3MGS A;  3WAA D;  3H0M C;  3REL D;  2CWE A;  5AV5 C;  5AY8 B;  3AZN D;  4H9O A;  5B32 B;  3MGP C;  4XUJ B;  1AOI D;  3B6G A;  2ZY5 A;  4XZQ C;  4QLC C;  3MGQ B;  5B33 B;  5E5A C;  5BO0 A;  3X1S B;  5FUG A;  1TZY C;  1B6W A;  4G91 C;  4WU8 B;  5AY8 D;  3WKJ B;  1F1E A;  2BYK B;  5B32 D;  4XUJ D;  3WA9 C;  4NFT A;  3AYW C;  1P3G C;  3V9R A;  5GT3 C;  3MGQ D;  5B33 D;  3X1S D;  3LEL C;  5B0Y B;  5AV6 C;  4WU8 D;  1S32 C;  3WKJ D;  4Z5T C;  3B6F A;  3KUY C;  3AZG A;  2Y2L A;  1T3U A;  5DNM D;  3LZ0 B;  5B0Y D;  3C1B B;  4H9Q A;  3KSY A;  5B1L B;  4EO5 C;  1BH8 A;  3MVD B;  5GSU A;  4KGC A;  1P3M B;  3AZI B;  5B2I C;  3AZJ A;  3LZ0 D;  3AZL B;  3R45 B;  1M19 A;  3C1B D;  5CPI C;  5B1L D;  3AZF A;  3MVD D;  2NQB C;  3VH5 T;  4E44 A;  5B24 B;  3O62 C;  5CPK C;  1P3M D;  5AVB C;  3REK C;  3AZI D;  1F66 C;  4Z66 C;  5GT0 C;  2HUE C;  5AV5 A;  3W96 B;  3MGR B;  3C1C B;  3AZL D;  3MGP A;  5CHL B;  4R8P C;  4JJN B;  1P3K C;  1W2E A;  2HIO B;  4XZQ A;  4QLC A;  4Z2M H;  4YM6 A;  5E5A A;  5B24 D;  1M1A B;  1TZY A;  5CP6 B;  3W96 D;  1P3B C;  3MGR D;  3X1V C;  3C1C D;  4WJ3 C;  5C3I C;  4JJN D;  5BT1 D;  2Y2N A;  3WA9 A;  2HIO D;  3X1T B;  3AYW A;  1ULY A;  5GT3 A;  3LEL A;  1M1A D;  3UTA C;  5CP6 D;  5AV6 A;  3LZ1 C;  5F99 D;  2PYO B;  1S32 A;  2UWX A;  4Z5T A;  3X1T D;  5B31 G;  3WTP C;  5G49 A;  3KUY A;  4J8U C;  3MGS B;  5CPJ C;  4H9O B;  5JA4 A;  2PYO D;  5B2J C;  3VH5 W;  5BO0 B;  3MGS D;  4CSR A;  5FUG B;  1KX5 C;  2Y2H A;  2NQB A;  3O62 A;  5CPK A;  5KDM A;  5AVB A;  3REJ C;  3REK A;  1F66 A;  4DRB A;  4ZUX A;  4Z66 A;  2ARO C;  3AL0 C;  4R8P A;  1P3K A;  2VQR A;  3B6F B;  3AV1 C;  3AZG B;  2ZM5 A;  1KX4 C;  2ZY4 A;  2F2A C;  2YFV A;  3X1V A;  3A6N C;  4H9Q B;  3AZM B;  1WWI A;  3KXB C;  1BH8 B;  3AN2 C;  4J8W C;  5GSU B;  2Y2K A;  4X23 A;  4KGC B;  3B6F D;  4WU9 A;  3UTA A;  3AZG D;  3LZ1 A;  3AZJ B;  4J8V A;  3WTP E;  1M19 B;  3AZM D;  4UUZ A;  1P34 A;  3F6T A;  3AZF B;  4J8X C;  5GSU D;  4J8U A;  4KGC D;  3X1U C;  5BS7 C;  5CPJ A;  5AV5 B;  3AZJ D;  1R4V A;  1M19 D;  5B2J A;  3MGP B;  1P3O C;  1PZR A;  3AZF D;  4XZQ B;  4QLC B;  1A7W A;  2NZD C;  5B0Z C;  4YM6 B;  1KX5 A;  3EPJ A;  5AV5 D;  3KWQ C;  1P3A C;  3MGP D;  2YFW A;  3WA9 B;  5JRG C;  3AYW B;  4XZQ D;  1HTA A;  4QLC D;  3AFA C;  3W99 A;  1KX3 A;  4YM6 D;  3VH5 A;  5E5A D;  3LEL B;  2ARO A;  3NQU A;  3TU4 C;  5AV6 B;  1S32 B;  3AZH B;  2L5A A;  3WA9 D;  5DNM B;  1M18 A;  4LD9 C;  3AV1 A;  3AYW D;  3WAA C;  5G49 B;  3KUY B;  3AV2 C;  1BFM A;  1KX4 A;  3LEL D;  3AZN C;  2JE5 A;  3A6N A;  5AV6 D;  3KXB A;  1AOI C;  4EO5 B;  3AN2 A;  1S32 D;  4J8W A;  3AZH D;  5B1M C;  1ZLA A;  1HQ3 C;  5B40 A;  5DNN C;  3W97 C;  3KUY D;  3H0L C;  5AY8 C;  5AV9 C;  5GXQ C;  5B31 B;  1TAF A;  2NQB B;  3X1U A;  5B33 C;  3X1S C;  3EPH A;  3O62 B;  5CPK B;  5BS7 A;  5KDM B;  5AVB B;  3REK B;  1F66 B;  4ZUX B;  2HUE B;  3EG5 B;  3WKJ C;  5BNV A;  1WWS A;  5B31 D;  4H9R A;  4R8P B;  1P3O A;  1P3K B;  3AZK C;  2NQB D;  2NZD A;  5B0Z A;  3O62 D;  5CPK D;  5AVB D;  3REK D;  1F66 D;  4ZUX D;  4Z66 D;  2YFV B;  1P3A A;  4R8P D;  1P3K D;  5JRG A;  4HGA C;  4X23 B;  3AFA A;  2F8N A;  5F99 B;  4WU9 B;  2G5H C;  3UTA B;  1JFI A;  3C1B C;  3LZ1 B;  3A1I A;  3TU4 A;  4J8V B;  1P34 B;  1P3G A;  4LD9 A;  1P3M C;  3AV2 A;  4J8U B;  4X23 D;  3AZN A;  4WU9 D;  3UTA D;  5CPJ B;  3LZ1 D;  3KFU G;  3AZE B;  4J8V D;  3B0D C;  5B2J B;  3REI C;  2CV5 C;  3UTB C;  5B1M A;  1P34 D;  1HQ3 A;  4YS3 C;  2DF4 C;  5DNN A;  3W97 A;  4J8U D;  5AV9 A;  3C1C C;  5GXQ A;  1KX5 B;  4WZS B;  5CPJ D;  3AZE D;  3B6G B;  2FFF B;  1U35 C;  2HIO C;  5B2J D;  2YFW B;  4G92 C;  2BYM A;  3X1S A;  3EPL A;  5B2I A;  2RIQ A;  2FJ7 C;  2Y2G A;  3NQJ A;  1KX3 B;  3W99 B;  2ARO B;  4KHA A;  5AVC C;  3NQU B;  5CPI A;  1KX5 D;  4KUD C;  3EPK A;  3A1K A;  3B6G D;  3AZK A;  2Y2I A;  4WNN A;  4H9S C;  5BNX A;  3X1T C;  3V9R B;  3VH6 W;  1M18 B;  3AV1 B;  5GT0 A;  1KX4 B;  3W99 D;  1KX3 D;  1ID3 C;  4H9N A;  4NE3 A;  2ARO D;  4ZBJ B;  3KXB B;  2RVQ C;  4J8W B;  1ZLA B;  5B40 B;  4NE6 A;  1M18 D;  3AV1 D;  1P3B A;  1P3P C;  2IO5 C;  1KX4 D;  1KU5 A;  2ZY2 A;  4AWL B;  2G5I C;  3A6N D;  1P3I C;  3KXB D;  1TAF B;  4J8W D;  1P3M A;  3W98 C;  1ZLA D;  1P3F C;  5B40 D;  3IP4 C;  3X1U B;  3LJA C;  3P5J B;  3MNN C;  5BNV B;  3REI A;  2CV5 A;  4H9R B;  3UTB A;  2ZY3 A;  3WTP A;  4YS3 A;  2NZD B;  5B0Z B;  3X1U D;  3UT9 C;  5AV8 C;  2Y2M A;  1U35 A;  2J8P A;  1P3A B;  1P3O D;  5E5A B;  4Z2M G;  2FJ7 A;  3AFA B;  1TZY B;  2NZD D;  5B0Z D;  4G91 B;  1JFI B;  5AVC A;  3TU4 B;  2W8S A;  3AZM C;  4KUD A;  1P3A D;  5GSU C;  4CAY A;  1P3G B;  3REJ A;  5GT3 B;  5JRG D;  4LD9 B;  3AV2 B;  2Y2P A;  1TZY D;  3AFA D;  3REH C;  1ID3 A;  4E45 A;  3AZJ C;  3TU4 D;  1P3L C;  1EQZ C;  4Z5T B;  3AZF C;  5B1M B;  1Z2C B;  4UPK A;  1HQ3 B;  3REL C;  1P3G D;  5DNN B;  5GT3 D;  4LD9 D;  3W97 B;  3AV2 D;  1P3P A;  3VH6 A;  5AV9 B;  5GXQ B;  5JA4 B;  1P3I A;  4Z5T D;  3FDD A;  3H0R C;  5B1M D;  3W98 A;  1P3F A;  1HQ3 D;  2BYM B;  4YM6 C;  5DNN D;  4CSR B;  5B2I B;  3W97 D;  3LJA A;  3NQJ B;  5B32 C;  2LY8 A;  3MNN A;  4XUJ C;  5AV9 D;  4KHA B;  5CPI B;  5GXQ D;  4DRA A;  1N1J A;  4J8X A;  3AZK B;  3MGQ C;  5BNX B;  4WNN B;  2JSS A;  4Z66 B;  5GT0 B;  5B2I D;  5AV8 A;  3UT9 A;  4WU8 C;  4H9N B;  5CPI D;  2F8N G;  3AZH C;  5DNM C;  3AZK D;  2DQN C;  5B0Y C;  4HGA B;  4NE5 A;  1P3B B;  5GT0 D;  3KWQ A;  3X1V B;  3B0C W;  3AZM A;  5C3I B;  2Y2J A;  3VH6 T;  1BH9 A;  3LZ0 C;  3REH A;  1P3B D;  5B1L C;  3X1V D;  4H9P A;  5B31 C;  3MVD C;  1P3L A;  4UUZ B;  1EQZ A;  3B0D B;  3REI B;  2CV5 B;  5B32 G;  3UTB B;  3WTP B;  3WAA A;  3REL A;  1H3O A;  3AZI C;  4YS3 B;  3AZL C;  4ZUX C;  1AOI A;  4WV4 B;  1U35 B;  3REI D;  2CV5 D;  5B24 C;  3UTB D;  3WTP D;  2JCH A;  4G92 B;  3W96 C;  4YS3 D;  1B67 A;  5AY8 A;  3MGR C;  2FJ7 B;  5B32 A;  4XUJ A;  4JJN C;  5AVC B;  5BT1 C;  4KUD B;  1U35 D;  3MGQ A;  5B33 A;  4CAY B;  1M1A C;  4X23 C;  3REJ B;  5CP6 C;  2BG1 A;  5F99 C;  4WU8 A;  4WU9 C;  2FJ7 D;  3WKJ A;  1ID3 B;  2BYK A;  4J8V C;  5AVC D;  3AZH A;  4KUD D;  1P34 C;  5DNM A;  5B0Y A;  3REJ D;  2F8N K;  1P3P B;  2IO5 B;  2XD5 A;  2PYO C;  4M6B A;  3A6N B;  1ID3 D;  3AZE C;  3AN2 B;  1P3I B;  2RVQ D;  3MGS C;  3W98 B;  3LZ0 A;  1P3F B;  3C1B A;  3LJA B;  5B1L A;  1P3P D;  3MNN B;  5B31 A;  3MVD A;  3B6G C;  3AN2 D; 
#chains in the Genus database with same CATH homology
 1P3I D;  1N1J B;  4J8X B;  3AZI A;  1Q9C A;  3W98 D;  3W99 C;  3AZL A;  3R45 A;  1P3F D;  1KX3 C;  3UT9 B;  5AV8 B;  3LJA D;  2F8N H;  3MNN D;  1P3O B;  5B24 A;  4J8X D;  1M18 C;  3W96 A;  4DQY B;  3MGR A;  3C1C A;  3UT9 D;  5AV8 D;  4JJN A;  3KWQ B;  2HIO A;  4ZBJ C;  5JRG B;  3B6F C;  1ZLA C;  1M1A A;  5B40 C;  3AZG C;  1BH9 B;  5CP6 A;  2F8N B;  5F99 A;  3REH B;  4AWL C;  2XD1 A;  3KWQ D;  4H9P B;  2Y2O A;  1P3L B;  3X1T A;  1EQZ B;  4H9S A;  4KGC C;  3WAA B;  3REL B;  1H3O B;  3B0B A;  2F8N D;  3AZN B;  1M19 C;  2PYO A;  3B0C T;  2Y2Q A;  3REH D;  3AZE A;  1AOI B;  1P3L D;  1EQZ D;  3MGS A;  3WAA D;  3H0M C;  3REL D;  2CWE A;  5AV5 C;  5AY8 B;  3AZN D;  4H9O A;  5B32 B;  3MGP C;  4XUJ B;  1AOI D;  3B6G A;  2ZY5 A;  4XZQ C;  4QLC C;  3MGQ B;  5B33 B;  5E5A C;  5BO0 A;  3X1S B;  5FUG A;  1TZY C;  1B6W A;  4G91 C;  4WU8 B;  5AY8 D;  3WKJ B;  1F1E A;  2BYK B;  5B32 D;  4XUJ D;  3WA9 C;  4NFT A;  3AYW C;  1P3G C;  3V9R A;  5GT3 C;  3MGQ D;  5B33 D;  3X1S D;  3LEL C;  5B0Y B;  5AV6 C;  4WU8 D;  1S32 C;  3WKJ D;  4Z5T C;  3B6F A;  3KUY C;  3AZG A;  2Y2L A;  1T3U A;  5DNM D;  3LZ0 B;  5B0Y D;  3C1B B;  4H9Q A;  3KSY A;  5B1L B;  4EO5 C;  1BH8 A;  3MVD B;  5GSU A;  4KGC A;  1P3M B;  3AZI B;  5B2I C;  3AZJ A;  3LZ0 D;  3AZL B;  3R45 B;  1M19 A;  3C1B D;  5CPI C;  5B1L D;  3AZF A;  3MVD D;  2NQB C;  3VH5 T;  4E44 A;  5B24 B;  3O62 C;  5CPK C;  1P3M D;  5AVB C;  3REK C;  3AZI D;  1F66 C;  4Z66 C;  5GT0 C;  2HUE C;  5AV5 A;  3W96 B;  3MGR B;  3C1C B;  3AZL D;  3MGP A;  5CHL B;  4R8P C;  4JJN B;  1P3K C;  1W2E A;  2HIO B;  4XZQ A;  4QLC A;  4Z2M H;  4YM6 A;  5E5A A;  5B24 D;  1M1A B;  1TZY A;  5CP6 B;  3W96 D;  1P3B C;  3MGR D;  3X1V C;  3C1C D;  4WJ3 C;  5C3I C;  4JJN D;  5BT1 D;  2Y2N A;  3WA9 A;  2HIO D;  3X1T B;  3AYW A;  1ULY A;  5GT3 A;  3LEL A;  1M1A D;  3UTA C;  5CP6 D;  5AV6 A;  3LZ1 C;  5F99 D;  2PYO B;  1S32 A;  2UWX A;  4Z5T A;  3X1T D;  5B31 G;  3WTP C;  5G49 A;  3KUY A;  4J8U C;  3MGS B;  5CPJ C;  4H9O B;  5JA4 A;  2PYO D;  5B2J C;  3VH5 W;  5BO0 B;  3MGS D;  4CSR A;  5FUG B;  1KX5 C;  2Y2H A;  2NQB A;  3O62 A;  5CPK A;  5KDM A;  5AVB A;  3REJ C;  3REK A;  1F66 A;  4DRB A;  4ZUX A;  4Z66 A;  2ARO C;  3AL0 C;  4R8P A;  1P3K A;  2VQR A;  3B6F B;  3AV1 C;  3AZG B;  2ZM5 A;  1KX4 C;  2ZY4 A;  2F2A C;  2YFV A;  3X1V A;  3A6N C;  4H9Q B;  3AZM B;  1WWI A;  3KXB C;  1BH8 B;  3AN2 C;  4J8W C;  5GSU B;  2Y2K A;  4X23 A;  4KGC B;  3B6F D;  4WU9 A;  3UTA A;  3AZG D;  3LZ1 A;  3AZJ B;  4J8V A;  3WTP E;  1M19 B;  3AZM D;  4UUZ A;  1P34 A;  3F6T A;  3AZF B;  4J8X C;  5GSU D;  4J8U A;  4KGC D;  3X1U C;  5BS7 C;  5CPJ A;  5AV5 B;  3AZJ D;  1R4V A;  1M19 D;  5B2J A;  3MGP B;  1P3O C;  1PZR A;  3AZF D;  4XZQ B;  4QLC B;  1A7W A;  2NZD C;  5B0Z C;  4YM6 B;  1KX5 A;  3EPJ A;  5AV5 D;  3KWQ C;  1P3A C;  3MGP D;  2YFW A;  3WA9 B;  5JRG C;  3AYW B;  4XZQ D;  1HTA A;  4QLC D;  3AFA C;  3W99 A;  1KX3 A;  4YM6 D;  3VH5 A;  5E5A D;  3LEL B;  2ARO A;  3NQU A;  3TU4 C;  5AV6 B;  1S32 B;  3AZH B;  2L5A A;  3WA9 D;  5DNM B;  1M18 A;  4LD9 C;  3AV1 A;  3AYW D;  3WAA C;  5G49 B;  3KUY B;  3AV2 C;  1BFM A;  1KX4 A;  3LEL D;  3AZN C;  2JE5 A;  3A6N A;  5AV6 D;  3KXB A;  1AOI C;  4EO5 B;  3AN2 A;  1S32 D;  4J8W A;  3AZH D;  5B1M C;  1ZLA A;  1HQ3 C;  5B40 A;  5DNN C;  3W97 C;  3KUY D;  3H0L C;  5AY8 C;  5AV9 C;  5GXQ C;  5B31 B;  1TAF A;  2NQB B;  3X1U A;  5B33 C;  3X1S C;  3EPH A;  3O62 B;  5CPK B;  5BS7 A;  5KDM B;  5AVB B;  3REK B;  1F66 B;  4ZUX B;  2HUE B;  3EG5 B;  3WKJ C;  5BNV A;  1WWS A;  5B31 D;  4H9R A;  4R8P B;  1P3O A;  1P3K B;  3AZK C;  2NQB D;  2NZD A;  5B0Z A;  3O62 D;  5CPK D;  5AVB D;  3REK D;  1F66 D;  4ZUX D;  4Z66 D;  2YFV B;  1P3A A;  4R8P D;  1P3K D;  5JRG A;  4HGA C;  4X23 B;  3AFA A;  2F8N A;  5F99 B;  4WU9 B;  2G5H C;  3UTA B;  1JFI A;  3C1B C;  3LZ1 B;  3A1I A;  3TU4 A;  4J8V B;  1P34 B;  1P3G A;  4LD9 A;  1P3M C;  3AV2 A;  4J8U B;  4X23 D;  3AZN A;  4WU9 D;  3UTA D;  5CPJ B;  3LZ1 D;  3KFU G;  3AZE B;  4J8V D;  3B0D C;  5B2J B;  3REI C;  2CV5 C;  3UTB C;  5B1M A;  1P34 D;  1HQ3 A;  4YS3 C;  2DF4 C;  5DNN A;  3W97 A;  4J8U D;  5AV9 A;  3C1C C;  5GXQ A;  1KX5 B;  4WZS B;  5CPJ D;  3AZE D;  3B6G B;  2FFF B;  1U35 C;  2HIO C;  5B2J D;  2YFW B;  4G92 C;  2BYM A;  3X1S A;  3EPL A;  5B2I A;  2RIQ A;  2FJ7 C;  2Y2G A;  3NQJ A;  1KX3 B;  3W99 B;  2ARO B;  4KHA A;  5AVC C;  3NQU B;  5CPI A;  1KX5 D;  4KUD C;  3EPK A;  3A1K A;  3B6G D;  3AZK A;  2Y2I A;  4WNN A;  4H9S C;  5BNX A;  3X1T C;  3V9R B;  3VH6 W;  1M18 B;  3AV1 B;  5GT0 A;  1KX4 B;  3W99 D;  1KX3 D;  1ID3 C;  4H9N A;  4NE3 A;  2ARO D;  4ZBJ B;  3KXB B;  2RVQ C;  4J8W B;  1ZLA B;  5B40 B;  4NE6 A;  1M18 D;  3AV1 D;  1P3B A;  1P3P C;  2IO5 C;  1KX4 D;  1KU5 A;  2ZY2 A;  4AWL B;  2G5I C;  3A6N D;  1P3I C;  3KXB D;  1TAF B;  4J8W D;  1P3M A;  3W98 C;  1ZLA D;  1P3F C;  5B40 D;  3IP4 C;  3X1U B;  3LJA C;  3P5J B;  3MNN C;  5BNV B;  3REI A;  2CV5 A;  4H9R B;  3UTB A;  2ZY3 A;  3WTP A;  4YS3 A;  2NZD B;  5B0Z B;  3X1U D;  3UT9 C;  5AV8 C;  2Y2M A;  1U35 A;  2J8P A;  1P3A B;  1P3O D;  5E5A B;  4Z2M G;  2FJ7 A;  3AFA B;  1TZY B;  2NZD D;  5B0Z D;  4G91 B;  1JFI B;  5AVC A;  3TU4 B;  2W8S A;  3AZM C;  4KUD A;  1P3A D;  5GSU C;  4CAY A;  1P3G B;  3REJ A;  5GT3 B;  5JRG D;  4LD9 B;  3AV2 B;  2Y2P A;  1TZY D;  3AFA D;  3REH C;  1ID3 A;  4E45 A;  3AZJ C;  3TU4 D;  1P3L C;  1EQZ C;  4Z5T B;  3AZF C;  5B1M B;  1Z2C B;  4UPK A;  1HQ3 B;  3REL C;  1P3G D;  5DNN B;  5GT3 D;  4LD9 D;  3W97 B;  3AV2 D;  1P3P A;  3VH6 A;  5AV9 B;  5GXQ B;  5JA4 B;  1P3I A;  4Z5T D;  3FDD A;  3H0R C;  5B1M D;  3W98 A;  1P3F A;  1HQ3 D;  2BYM B;  4YM6 C;  5DNN D;  4CSR B;  5B2I B;  3W97 D;  3LJA A;  3NQJ B;  5B32 C;  2LY8 A;  3MNN A;  4XUJ C;  5AV9 D;  4KHA B;  5CPI B;  5GXQ D;  4DRA A;  1N1J A;  4J8X A;  3AZK B;  3MGQ C;  5BNX B;  4WNN B;  2JSS A;  4Z66 B;  5GT0 B;  5B2I D;  5AV8 A;  3UT9 A;  4WU8 C;  4H9N B;  5CPI D;  2F8N G;  3AZH C;  5DNM C;  3AZK D;  2DQN C;  5B0Y C;  4HGA B;  4NE5 A;  1P3B B;  5GT0 D;  3KWQ A;  3X1V B;  3B0C W;  3AZM A;  5C3I B;  2Y2J A;  3VH6 T;  1BH9 A;  3LZ0 C;  3REH A;  1P3B D;  5B1L C;  3X1V D;  4H9P A;  5B31 C;  3MVD C;  1P3L A;  4UUZ B;  1EQZ A;  3B0D B;  3REI B;  2CV5 B;  5B32 G;  3UTB B;  3WTP B;  3WAA A;  3REL A;  1H3O A;  3AZI C;  4YS3 B;  3AZL C;  4ZUX C;  1AOI A;  4WV4 B;  1U35 B;  3REI D;  2CV5 D;  5B24 C;  3UTB D;  3WTP D;  2JCH A;  4G92 B;  3W96 C;  4YS3 D;  1B67 A;  5AY8 A;  3MGR C;  2FJ7 B;  5B32 A;  4XUJ A;  4JJN C;  5AVC B;  5BT1 C;  4KUD B;  1U35 D;  3MGQ A;  5B33 A;  4CAY B;  1M1A C;  4X23 C;  3REJ B;  5CP6 C;  2BG1 A;  5F99 C;  4WU8 A;  4WU9 C;  2FJ7 D;  3WKJ A;  1ID3 B;  2BYK A;  4J8V C;  5AVC D;  3AZH A;  4KUD D;  1P34 C;  5DNM A;  5B0Y A;  3REJ D;  2F8N K;  1P3P B;  2IO5 B;  2XD5 A;  2PYO C;  4M6B A;  3A6N B;  1ID3 D;  3AZE C;  3AN2 B;  1P3I B;  2RVQ D;  3MGS C;  3W98 B;  3LZ0 A;  1P3F B;  3C1B A;  3LJA B;  5B1L A;  1P3P D;  3MNN B;  5B31 A;  3MVD A;  3B6G C;  3AN2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...