1KX3C

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3C00
3MVDA 1M19B 5B0YA 3UT9C 3AZJD 3WTPD 3WKJB 3V9RB 5B1MD 5B32A 5DNMB 3MGRD 3AZLC 3LZ0C 3REID 3AN2B 1M1AC 2FJ7A 4Z66C 3RELB 1TAFA 3MVDD 5B0YD 1P3BB 3O62C 3B6GC 2L5AA 5JA4A 5B32D 5CPKC 1S32B 3KWQB 2FJ7D 5G49A 3X1UB 1P3FB 3WAAB 4XUJC 3AZEB 5AVBA 2NZDB 1BH8A 4ZUXA 3B6FB 3B0CW 3W99B 5GSUB 3AZLA 2NQBA 1M1AA 5AVBD 4Z66A 3AZID 4ZUXD 3TU4B 3O62A 3B6GA 2LY8A 3NQUB 5CPKA 4Z5TC 5JRGC 4NE3A 3AZLD 3REHC 1M1AD 4E45A 4Z66D 5AVCB 4XUJA 4X23C 1KX5B 3O62D 4R8PC 3B6GD 5C3IC 5CPKD 5FUGB 2YFVA 1BFMA 3WA9B 1M18C 3X1SC 4J8XA 4XUJD 2HIOA 5B2IB 4NE6A 1WWSA 1P3MC 1ZLAB 4H9PA 1P3KB 4ZBJB 1HTAA 3MNNC 5GXQB 4AWLC 4J8XD 5JRGA 5GT0B 2HIOD 1AOIC 3REHA 3REKC 5DNNC 2F8NG 3AZJB 5AV9C 5BT1C 5B1LB 5B1MB 3MGRB 3AZNB 3REIB 1EQZC 4UUZB 1A7WA 4NFTA 5JRGD 3REHD 5CPIC 1P3AB 4J8WC 1M18A 3X1SA 3KUYC 4WZSB 3VH5T 1B6WA 2IO5B 5AY8C 4YS3C 4R8PD 1F66B 2FJ7B 1TAFB 1P3MA 3MNNA 1M18D 3X1SD 3MGQA 5CP6C 5BNVA 1ID3A 3AZFB 1AOIA 1JFIB 5AV9A 1P3MD 4KUDA 5B0ZB 3W98B 5B40B 3MNND 4WU9B 3A6NB 1EQZA 5E5AC 5AVBB 4NE5A 3MGQD 1AOID 1KX3C 3W96B 5CPIA 4J8VB 5AV9D 5BT1D 4J8WA 1P3LA 3AV1C 3KUYA 2PYOC 3AZMC 1EQZD 2NQBB 4CAYB 3UTBC 2BYMB 4H9QA 2CV5B 3B0DC 3LZ1C 4Z2MH 5CPID 4J8WD 3C1CA 3KUYD 1H3OA 3AYWC 5CP6A 1U35C 5B2JC 3NQJA 5KDMB 5AV8B 3C1BC 2JSSA 5E5AA 3MGPC 3C1CD 4LD9B 5CP6D 5CPJC 3R45B 1P3PA 2AROB 5B31B 3AV1A 4J8XB 1TZYC 2HIOB 3LJAC 2PYOA 3AZMA 4XZQB 5E5AD 2BYKA 1P3IA 3UTBA 4G91B 1P3PD 4H9RA 3LZ1A 3X1VA 3LELC 3KXBC 4HGAB 1P3GC 3X1TC 4KHAA 3AYWA 3AV1D 5AV6C 2PYOD 1U35A 3AZMD 1P3ID 3UTBD 3C1BA 3KSYA 3VH6W 4JJNC 3LZ1D 3X1VD 1P34A 3AFAC 1P3OB 3MGPA 3REJB 3AYWD 3AZIA 4WU8C 5CPJA 3W97B 1U35D 3UT9A 2HUEC 3B0BA 3C1BD 1TZYA 4YM6C 1P34D 4QLCC 3LZ0A 3MGPD 3MGSC 3AZHC 5CPJD 3UT9D 3LELA 3X1TA 4H9SC 3MGQB 1TZYD 5BNVB 1ID3B 3LZ0D 5F99C 5GT3B 4KUDB 5BO0B 1HQ3C 1KX4C 5B33C 4JJNA 5BS7C 4EO5B 3LELD 1M19C 2YFWA 3AFAA 3X1TD 1N1JB 4J8UB 1BH9A 3AV2B 3WKJC 4WU8A 5AV6D 5AV5B 5DNMC 4WNNB 3AN2C 4G92B 4KGCB 3UTAB 1P3LB 3RELC 4JJND 4QLCA 1P3BC 3AFAD 1F1EA 3AZGB 5B24B 3MGSA 4WU8D 3AZKB 1S32C 3KWQC 4Z2MG 3C1CB 1H3OB 4H9NA 3X1UC 4Z5TA 1P3FC 3WAAC 4QLCD 3AZEC 5F99A 3WTPB 3MGSD 2NZDC 1HQ3A 1KX4A 5B33A 1ULYA 5BS7A 4X23A 3B6FC 4R8PA 5E5AB 3W99C 4Z5TD 5B32G 5GSUC 3MVDB 3VH6A 5F99D 5B0YB 3AN2A 1P3PB 3RELA 1HQ3D 5B32B 5B33D 1KX4D 4X23D 1P3BA 2BYKB 3TU4C 1P3IB 3B0DB 5DNMD 3X1VB 3AN2D 1S32A 3KWQA 3RELD 5BNXA 5JA4B 3X1UA 5AVCC 3WAAA 1P3BD 3REKA 5DNNA 1R4VA 1KX5C 5G49B 2F8NK 2NZDA 1S32D 1P34B 3B6FA 3KWQD 3AZIB 3X1UD 3W99A 1BH8B 4ZUXB 5GSUA 3WAAD 3REKD 3AZED 5DNND 3UT9B 5B2IC 1ZLAC 2NZDD 1P3KC 4ZBJC 3AZLB 3LZ0B 3B6FD 5AY8A 4YS3A 1M1AB 5GXQC 3TU4A 4Z66B 3W99D 3NQUA 5GSUD 5GT0C 3O62B 3B6GB 3AZJC 5B1LC 5CPKB 5AVCA 5B1MC 5AY8D 4YS3D 3MGRC 3REIC 3TU4D 3AZNC 5FUGA 1B67A 4XUJB 2YFWB 1P3AC 1BH9B 5B31G 5AVCD 2YFVB 1KX3A 2IO5C 5B2IA 1F66C 2FJ7C 1ZLAA 1P3KA 4H9PB 2F8NH 5GT0A 1KX3D 3AZFC 4CSRA 5B2ID 5B1LA 1ZLAD 4Z5TB 5B0ZC 5JRGB 3W98C 5B40C 1P3KD 5B2JA 3REHB 3AZNA 5GXQD 3A6NC 4WU9C 2F8NA 5AVBC 5GT0D 4X23B 4R8PB 3W96C 1P3AA 4J8VC 5C3IB 5B1LD 5B2JD 3AZND 2F8ND 2NQBC 1M18B 1F66A 3X1SB 3LJAA 2CV5C 1P3AD 1P3MB 3MNNB 3AZFA 3KXBA 1F66D 1P3GA 5BNXB 4AWLB 4H9OA 5AV8C 5B0ZA 5AV6A 3VH5W 5B40A 3LJAD 3W98A 1AOIB 3REKB 5DNNB 4WU9A 3A6NA 5AV9B 2RVQC 4LD9C 4E44A 3AZFD 1EQZB 3KXBD 3W96A 1P3GD 2AROC 4J8VA 5B31C 5B0ZD 4J8XC 3W98D 5B40D 2HIOC 4WU9D 3A6ND 4XZQC 5CPIB 4J8WB 3KUYB 4CAYA 2BYMA 4M6BA 4YM6A 4G91C 2CV5A 5AY8B 4YS3B 3W96D 4J8VD 4HGAC 3AZHA 4H9QB 2NQBD 5KDMA 4H9SA 5CP6B 5AV8A 4YM6D 2CV5D 3NQJB 1P3OC 3REJC 4LD9A 3AZHD 1JFIA 3W97C 3R45A 1M19A 2AROA 3WKJA 3V9RA 5B31A 5AV8D 5DNMA 1KX3B 4XZQA 2RVQD 4LD9D 3AV1B 1Q9CA 3WTPE 2PYOB 3VH6T 3AZMB 1M19D 2AROD 3WKJD 3UTBB 5B31D 3MGQC 4H9RB 3LZ1B 1ID3C 4CSRB 4XZQD 4KHAB 5GT3C 3AYWB 4KUDC 3B0CT 1U35B 1P3FA 5B2JB 3AZEA 4EO5C 2F8NB 1P3OA 3REJA 4J8UC 3AV2C 3C1BB 3W97A 5AV5C 3VH5A 3MGPB 3WA9C 4G92C 4KGCC 3UTAC 1P3LC 5CPJB 4DRBA 1P3FD 3AZGC 3REJD 1P3OD 5B24C 1TZYB 3W97D 3AZKC 3LJAB 3C1CC 1WWIA 3LELB 3KXBB 1P3GB 3X1TB 5CHLB 3WTPC 5GT3A 4H9OB 5BO0A 5AV6B 1KX5A 1N1JA 4J8UA 3AV2A 4JJNB 5AV5A 3MVDC 1ID3D 5B0YC 3AFAB 4WNNA 2CWEA 1P3PC 3WA9A 5GT3D 4WV4B 4KUDD 3UTAA 4KGCA 4WU8B 5B32C 1KX5D 3AZGA 2HUEB 4J8UD 3AV2D 1P3IC 5B24A 4YM6B 5AV5D 3AZKA 4QLCB 3X1VC 3WA9D 5GXQA 4KGCD 3UTAD 3MGSB 1P3LD 3AZHB 3AZGD 3AZJA 3WTPA 4H9NB 5B24D 1KU5A 3AZKD 5B1MA 5F99B 3MGRA 1P34C 3REIA 4UUZA 3AZIC 1HQ3B 1KX4B 5B33B 4ZUXC 4DRAA
chains in the Genus database with same CATH superfamily
3MVDA 1M19B 5B0YA 3UT9C 3AZJD 3WTPD 3WKJB 3H0MC 3V9RB 2RIQA 5B1MD 5B32A 5DNMB 3A1KA 3MGRD 3LZ0C 3REID 3AZLC 3AN2B 1M1AC 2FJ7A 4Z66C 3RELB 1TAFA 3MVDD 5B0YD 1P3BB 3O62C 3B6GC 2L5AA 5JA4A 5B32D 5CPKC 3AL0C 1S32B 3KWQB 2FJ7D 1PZRA 5G49A 3X1UB 4DQYB 1P3FB 3WAAB 4XUJC 3AZEB 1W2EA 5AVBA 2NZDB 1BH8A 4ZUXA 2Y2LA 3B6FB 3B0CW 2DQNC 3W99B 5GSUB 3AZLA 2Y2GA 2NQBA 1M1AA 5AVBD 4Z66A 3AZID 4ZUXD 3TU4B 2ZY5A 3O62A 3B6GA 2LY8A 3NQUB 5CPKA 4Z5TC 5JRGC 4NE3A 3AZLD 3FDDA 3REHC 1M1AD 4E45A 4Z66D 2FFFB 5AVCB 2JCHA 2Y2KA 4XUJA 4X23C 1KX5B 3O62D 4R8PC 3B6GD 5C3IC 5CPKD 5FUGB 2YFVA 1BFMA 3WA9B 1M18C 3X1SC 4J8XA 4XUJD 2HIOA 5B2IB 4NE6A 1WWSA 1P3MC 1ZLAB 3P5JB 4H9PA 1P3KB 4ZBJB 1HTAA 3MNNC 5GXQB 4AWLC 4J8XD 3IP4C 5JRGA 5GT0B 2HIOD 1AOIC 3REHA 3REKC 5DNNC 2F8NG 3AZJB 5AV9C 5BT1C 5B1LB 2Y2PA 5B1MB 3MGRB 3AZNB 3REIB 1EQZC 4UUZB 1A7WA 4NFTA 5JRGD 3REHD 5CPIC 1P3AB 4J8WC 1M18A 3X1SA 3KUYC 4WZSB 3VH5T 1B6WA 2IO5B 5AY8C 4YS3C 4R8PD 1F66B 2FJ7B 1TAFB 1P3MA 2JE5A 3MNNA 3EPJA 1M18D 3X1SD 3KFUG 3MGQA 5CP6C 5BNVA 1ID3A 3AZFB 1AOIA 1JFIB 5AV9A 1P3MD 4KUDA 5B0ZB 3W98B 5B40B 3MNND 4WU9B 3A6NB 1EQZA 5E5AC 5AVBB 4NE5A 3MGQD 1AOID 1KX3C 3W96B 5CPIA 3F6TA 4J8VB 5AV9D 5BT1D 4J8WA 1P3LA 3AV1C 3KUYA 2PYOC 3AZMC 1EQZD 2NQBB 4CAYB 3UTBC 2BYMB 4H9QA 2CV5B 3B0DC 3LZ1C 4Z2MH 5CPID 4J8WD 3C1CA 3KUYD 1H3OA 3AYWC 5CP6A 1U35C 5B2JC 3NQJA 5KDMB 5AV8B 3C1BC 2JSSA 5E5AA 3MGPC 3C1CD 4LD9B 4WJ3C 5CP6D 5CPJC 3R45B 1P3PA 2AROB 5B31B 3AV1A 4J8XB 1TZYC 2HIOB 2Y2OA 3LJAC 3AZMA 2PYOA 4XZQB 5E5AD 2BYKA 1P3IA 3UTBA 4G91B 1P3PD 4H9RA 3LZ1A 3X1VA 3LELC 3KXBC 4HGAB 1P3GC 3X1TC 4KHAA 3AYWA 3AV1D 5AV6C 2PYOD 1U35A 3AZMD 1P3ID 3UTBD 3C1BA 3KSYA 2J8PA 3VH6W 4JJNC 3LZ1D 3X1VD 1P34A 3AFAC 1P3OB 3MGPA 3REJB 3AYWD 3AZIA 4WU8C 5CPJA 3W97B 1U35D 3UT9A 2HUEC 3B0BA 3C1BD 1TZYA 4YM6C 3H0RC 1P34D 4QLCC 3LZ0A 3MGPD 3MGSC 3AZHC 5CPJD 3UT9D 3LELA 3X1TA 4H9SC 3MGQB 1TZYD 2Y2NA 5BNVB 1ID3B 3LZ0D 5F99C 5GT3B 4KUDB 1T3UA 5BO0B 1HQ3C 1KX4C 5B33C 4JJNA 5BS7C 4EO5B 3LELD 1M19C 2YFWA 3AFAA 3X1TD 1N1JB 4J8UB 1BH9A 3AV2B 3WKJC 4WU8A 5AV6D 2Y2JA 5AV5B 5DNMC 4WNNB 3AN2C 4G92B 4KGCB 3UTAB 1P3LB 3RELC 4JJND 4QLCA 1P3BC 3AFAD 1F1EA 3AZGB 5B24B 3MGSA 4WU8D 3AZKB 1S32C 2G5HC 3KWQC 4Z2MG 3C1CB 1H3OB 4H9NA 3X1UC 4Z5TA 1P3FC 3WAAC 2ZY4A 4QLCD 3AZEC 5F99A 3WTPB 3MGSD 2NZDC 1HQ3A 1KX4A 5B33A 1ULYA 5BS7A 4X23A 3B6FC 4R8PA 5E5AB 2Y2QA 3W99C 4Z5TD 5B32G 2F2AC 2XD5A 5GSUC 3MVDB 3VH6A 5F99D 5B0YB 3AN2A 1P3PB 2UWXA 3H0LC 3RELA 1HQ3D 5B32B 5B33D 1KX4D 4X23D 1P3BA 2BYKB 3TU4C 2ZY3A 2VQRA 1P3IB 3B0DB 5DNMD 3X1VB 3AN2D 1S32A 3KWQA 3RELD 5BNXA 5JA4B 3X1UA 5AVCC 3WAAA 1P3BD 3REKA 5DNNA 1R4VA 1KX5C 5G49B 2F8NK 2NZDA 2Y2MA 1S32D 1P34B 3B6FA 3KWQD 3AZIB 3X1UD 3W99A 1BH8B 4ZUXB 5GSUA 3WAAD 3REKD 3AZED 5DNND 3UT9B 5B2IC 3EG5B 1ZLAC 2NZDD 1P3KC 4ZBJC 3AZLB 3LZ0B 3B6FD 5AY8A 4YS3A 1M1AB 5GXQC 3TU4A 4Z66B 3EPHA 3W99D 3NQUA 5GSUD 5GT0C 3O62B 3B6GB 3AZJC 5B1LC 5CPKB 5AVCA 5B1MC 5AY8D 4YS3D 3MGRC 3REIC 3TU4D 3AZNC 5FUGA 1B67A 4XUJB 2YFWB 1P3AC 1BH9B 5B31G 5AVCD 2YFVB 1KX3A 2IO5C 5B2IA 1F66C 2FJ7C 1ZLAA 1P3KA 4UPKA 4H9PB 2F8NH 5GT0A 1KX3D 3AZFC 4CSRA 5B2ID 5B1LA 1ZLAD 2ZM5A 4Z5TB 5B0ZC 5JRGB 3W98C 5B40C 1Z2CB 5B2JA 1P3KD 3REHB 3AZNA 5GXQD 3A6NC 4WU9C 2F8NA 5AVBC 5GT0D 4X23B 4R8PB 3W96C 1P3AA 4J8VC 5C3IB 5B1LD 5B2JD 3AZND 2F8ND 2NQBC 1M18B 1F66A 3X1SB 3LJAA 2CV5C 1P3AD 1P3MB 3MNNB 3AZFA 3KXBA 1F66D 1P3GA 5BNXB 4AWLB 4H9OA 5B0ZA 5AV8C 5AV6A 3VH5W 5B40A 3LJAD 3W98A 1AOIB 3REKB 5DNNB 4WU9A 3A6NA 5AV9B 2RVQC 4LD9C 4E44A 3AZFD 1EQZB 3KXBD 3W96A 1P3GD 2AROC 4J8VA 5B31C 5B0ZD 4J8XC 3W98D 5B40D 2HIOC 4WU9D 3A6ND 4XZQC 5CPIB 4J8WB 3KUYB 4CAYA 2BYMA 4M6BA 4YM6A 4G91C 2CV5A 5AY8B 4YS3B 3W96D 4J8VD 4HGAC 3AZHA 4H9QB 3EPLA 2NQBD 5KDMA 4H9SA 5CP6B 5AV8A 4YM6D 2CV5D 2Y2HA 3NQJB 1P3OC 3REJC 4LD9A 3AZHD 1JFIA 3W97C 3R45A 1M19A 2AROA 3WKJA 3V9RA 5B31A 5AV8D 5DNMA 1KX3B 4XZQA 2RVQD 4LD9D 3AV1B 1Q9CA 3WTPE 2PYOB 3VH6T 3AZMB 1M19D 2AROD 3WKJD 3UTBB 5B31D 3MGQC 4H9RB 3LZ1B 1ID3C 4CSRB 4XZQD 2W8SA 2ZY2A 4KHAB 5GT3C 3AYWB 4KUDC 3B0CT 1U35B 1P3FA 5B2JB 3AZEA 4EO5C 2F8NB 1P3OA 3REJA 4J8UC 3EPKA 3AV2C 3C1BB 3W97A 2G5IC 5AV5C 3VH5A 3MGPB 3WA9C 4G92C 4KGCC 3UTAC 1P3LC 2BG1A 5CPJB 4DRBA 1P3FD 3AZGC 3REJD 1P3OD 3A1IA 5B24C 1TZYB 3W97D 3AZKC 3LJAB 3C1CC 1WWIA 3LELB 3KXBB 1P3GB 3X1TB 5CHLB 3WTPC 5GT3A 4H9OB 5BO0A 5AV6B 1KX5A 1N1JA 4J8UA 3AV2A 4JJNB 5AV5A 3MVDC 1ID3D 5B0YC 3AFAB 4WNNA 2CWEA 1P3PC 3WA9A 5GT3D 4WV4B 4KUDD 3UTAA 4KGCA 4WU8B 5B32C 1KX5D 3AZGA 2HUEB 4J8UD 2Y2IA 3AV2D 5B24A 1P3IC 4YM6B 5AV5D 3AZKA 4QLCB 3X1VC 3WA9D 5GXQA 4KGCD 3UTAD 3MGSB 1P3LD 3AZHB 2DF4C 2XD1A 3AZGD 3AZJA 3WTPA 4H9NB 5B24D 1KU5A 3AZKD 5B1MA 5F99B 3MGRA 1P34C 3REIA 4UUZA 3AZIC 1HQ3B 1KX4B 5B33B 4ZUXC 4DRAA
chains in the Genus database with same CATH topology
3MVDA 1M19B 5B0YA 3UT9C 3AZJD 3WTPD 3WKJB 3H0MC 3V9RB 2RIQA 5B1MD 5B32A 5DNMB 3A1KA 3MGRD 3LZ0C 3REID 3AZLC 3AN2B 1M1AC 2FJ7A 4Z66C 3RELB 1TAFA 3MVDD 5B0YD 1P3BB 3O62C 3B6GC 2L5AA 5JA4A 5B32D 5CPKC 3AL0C 1S32B 3KWQB 2FJ7D 1PZRA 5G49A 3X1UB 4DQYB 1P3FB 3WAAB 4XUJC 3AZEB 1W2EA 5AVBA 2NZDB 1BH8A 4ZUXA 2Y2LA 3B6FB 3B0CW 2DQNC 3W99B 5GSUB 3AZLA 2Y2GA 2NQBA 1M1AA 5AVBD 4Z66A 3AZID 4ZUXD 3TU4B 2ZY5A 3O62A 3B6GA 2LY8A 3NQUB 5CPKA 4Z5TC 5JRGC 4NE3A 3AZLD 3FDDA 3REHC 1M1AD 4E45A 4Z66D 2FFFB 5AVCB 2JCHA 2Y2KA 4XUJA 4X23C 1KX5B 3O62D 4R8PC 3B6GD 5C3IC 5CPKD 5FUGB 2YFVA 1BFMA 3WA9B 1M18C 3X1SC 4J8XA 4XUJD 2HIOA 5B2IB 4NE6A 1WWSA 1P3MC 1ZLAB 3P5JB 4H9PA 1P3KB 4ZBJB 1HTAA 3MNNC 5GXQB 4AWLC 4J8XD 3IP4C 5JRGA 5GT0B 2HIOD 1AOIC 3REHA 3REKC 5DNNC 2F8NG 3AZJB 5AV9C 5BT1C 5B1LB 2Y2PA 5B1MB 3MGRB 3AZNB 3REIB 1EQZC 4UUZB 1A7WA 4NFTA 5JRGD 3REHD 5CPIC 1P3AB 4J8WC 1M18A 3X1SA 3KUYC 4WZSB 3VH5T 1B6WA 2IO5B 5AY8C 4YS3C 4R8PD 1F66B 2FJ7B 1TAFB 1P3MA 2JE5A 3MNNA 3EPJA 1M18D 3X1SD 3KFUG 3MGQA 5CP6C 5BNVA 1ID3A 3AZFB 1AOIA 1JFIB 5AV9A 1P3MD 4KUDA 5B0ZB 3W98B 5B40B 3MNND 4WU9B 3A6NB 1EQZA 5E5AC 5AVBB 4NE5A 3MGQD 1AOID 1KX3C 3W96B 5CPIA 3F6TA 4J8VB 5AV9D 5BT1D 4J8WA 1P3LA 3AV1C 3KUYA 2PYOC 3AZMC 1EQZD 2NQBB 4CAYB 3UTBC 2BYMB 4H9QA 2CV5B 3B0DC 3LZ1C 4Z2MH 5CPID 4J8WD 3C1CA 3KUYD 1H3OA 3AYWC 5CP6A 1U35C 5B2JC 3NQJA 5KDMB 5AV8B 3C1BC 2JSSA 5E5AA 3MGPC 3C1CD 4LD9B 4WJ3C 5CP6D 5CPJC 3R45B 1P3PA 2AROB 5B31B 3AV1A 4J8XB 1TZYC 2HIOB 2Y2OA 3LJAC 3AZMA 2PYOA 4XZQB 5E5AD 2BYKA 1P3IA 3UTBA 4G91B 1P3PD 4H9RA 3LZ1A 3X1VA 3LELC 3KXBC 4HGAB 1P3GC 3X1TC 4KHAA 3AYWA 3AV1D 5AV6C 2PYOD 1U35A 3AZMD 1P3ID 3UTBD 3C1BA 3KSYA 2J8PA 3VH6W 4JJNC 3LZ1D 3X1VD 1P34A 3AFAC 1P3OB 3MGPA 3REJB 3AYWD 3AZIA 4WU8C 5CPJA 3W97B 1U35D 3UT9A 2HUEC 3B0BA 3C1BD 1TZYA 4YM6C 3H0RC 1P34D 4QLCC 3LZ0A 3MGPD 3MGSC 3AZHC 5CPJD 3UT9D 3LELA 3X1TA 4H9SC 3MGQB 1TZYD 2Y2NA 5BNVB 1ID3B 3LZ0D 5F99C 5GT3B 4KUDB 1T3UA 5BO0B 1HQ3C 1KX4C 5B33C 4JJNA 5BS7C 4EO5B 3LELD 1M19C 2YFWA 3AFAA 3X1TD 1N1JB 4J8UB 1BH9A 3AV2B 3WKJC 4WU8A 5AV6D 2Y2JA 5AV5B 5DNMC 4WNNB 3AN2C 4G92B 4KGCB 3UTAB 1P3LB 3RELC 4JJND 4QLCA 1P3BC 3AFAD 1F1EA 3AZGB 5B24B 3MGSA 4WU8D 3AZKB 1S32C 2G5HC 3KWQC 4Z2MG 3C1CB 1H3OB 4H9NA 3X1UC 4Z5TA 1P3FC 3WAAC 2ZY4A 4QLCD 3AZEC 5F99A 3WTPB 3MGSD 2NZDC 1HQ3A 1KX4A 5B33A 1ULYA 5BS7A 4X23A 3B6FC 4R8PA 5E5AB 2Y2QA 3W99C 4Z5TD 5B32G 2F2AC 2XD5A 5GSUC 3MVDB 3VH6A 5F99D 5B0YB 3AN2A 1P3PB 2UWXA 3H0LC 3RELA 1HQ3D 5B32B 5B33D 1KX4D 4X23D 1P3BA 2BYKB 3TU4C 2ZY3A 2VQRA 1P3IB 3B0DB 5DNMD 3X1VB 3AN2D 1S32A 3KWQA 3RELD 5BNXA 5JA4B 3X1UA 5AVCC 3WAAA 1P3BD 3REKA 5DNNA 1R4VA 1KX5C 5G49B 2F8NK 2NZDA 2Y2MA 1S32D 1P34B 3B6FA 3KWQD 3AZIB 3X1UD 3W99A 1BH8B 4ZUXB 5GSUA 3WAAD 3REKD 3AZED 5DNND 3UT9B 5B2IC 3EG5B 1ZLAC 2NZDD 1P3KC 4ZBJC 3AZLB 3LZ0B 3B6FD 5AY8A 4YS3A 1M1AB 5GXQC 3TU4A 4Z66B 3EPHA 3W99D 3NQUA 5GSUD 5GT0C 3O62B 3B6GB 3AZJC 5B1LC 5CPKB 5AVCA 5B1MC 5AY8D 4YS3D 3MGRC 3REIC 3TU4D 3AZNC 5FUGA 1B67A 4XUJB 2YFWB 1P3AC 1BH9B 5B31G 5AVCD 2YFVB 1KX3A 2IO5C 5B2IA 1F66C 2FJ7C 1ZLAA 1P3KA 4UPKA 4H9PB 2F8NH 5GT0A 1KX3D 3AZFC 4CSRA 5B2ID 5B1LA 1ZLAD 2ZM5A 4Z5TB 5B0ZC 5JRGB 3W98C 5B40C 1Z2CB 5B2JA 1P3KD 3REHB 3AZNA 5GXQD 3A6NC 4WU9C 2F8NA 5AVBC 5GT0D 4X23B 4R8PB 3W96C 1P3AA 4J8VC 5C3IB 5B1LD 5B2JD 3AZND 2F8ND 2NQBC 1M18B 1F66A 3X1SB 3LJAA 2CV5C 1P3AD 1P3MB 3MNNB 3AZFA 3KXBA 1F66D 1P3GA 5BNXB 4AWLB 4H9OA 5B0ZA 5AV8C 5AV6A 3VH5W 5B40A 3LJAD 3W98A 1AOIB 3REKB 5DNNB 4WU9A 3A6NA 5AV9B 2RVQC 4LD9C 4E44A 3AZFD 1EQZB 3KXBD 3W96A 1P3GD 2AROC 4J8VA 5B31C 5B0ZD 4J8XC 3W98D 5B40D 2HIOC 4WU9D 3A6ND 4XZQC 5CPIB 4J8WB 3KUYB 4CAYA 2BYMA 4M6BA 4YM6A 4G91C 2CV5A 5AY8B 4YS3B 3W96D 4J8VD 4HGAC 3AZHA 4H9QB 3EPLA 2NQBD 5KDMA 4H9SA 5CP6B 5AV8A 4YM6D 2CV5D 2Y2HA 3NQJB 1P3OC 3REJC 4LD9A 3AZHD 1JFIA 3W97C 3R45A 1M19A 2AROA 3WKJA 3V9RA 5B31A 5AV8D 5DNMA 1KX3B 4XZQA 2RVQD 4LD9D 3AV1B 1Q9CA 3WTPE 2PYOB 3VH6T 3AZMB 1M19D 2AROD 3WKJD 3UTBB 5B31D 3MGQC 4H9RB 3LZ1B 1ID3C 4CSRB 4XZQD 2W8SA 2ZY2A 4KHAB 5GT3C 3AYWB 4KUDC 3B0CT 1U35B 1P3FA 5B2JB 3AZEA 4EO5C 2F8NB 1P3OA 3REJA 4J8UC 3EPKA 3AV2C 3C1BB 3W97A 2G5IC 5AV5C 3VH5A 3MGPB 3WA9C 4G92C 4KGCC 3UTAC 1P3LC 2BG1A 5CPJB 4DRBA 1P3FD 3AZGC 3REJD 1P3OD 3A1IA 5B24C 1TZYB 3W97D 3AZKC 3LJAB 3C1CC 1WWIA 3LELB 3KXBB 1P3GB 3X1TB 5CHLB 3WTPC 5GT3A 4H9OB 5BO0A 5AV6B 1KX5A 1N1JA 4J8UA 3AV2A 4JJNB 5AV5A 3MVDC 1ID3D 5B0YC 3AFAB 4WNNA 2CWEA 1P3PC 3WA9A 5GT3D 4WV4B 4KUDD 3UTAA 4KGCA 4WU8B 5B32C 1KX5D 3AZGA 2HUEB 4J8UD 2Y2IA 3AV2D 5B24A 1P3IC 4YM6B 5AV5D 3AZKA 4QLCB 3X1VC 3WA9D 5GXQA 4KGCD 3UTAD 3MGSB 1P3LD 3AZHB 2DF4C 2XD1A 3AZGD 3AZJA 3WTPA 4H9NB 5B24D 1KU5A 3AZKD 5B1MA 5F99B 3MGRA 1P34C 3REIA 4UUZA 3AZIC 1HQ3B 1KX4B 5B33B 4ZUXC 4DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD A;  1M19 B;  5B0Y A;  3UT9 C;  3AZJ D;  3WTP D;  3WKJ B;  3V9R B;  5B1M D;  5B32 A;  5DNM B;  3MGR D;  3AZL C;  3LZ0 C;  3REI D;  3AN2 B;  1M1A C;  2FJ7 A;  4Z66 C;  3REL B;  1TAF A;  3MVD D;  5B0Y D;  1P3B B;  3O62 C;  3B6G C;  2L5A A;  5JA4 A;  5B32 D;  5CPK C;  1S32 B;  3KWQ B;  2FJ7 D;  5G49 A;  3X1U B;  1P3F B;  3WAA B;  4XUJ C;  3AZE B;  5AVB A;  2NZD B;  1BH8 A;  4ZUX A;  3B6F B;  3B0C W;  3W99 B;  5GSU B;  3AZL A;  2NQB A;  1M1A A;  5AVB D;  4Z66 A;  3AZI D;  4ZUX D;  3TU4 B;  3O62 A;  3B6G A;  2LY8 A;  3NQU B;  5CPK A;  4Z5T C;  5JRG C;  4NE3 A;  3AZL D;  3REH C;  1M1A D;  4E45 A;  4Z66 D;  5AVC B;  4XUJ A;  4X23 C;  1KX5 B;  3O62 D;  4R8P C;  3B6G D;  5C3I C;  5CPK D;  5FUG B;  2YFV A;  1BFM A;  3WA9 B;  1M18 C;  3X1S C;  4J8X A;  4XUJ D;  2HIO A;  5B2I B;  4NE6 A;  1WWS A;  1P3M C;  1ZLA B;  4H9P A;  1P3K B;  4ZBJ B;  1HTA A;  3MNN C;  5GXQ B;  4AWL C;  4J8X D;  5JRG A;  5GT0 B;  2HIO D;  1AOI C;  3REH A;  3REK C;  5DNN C;  2F8N G;  3AZJ B;  5AV9 C;  5BT1 C;  5B1L B;  5B1M B;  3MGR B;  3AZN B;  3REI B;  1EQZ C;  4UUZ B;  1A7W A;  4NFT A;  5JRG D;  3REH D;  5CPI C;  1P3A B;  4J8W C;  1M18 A;  3X1S A;  3KUY C;  4WZS B;  3VH5 T;  1B6W A;  2IO5 B;  5AY8 C;  4YS3 C;  4R8P D;  1F66 B;  2FJ7 B;  1TAF B;  1P3M A;  3MNN A;  1M18 D;  3X1S D;  3MGQ A;  5CP6 C;  5BNV A;  1ID3 A;  3AZF B;  1AOI A;  1JFI B;  5AV9 A;  1P3M D;  4KUD A;  5B0Z B;  3W98 B;  5B40 B;  3MNN D;  4WU9 B;  3A6N B;  1EQZ A;  5E5A C;  5AVB B;  4NE5 A;  3MGQ D;  1AOI D;  1KX3 C;  3W96 B;  5CPI A;  4J8V B;  5AV9 D;  5BT1 D;  4J8W A;  1P3L A;  3AV1 C;  3KUY A;  2PYO C;  3AZM C;  1EQZ D;  2NQB B;  4CAY B;  3UTB C;  2BYM B;  4H9Q A;  2CV5 B;  3B0D C;  3LZ1 C;  4Z2M H;  5CPI D;  4J8W D;  3C1C A;  3KUY D;  1H3O A;  3AYW C;  5CP6 A;  1U35 C;  5B2J C;  3NQJ A;  5KDM B;  5AV8 B;  3C1B C;  2JSS A;  5E5A A;  3MGP C;  3C1C D;  4LD9 B;  5CP6 D;  5CPJ C;  3R45 B;  1P3P A;  2ARO B;  5B31 B;  3AV1 A;  4J8X B;  1TZY C;  2HIO B;  3LJA C;  2PYO A;  3AZM A;  4XZQ B;  5E5A D;  2BYK A;  1P3I A;  3UTB A;  4G91 B;  1P3P D;  4H9R A;  3LZ1 A;  3X1V A;  3LEL C;  3KXB C;  4HGA B;  1P3G C;  3X1T C;  4KHA A;  3AYW A;  3AV1 D;  5AV6 C;  2PYO D;  1U35 A;  3AZM D;  1P3I D;  3UTB D;  3C1B A;  3KSY A;  3VH6 W;  4JJN C;  3LZ1 D;  3X1V D;  1P34 A;  3AFA C;  1P3O B;  3MGP A;  3REJ B;  3AYW D;  3AZI A;  4WU8 C;  5CPJ A;  3W97 B;  1U35 D;  3UT9 A;  2HUE C;  3B0B A;  3C1B D;  1TZY A;  4YM6 C;  1P34 D;  4QLC C;  3LZ0 A;  3MGP D;  3MGS C;  3AZH C;  5CPJ D;  3UT9 D;  3LEL A;  3X1T A;  4H9S C;  3MGQ B;  1TZY D;  5BNV B;  1ID3 B;  3LZ0 D;  5F99 C;  5GT3 B;  4KUD B;  5BO0 B;  1HQ3 C;  1KX4 C;  5B33 C;  4JJN A;  5BS7 C;  4EO5 B;  3LEL D;  1M19 C;  2YFW A;  3AFA A;  3X1T D;  1N1J B;  4J8U B;  1BH9 A;  3AV2 B;  3WKJ C;  4WU8 A;  5AV6 D;  5AV5 B;  5DNM C;  4WNN B;  3AN2 C;  4G92 B;  4KGC B;  3UTA B;  1P3L B;  3REL C;  4JJN D;  4QLC A;  1P3B C;  3AFA D;  1F1E A;  3AZG B;  5B24 B;  3MGS A;  4WU8 D;  3AZK B;  1S32 C;  3KWQ C;  4Z2M G;  3C1C B;  1H3O B;  4H9N A;  3X1U C;  4Z5T A;  1P3F C;  3WAA C;  4QLC D;  3AZE C;  5F99 A;  3WTP B;  3MGS D;  2NZD C;  1HQ3 A;  1KX4 A;  5B33 A;  1ULY A;  5BS7 A;  4X23 A;  3B6F C;  4R8P A;  5E5A B;  3W99 C;  4Z5T D;  5B32 G;  5GSU C;  3MVD B;  3VH6 A;  5F99 D;  5B0Y B;  3AN2 A;  1P3P B;  3REL A;  1HQ3 D;  5B32 B;  5B33 D;  1KX4 D;  4X23 D;  1P3B A;  2BYK B;  3TU4 C;  1P3I B;  3B0D B;  5DNM D;  3X1V B;  3AN2 D;  1S32 A;  3KWQ A;  3REL D;  5BNX A;  5JA4 B;  3X1U A;  5AVC C;  3WAA A;  1P3B D;  3REK A;  5DNN A;  1R4V A;  1KX5 C;  5G49 B;  2F8N K;  2NZD A;  1S32 D;  1P34 B;  3B6F A;  3KWQ D;  3AZI B;  3X1U D;  3W99 A;  1BH8 B;  4ZUX B;  5GSU A;  3WAA D;  3REK D;  3AZE D;  5DNN D;  3UT9 B;  5B2I C;  1ZLA C;  2NZD D;  1P3K C;  4ZBJ C;  3AZL B;  3LZ0 B;  3B6F D;  5AY8 A;  4YS3 A;  1M1A B;  5GXQ C;  3TU4 A;  4Z66 B;  3W99 D;  3NQU A;  5GSU D;  5GT0 C;  3O62 B;  3B6G B;  3AZJ C;  5B1L C;  5CPK B;  5AVC A;  5B1M C;  5AY8 D;  4YS3 D;  3MGR C;  3REI C;  3TU4 D;  3AZN C;  5FUG A;  1B67 A;  4XUJ B;  2YFW B;  1P3A C;  1BH9 B;  5B31 G;  5AVC D;  2YFV B;  1KX3 A;  2IO5 C;  5B2I A;  1F66 C;  2FJ7 C;  1ZLA A;  1P3K A;  4H9P B;  2F8N H;  5GT0 A;  1KX3 D;  3AZF C;  4CSR A;  5B2I D;  5B1L A;  1ZLA D;  4Z5T B;  5B0Z C;  5JRG B;  3W98 C;  5B40 C;  1P3K D;  5B2J A;  3REH B;  3AZN A;  5GXQ D;  3A6N C;  4WU9 C;  2F8N A;  5AVB C;  5GT0 D;  4X23 B;  4R8P B;  3W96 C;  1P3A A;  4J8V C;  5C3I B;  5B1L D;  5B2J D;  3AZN D;  2F8N D;  2NQB C;  1M18 B;  1F66 A;  3X1S B;  3LJA A;  2CV5 C;  1P3A D;  1P3M B;  3MNN B;  3AZF A;  3KXB A;  1F66 D;  1P3G A;  5BNX B;  4AWL B;  4H9O A;  5AV8 C;  5B0Z A;  5AV6 A;  3VH5 W;  5B40 A;  3LJA D;  3W98 A;  1AOI B;  3REK B;  5DNN B;  4WU9 A;  3A6N A;  5AV9 B;  2RVQ C;  4LD9 C;  4E44 A;  3AZF D;  1EQZ B;  3KXB D;  3W96 A;  1P3G D;  2ARO C;  4J8V A;  5B31 C;  5B0Z D;  4J8X C;  3W98 D;  5B40 D;  2HIO C;  4WU9 D;  3A6N D;  4XZQ C;  5CPI B;  4J8W B;  3KUY B;  4CAY A;  2BYM A;  4M6B A;  4YM6 A;  4G91 C;  2CV5 A;  5AY8 B;  4YS3 B;  3W96 D;  4J8V D;  4HGA C;  3AZH A;  4H9Q B;  2NQB D;  5KDM A;  4H9S A;  5CP6 B;  5AV8 A;  4YM6 D;  2CV5 D;  3NQJ B;  1P3O C;  3REJ C;  4LD9 A;  3AZH D;  1JFI A;  3W97 C;  3R45 A;  1M19 A;  2ARO A;  3WKJ A;  3V9R A;  5B31 A;  5AV8 D;  5DNM A;  1KX3 B;  4XZQ A;  2RVQ D;  4LD9 D;  3AV1 B;  1Q9C A;  3WTP E;  2PYO B;  3VH6 T;  3AZM B;  1M19 D;  2ARO D;  3WKJ D;  3UTB B;  5B31 D;  3MGQ C;  4H9R B;  3LZ1 B;  1ID3 C;  4CSR B;  4XZQ D;  4KHA B;  5GT3 C;  3AYW B;  4KUD C;  3B0C T;  1U35 B;  1P3F A;  5B2J B;  3AZE A;  4EO5 C;  2F8N B;  1P3O A;  3REJ A;  4J8U C;  3AV2 C;  3C1B B;  3W97 A;  5AV5 C;  3VH5 A;  3MGP B;  3WA9 C;  4G92 C;  4KGC C;  3UTA C;  1P3L C;  5CPJ B;  4DRB A;  1P3F D;  3AZG C;  3REJ D;  1P3O D;  5B24 C;  1TZY B;  3W97 D;  3AZK C;  3LJA B;  3C1C C;  1WWI A;  3LEL B;  3KXB B;  1P3G B;  3X1T B;  5CHL B;  3WTP C;  5GT3 A;  4H9O B;  5BO0 A;  5AV6 B;  1KX5 A;  1N1J A;  4J8U A;  3AV2 A;  4JJN B;  5AV5 A;  3MVD C;  1ID3 D;  5B0Y C;  3AFA B;  4WNN A;  2CWE A;  1P3P C;  3WA9 A;  5GT3 D;  4WV4 B;  4KUD D;  3UTA A;  4KGC A;  4WU8 B;  5B32 C;  1KX5 D;  3AZG A;  2HUE B;  4J8U D;  3AV2 D;  1P3I C;  5B24 A;  4YM6 B;  5AV5 D;  3AZK A;  4QLC B;  3X1V C;  3WA9 D;  5GXQ A;  4KGC D;  3UTA D;  3MGS B;  1P3L D;  3AZH B;  3AZG D;  3AZJ A;  3WTP A;  4H9N B;  5B24 D;  1KU5 A;  3AZK D;  5B1M A;  5F99 B;  3MGR A;  1P34 C;  3REI A;  4UUZ A;  3AZI C;  1HQ3 B;  1KX4 B;  5B33 B;  4ZUX C;  4DRA A; 
#chains in the Genus database with same CATH topology
 3MVD A;  1M19 B;  5B0Y A;  3UT9 C;  3AZJ D;  3WTP D;  3WKJ B;  3H0M C;  3V9R B;  2RIQ A;  5B1M D;  5B32 A;  5DNM B;  3A1K A;  3MGR D;  3LZ0 C;  3REI D;  3AZL C;  3AN2 B;  1M1A C;  2FJ7 A;  4Z66 C;  3REL B;  1TAF A;  3MVD D;  5B0Y D;  1P3B B;  3O62 C;  3B6G C;  2L5A A;  5JA4 A;  5B32 D;  5CPK C;  3AL0 C;  1S32 B;  3KWQ B;  2FJ7 D;  1PZR A;  5G49 A;  3X1U B;  4DQY B;  1P3F B;  3WAA B;  4XUJ C;  3AZE B;  1W2E A;  5AVB A;  2NZD B;  1BH8 A;  4ZUX A;  2Y2L A;  3B6F B;  3B0C W;  2DQN C;  3W99 B;  5GSU B;  3AZL A;  2Y2G A;  2NQB A;  1M1A A;  5AVB D;  4Z66 A;  3AZI D;  4ZUX D;  3TU4 B;  2ZY5 A;  3O62 A;  3B6G A;  2LY8 A;  3NQU B;  5CPK A;  4Z5T C;  5JRG C;  4NE3 A;  3AZL D;  3FDD A;  3REH C;  1M1A D;  4E45 A;  4Z66 D;  2FFF B;  5AVC B;  2JCH A;  2Y2K A;  4XUJ A;  4X23 C;  1KX5 B;  3O62 D;  4R8P C;  3B6G D;  5C3I C;  5CPK D;  5FUG B;  2YFV A;  1BFM A;  3WA9 B;  1M18 C;  3X1S C;  4J8X A;  4XUJ D;  2HIO A;  5B2I B;  4NE6 A;  1WWS A;  1P3M C;  1ZLA B;  3P5J B;  4H9P A;  1P3K B;  4ZBJ B;  1HTA A;  3MNN C;  5GXQ B;  4AWL C;  4J8X D;  3IP4 C;  5JRG A;  5GT0 B;  2HIO D;  1AOI C;  3REH A;  3REK C;  5DNN C;  2F8N G;  3AZJ B;  5AV9 C;  5BT1 C;  5B1L B;  2Y2P A;  5B1M B;  3MGR B;  3AZN B;  3REI B;  1EQZ C;  4UUZ B;  1A7W A;  4NFT A;  5JRG D;  3REH D;  5CPI C;  1P3A B;  4J8W C;  1M18 A;  3X1S A;  3KUY C;  4WZS B;  3VH5 T;  1B6W A;  2IO5 B;  5AY8 C;  4YS3 C;  4R8P D;  1F66 B;  2FJ7 B;  1TAF B;  1P3M A;  2JE5 A;  3MNN A;  3EPJ A;  1M18 D;  3X1S D;  3KFU G;  3MGQ A;  5CP6 C;  5BNV A;  1ID3 A;  3AZF B;  1AOI A;  1JFI B;  5AV9 A;  1P3M D;  4KUD A;  5B0Z B;  3W98 B;  5B40 B;  3MNN D;  4WU9 B;  3A6N B;  1EQZ A;  5E5A C;  5AVB B;  4NE5 A;  3MGQ D;  1AOI D;  1KX3 C;  3W96 B;  5CPI A;  3F6T A;  4J8V B;  5AV9 D;  5BT1 D;  4J8W A;  1P3L A;  3AV1 C;  3KUY A;  2PYO C;  3AZM C;  1EQZ D;  2NQB B;  4CAY B;  3UTB C;  2BYM B;  4H9Q A;  2CV5 B;  3B0D C;  3LZ1 C;  4Z2M H;  5CPI D;  4J8W D;  3C1C A;  3KUY D;  1H3O A;  3AYW C;  5CP6 A;  1U35 C;  5B2J C;  3NQJ A;  5KDM B;  5AV8 B;  3C1B C;  2JSS A;  5E5A A;  3MGP C;  3C1C D;  4LD9 B;  4WJ3 C;  5CP6 D;  5CPJ C;  3R45 B;  1P3P A;  2ARO B;  5B31 B;  3AV1 A;  4J8X B;  1TZY C;  2HIO B;  2Y2O A;  3LJA C;  3AZM A;  2PYO A;  4XZQ B;  5E5A D;  2BYK A;  1P3I A;  3UTB A;  4G91 B;  1P3P D;  4H9R A;  3LZ1 A;  3X1V A;  3LEL C;  3KXB C;  4HGA B;  1P3G C;  3X1T C;  4KHA A;  3AYW A;  3AV1 D;  5AV6 C;  2PYO D;  1U35 A;  3AZM D;  1P3I D;  3UTB D;  3C1B A;  3KSY A;  2J8P A;  3VH6 W;  4JJN C;  3LZ1 D;  3X1V D;  1P34 A;  3AFA C;  1P3O B;  3MGP A;  3REJ B;  3AYW D;  3AZI A;  4WU8 C;  5CPJ A;  3W97 B;  1U35 D;  3UT9 A;  2HUE C;  3B0B A;  3C1B D;  1TZY A;  4YM6 C;  3H0R C;  1P34 D;  4QLC C;  3LZ0 A;  3MGP D;  3MGS C;  3AZH C;  5CPJ D;  3UT9 D;  3LEL A;  3X1T A;  4H9S C;  3MGQ B;  1TZY D;  2Y2N A;  5BNV B;  1ID3 B;  3LZ0 D;  5F99 C;  5GT3 B;  4KUD B;  1T3U A;  5BO0 B;  1HQ3 C;  1KX4 C;  5B33 C;  4JJN A;  5BS7 C;  4EO5 B;  3LEL D;  1M19 C;  2YFW A;  3AFA A;  3X1T D;  1N1J B;  4J8U B;  1BH9 A;  3AV2 B;  3WKJ C;  4WU8 A;  5AV6 D;  2Y2J A;  5AV5 B;  5DNM C;  4WNN B;  3AN2 C;  4G92 B;  4KGC B;  3UTA B;  1P3L B;  3REL C;  4JJN D;  4QLC A;  1P3B C;  3AFA D;  1F1E A;  3AZG B;  5B24 B;  3MGS A;  4WU8 D;  3AZK B;  1S32 C;  2G5H C;  3KWQ C;  4Z2M G;  3C1C B;  1H3O B;  4H9N A;  3X1U C;  4Z5T A;  1P3F C;  3WAA C;  2ZY4 A;  4QLC D;  3AZE C;  5F99 A;  3WTP B;  3MGS D;  2NZD C;  1HQ3 A;  1KX4 A;  5B33 A;  1ULY A;  5BS7 A;  4X23 A;  3B6F C;  4R8P A;  5E5A B;  2Y2Q A;  3W99 C;  4Z5T D;  5B32 G;  2F2A C;  2XD5 A;  5GSU C;  3MVD B;  3VH6 A;  5F99 D;  5B0Y B;  3AN2 A;  1P3P B;  2UWX A;  3H0L C;  3REL A;  1HQ3 D;  5B32 B;  5B33 D;  1KX4 D;  4X23 D;  1P3B A;  2BYK B;  3TU4 C;  2ZY3 A;  2VQR A;  1P3I B;  3B0D B;  5DNM D;  3X1V B;  3AN2 D;  1S32 A;  3KWQ A;  3REL D;  5BNX A;  5JA4 B;  3X1U A;  5AVC C;  3WAA A;  1P3B D;  3REK A;  5DNN A;  1R4V A;  1KX5 C;  5G49 B;  2F8N K;  2NZD A;  2Y2M A;  1S32 D;  1P34 B;  3B6F A;  3KWQ D;  3AZI B;  3X1U D;  3W99 A;  1BH8 B;  4ZUX B;  5GSU A;  3WAA D;  3REK D;  3AZE D;  5DNN D;  3UT9 B;  5B2I C;  3EG5 B;  1ZLA C;  2NZD D;  1P3K C;  4ZBJ C;  3AZL B;  3LZ0 B;  3B6F D;  5AY8 A;  4YS3 A;  1M1A B;  5GXQ C;  3TU4 A;  4Z66 B;  3EPH A;  3W99 D;  3NQU A;  5GSU D;  5GT0 C;  3O62 B;  3B6G B;  3AZJ C;  5B1L C;  5CPK B;  5AVC A;  5B1M C;  5AY8 D;  4YS3 D;  3MGR C;  3REI C;  3TU4 D;  3AZN C;  5FUG A;  1B67 A;  4XUJ B;  2YFW B;  1P3A C;  1BH9 B;  5B31 G;  5AVC D;  2YFV B;  1KX3 A;  2IO5 C;  5B2I A;  1F66 C;  2FJ7 C;  1ZLA A;  1P3K A;  4UPK A;  4H9P B;  2F8N H;  5GT0 A;  1KX3 D;  3AZF C;  4CSR A;  5B2I D;  5B1L A;  1ZLA D;  2ZM5 A;  4Z5T B;  5B0Z C;  5JRG B;  3W98 C;  5B40 C;  1Z2C B;  5B2J A;  1P3K D;  3REH B;  3AZN A;  5GXQ D;  3A6N C;  4WU9 C;  2F8N A;  5AVB C;  5GT0 D;  4X23 B;  4R8P B;  3W96 C;  1P3A A;  4J8V C;  5C3I B;  5B1L D;  5B2J D;  3AZN D;  2F8N D;  2NQB C;  1M18 B;  1F66 A;  3X1S B;  3LJA A;  2CV5 C;  1P3A D;  1P3M B;  3MNN B;  3AZF A;  3KXB A;  1F66 D;  1P3G A;  5BNX B;  4AWL B;  4H9O A;  5B0Z A;  5AV8 C;  5AV6 A;  3VH5 W;  5B40 A;  3LJA D;  3W98 A;  1AOI B;  3REK B;  5DNN B;  4WU9 A;  3A6N A;  5AV9 B;  2RVQ C;  4LD9 C;  4E44 A;  3AZF D;  1EQZ B;  3KXB D;  3W96 A;  1P3G D;  2ARO C;  4J8V A;  5B31 C;  5B0Z D;  4J8X C;  3W98 D;  5B40 D;  2HIO C;  4WU9 D;  3A6N D;  4XZQ C;  5CPI B;  4J8W B;  3KUY B;  4CAY A;  2BYM A;  4M6B A;  4YM6 A;  4G91 C;  2CV5 A;  5AY8 B;  4YS3 B;  3W96 D;  4J8V D;  4HGA C;  3AZH A;  4H9Q B;  3EPL A;  2NQB D;  5KDM A;  4H9S A;  5CP6 B;  5AV8 A;  4YM6 D;  2CV5 D;  2Y2H A;  3NQJ B;  1P3O C;  3REJ C;  4LD9 A;  3AZH D;  1JFI A;  3W97 C;  3R45 A;  1M19 A;  2ARO A;  3WKJ A;  3V9R A;  5B31 A;  5AV8 D;  5DNM A;  1KX3 B;  4XZQ A;  2RVQ D;  4LD9 D;  3AV1 B;  1Q9C A;  3WTP E;  2PYO B;  3VH6 T;  3AZM B;  1M19 D;  2ARO D;  3WKJ D;  3UTB B;  5B31 D;  3MGQ C;  4H9R B;  3LZ1 B;  1ID3 C;  4CSR B;  4XZQ D;  2W8S A;  2ZY2 A;  4KHA B;  5GT3 C;  3AYW B;  4KUD C;  3B0C T;  1U35 B;  1P3F A;  5B2J B;  3AZE A;  4EO5 C;  2F8N B;  1P3O A;  3REJ A;  4J8U C;  3EPK A;  3AV2 C;  3C1B B;  3W97 A;  2G5I C;  5AV5 C;  3VH5 A;  3MGP B;  3WA9 C;  4G92 C;  4KGC C;  3UTA C;  1P3L C;  2BG1 A;  5CPJ B;  4DRB A;  1P3F D;  3AZG C;  3REJ D;  1P3O D;  3A1I A;  5B24 C;  1TZY B;  3W97 D;  3AZK C;  3LJA B;  3C1C C;  1WWI A;  3LEL B;  3KXB B;  1P3G B;  3X1T B;  5CHL B;  3WTP C;  5GT3 A;  4H9O B;  5BO0 A;  5AV6 B;  1KX5 A;  1N1J A;  4J8U A;  3AV2 A;  4JJN B;  5AV5 A;  3MVD C;  1ID3 D;  5B0Y C;  3AFA B;  4WNN A;  2CWE A;  1P3P C;  3WA9 A;  5GT3 D;  4WV4 B;  4KUD D;  3UTA A;  4KGC A;  4WU8 B;  5B32 C;  1KX5 D;  3AZG A;  2HUE B;  4J8U D;  2Y2I A;  3AV2 D;  5B24 A;  1P3I C;  4YM6 B;  5AV5 D;  3AZK A;  4QLC B;  3X1V C;  3WA9 D;  5GXQ A;  4KGC D;  3UTA D;  3MGS B;  1P3L D;  3AZH B;  2DF4 C;  2XD1 A;  3AZG D;  3AZJ A;  3WTP A;  4H9N B;  5B24 D;  1KU5 A;  3AZK D;  5B1M A;  5F99 B;  3MGR A;  1P34 C;  3REI A;  4UUZ A;  3AZI C;  1HQ3 B;  1KX4 B;  5B33 B;  4ZUX C;  4DRA A; 
#chains in the Genus database with same CATH homology
 3MVD A;  1M19 B;  5B0Y A;  3UT9 C;  3AZJ D;  3WTP D;  3WKJ B;  3H0M C;  3V9R B;  2RIQ A;  5B1M D;  5B32 A;  5DNM B;  3A1K A;  3MGR D;  3LZ0 C;  3REI D;  3AZL C;  3AN2 B;  1M1A C;  2FJ7 A;  4Z66 C;  3REL B;  1TAF A;  3MVD D;  5B0Y D;  1P3B B;  3O62 C;  3B6G C;  2L5A A;  5JA4 A;  5B32 D;  5CPK C;  3AL0 C;  1S32 B;  3KWQ B;  2FJ7 D;  1PZR A;  5G49 A;  3X1U B;  4DQY B;  1P3F B;  3WAA B;  4XUJ C;  3AZE B;  1W2E A;  5AVB A;  2NZD B;  1BH8 A;  4ZUX A;  2Y2L A;  3B6F B;  3B0C W;  2DQN C;  3W99 B;  5GSU B;  3AZL A;  2Y2G A;  2NQB A;  1M1A A;  5AVB D;  4Z66 A;  3AZI D;  4ZUX D;  3TU4 B;  2ZY5 A;  3O62 A;  3B6G A;  2LY8 A;  3NQU B;  5CPK A;  4Z5T C;  5JRG C;  4NE3 A;  3AZL D;  3FDD A;  3REH C;  1M1A D;  4E45 A;  4Z66 D;  2FFF B;  5AVC B;  2JCH A;  2Y2K A;  4XUJ A;  4X23 C;  1KX5 B;  3O62 D;  4R8P C;  3B6G D;  5C3I C;  5CPK D;  5FUG B;  2YFV A;  1BFM A;  3WA9 B;  1M18 C;  3X1S C;  4J8X A;  4XUJ D;  2HIO A;  5B2I B;  4NE6 A;  1WWS A;  1P3M C;  1ZLA B;  3P5J B;  4H9P A;  1P3K B;  4ZBJ B;  1HTA A;  3MNN C;  5GXQ B;  4AWL C;  4J8X D;  3IP4 C;  5JRG A;  5GT0 B;  2HIO D;  1AOI C;  3REH A;  3REK C;  5DNN C;  2F8N G;  3AZJ B;  5AV9 C;  5BT1 C;  5B1L B;  2Y2P A;  5B1M B;  3MGR B;  3AZN B;  3REI B;  1EQZ C;  4UUZ B;  1A7W A;  4NFT A;  5JRG D;  3REH D;  5CPI C;  1P3A B;  4J8W C;  1M18 A;  3X1S A;  3KUY C;  4WZS B;  3VH5 T;  1B6W A;  2IO5 B;  5AY8 C;  4YS3 C;  4R8P D;  1F66 B;  2FJ7 B;  1TAF B;  1P3M A;  2JE5 A;  3MNN A;  3EPJ A;  1M18 D;  3X1S D;  3KFU G;  3MGQ A;  5CP6 C;  5BNV A;  1ID3 A;  3AZF B;  1AOI A;  1JFI B;  5AV9 A;  1P3M D;  4KUD A;  5B0Z B;  3W98 B;  5B40 B;  3MNN D;  4WU9 B;  3A6N B;  1EQZ A;  5E5A C;  5AVB B;  4NE5 A;  3MGQ D;  1AOI D;  1KX3 C;  3W96 B;  5CPI A;  3F6T A;  4J8V B;  5AV9 D;  5BT1 D;  4J8W A;  1P3L A;  3AV1 C;  3KUY A;  2PYO C;  3AZM C;  1EQZ D;  2NQB B;  4CAY B;  3UTB C;  2BYM B;  4H9Q A;  2CV5 B;  3B0D C;  3LZ1 C;  4Z2M H;  5CPI D;  4J8W D;  3C1C A;  3KUY D;  1H3O A;  3AYW C;  5CP6 A;  1U35 C;  5B2J C;  3NQJ A;  5KDM B;  5AV8 B;  3C1B C;  2JSS A;  5E5A A;  3MGP C;  3C1C D;  4LD9 B;  4WJ3 C;  5CP6 D;  5CPJ C;  3R45 B;  1P3P A;  2ARO B;  5B31 B;  3AV1 A;  4J8X B;  1TZY C;  2HIO B;  2Y2O A;  3LJA C;  3AZM A;  2PYO A;  4XZQ B;  5E5A D;  2BYK A;  1P3I A;  3UTB A;  4G91 B;  1P3P D;  4H9R A;  3LZ1 A;  3X1V A;  3LEL C;  3KXB C;  4HGA B;  1P3G C;  3X1T C;  4KHA A;  3AYW A;  3AV1 D;  5AV6 C;  2PYO D;  1U35 A;  3AZM D;  1P3I D;  3UTB D;  3C1B A;  3KSY A;  2J8P A;  3VH6 W;  4JJN C;  3LZ1 D;  3X1V D;  1P34 A;  3AFA C;  1P3O B;  3MGP A;  3REJ B;  3AYW D;  3AZI A;  4WU8 C;  5CPJ A;  3W97 B;  1U35 D;  3UT9 A;  2HUE C;  3B0B A;  3C1B D;  1TZY A;  4YM6 C;  3H0R C;  1P34 D;  4QLC C;  3LZ0 A;  3MGP D;  3MGS C;  3AZH C;  5CPJ D;  3UT9 D;  3LEL A;  3X1T A;  4H9S C;  3MGQ B;  1TZY D;  2Y2N A;  5BNV B;  1ID3 B;  3LZ0 D;  5F99 C;  5GT3 B;  4KUD B;  1T3U A;  5BO0 B;  1HQ3 C;  1KX4 C;  5B33 C;  4JJN A;  5BS7 C;  4EO5 B;  3LEL D;  1M19 C;  2YFW A;  3AFA A;  3X1T D;  1N1J B;  4J8U B;  1BH9 A;  3AV2 B;  3WKJ C;  4WU8 A;  5AV6 D;  2Y2J A;  5AV5 B;  5DNM C;  4WNN B;  3AN2 C;  4G92 B;  4KGC B;  3UTA B;  1P3L B;  3REL C;  4JJN D;  4QLC A;  1P3B C;  3AFA D;  1F1E A;  3AZG B;  5B24 B;  3MGS A;  4WU8 D;  3AZK B;  1S32 C;  2G5H C;  3KWQ C;  4Z2M G;  3C1C B;  1H3O B;  4H9N A;  3X1U C;  4Z5T A;  1P3F C;  3WAA C;  2ZY4 A;  4QLC D;  3AZE C;  5F99 A;  3WTP B;  3MGS D;  2NZD C;  1HQ3 A;  1KX4 A;  5B33 A;  1ULY A;  5BS7 A;  4X23 A;  3B6F C;  4R8P A;  5E5A B;  2Y2Q A;  3W99 C;  4Z5T D;  5B32 G;  2F2A C;  2XD5 A;  5GSU C;  3MVD B;  3VH6 A;  5F99 D;  5B0Y B;  3AN2 A;  1P3P B;  2UWX A;  3H0L C;  3REL A;  1HQ3 D;  5B32 B;  5B33 D;  1KX4 D;  4X23 D;  1P3B A;  2BYK B;  3TU4 C;  2ZY3 A;  2VQR A;  1P3I B;  3B0D B;  5DNM D;  3X1V B;  3AN2 D;  1S32 A;  3KWQ A;  3REL D;  5BNX A;  5JA4 B;  3X1U A;  5AVC C;  3WAA A;  1P3B D;  3REK A;  5DNN A;  1R4V A;  1KX5 C;  5G49 B;  2F8N K;  2NZD A;  2Y2M A;  1S32 D;  1P34 B;  3B6F A;  3KWQ D;  3AZI B;  3X1U D;  3W99 A;  1BH8 B;  4ZUX B;  5GSU A;  3WAA D;  3REK D;  3AZE D;  5DNN D;  3UT9 B;  5B2I C;  3EG5 B;  1ZLA C;  2NZD D;  1P3K C;  4ZBJ C;  3AZL B;  3LZ0 B;  3B6F D;  5AY8 A;  4YS3 A;  1M1A B;  5GXQ C;  3TU4 A;  4Z66 B;  3EPH A;  3W99 D;  3NQU A;  5GSU D;  5GT0 C;  3O62 B;  3B6G B;  3AZJ C;  5B1L C;  5CPK B;  5AVC A;  5B1M C;  5AY8 D;  4YS3 D;  3MGR C;  3REI C;  3TU4 D;  3AZN C;  5FUG A;  1B67 A;  4XUJ B;  2YFW B;  1P3A C;  1BH9 B;  5B31 G;  5AVC D;  2YFV B;  1KX3 A;  2IO5 C;  5B2I A;  1F66 C;  2FJ7 C;  1ZLA A;  1P3K A;  4UPK A;  4H9P B;  2F8N H;  5GT0 A;  1KX3 D;  3AZF C;  4CSR A;  5B2I D;  5B1L A;  1ZLA D;  2ZM5 A;  4Z5T B;  5B0Z C;  5JRG B;  3W98 C;  5B40 C;  1Z2C B;  5B2J A;  1P3K D;  3REH B;  3AZN A;  5GXQ D;  3A6N C;  4WU9 C;  2F8N A;  5AVB C;  5GT0 D;  4X23 B;  4R8P B;  3W96 C;  1P3A A;  4J8V C;  5C3I B;  5B1L D;  5B2J D;  3AZN D;  2F8N D;  2NQB C;  1M18 B;  1F66 A;  3X1S B;  3LJA A;  2CV5 C;  1P3A D;  1P3M B;  3MNN B;  3AZF A;  3KXB A;  1F66 D;  1P3G A;  5BNX B;  4AWL B;  4H9O A;  5B0Z A;  5AV8 C;  5AV6 A;  3VH5 W;  5B40 A;  3LJA D;  3W98 A;  1AOI B;  3REK B;  5DNN B;  4WU9 A;  3A6N A;  5AV9 B;  2RVQ C;  4LD9 C;  4E44 A;  3AZF D;  1EQZ B;  3KXB D;  3W96 A;  1P3G D;  2ARO C;  4J8V A;  5B31 C;  5B0Z D;  4J8X C;  3W98 D;  5B40 D;  2HIO C;  4WU9 D;  3A6N D;  4XZQ C;  5CPI B;  4J8W B;  3KUY B;  4CAY A;  2BYM A;  4M6B A;  4YM6 A;  4G91 C;  2CV5 A;  5AY8 B;  4YS3 B;  3W96 D;  4J8V D;  4HGA C;  3AZH A;  4H9Q B;  3EPL A;  2NQB D;  5KDM A;  4H9S A;  5CP6 B;  5AV8 A;  4YM6 D;  2CV5 D;  2Y2H A;  3NQJ B;  1P3O C;  3REJ C;  4LD9 A;  3AZH D;  1JFI A;  3W97 C;  3R45 A;  1M19 A;  2ARO A;  3WKJ A;  3V9R A;  5B31 A;  5AV8 D;  5DNM A;  1KX3 B;  4XZQ A;  2RVQ D;  4LD9 D;  3AV1 B;  1Q9C A;  3WTP E;  2PYO B;  3VH6 T;  3AZM B;  1M19 D;  2ARO D;  3WKJ D;  3UTB B;  5B31 D;  3MGQ C;  4H9R B;  3LZ1 B;  1ID3 C;  4CSR B;  4XZQ D;  2W8S A;  2ZY2 A;  4KHA B;  5GT3 C;  3AYW B;  4KUD C;  3B0C T;  1U35 B;  1P3F A;  5B2J B;  3AZE A;  4EO5 C;  2F8N B;  1P3O A;  3REJ A;  4J8U C;  3EPK A;  3AV2 C;  3C1B B;  3W97 A;  2G5I C;  5AV5 C;  3VH5 A;  3MGP B;  3WA9 C;  4G92 C;  4KGC C;  3UTA C;  1P3L C;  2BG1 A;  5CPJ B;  4DRB A;  1P3F D;  3AZG C;  3REJ D;  1P3O D;  3A1I A;  5B24 C;  1TZY B;  3W97 D;  3AZK C;  3LJA B;  3C1C C;  1WWI A;  3LEL B;  3KXB B;  1P3G B;  3X1T B;  5CHL B;  3WTP C;  5GT3 A;  4H9O B;  5BO0 A;  5AV6 B;  1KX5 A;  1N1J A;  4J8U A;  3AV2 A;  4JJN B;  5AV5 A;  3MVD C;  1ID3 D;  5B0Y C;  3AFA B;  4WNN A;  2CWE A;  1P3P C;  3WA9 A;  5GT3 D;  4WV4 B;  4KUD D;  3UTA A;  4KGC A;  4WU8 B;  5B32 C;  1KX5 D;  3AZG A;  2HUE B;  4J8U D;  2Y2I A;  3AV2 D;  5B24 A;  1P3I C;  4YM6 B;  5AV5 D;  3AZK A;  4QLC B;  3X1V C;  3WA9 D;  5GXQ A;  4KGC D;  3UTA D;  3MGS B;  1P3L D;  3AZH B;  2DF4 C;  2XD1 A;  3AZG D;  3AZJ A;  3WTP A;  4H9N B;  5B24 D;  1KU5 A;  3AZK D;  5B1M A;  5F99 B;  3MGR A;  1P34 C;  3REI A;  4UUZ A;  3AZI C;  1HQ3 B;  1KX4 B;  5B33 B;  4ZUX C;  4DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...