1KX3C

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3C00
2BYMA 3A6NC 4KUDD 3VH6W 1N1JA 4X23A 2HIOD 5B2JD 3KXBD 4J8XA 3B6GC 5CPJA 5JRGC 5B33D 4EO5B 4YM6B 3AZHD 5B0YA 1ID3B 3MGPB 2CV5C 1U35A 3KWQA 4J8VC 3WKJC 1WWIA 4H9NB 5GT3C 3AZFD 4KUDC 2PYOA 2HIOC 5B2JC 3KXBC 1H3OA 5B32G 4NE5A 5AV8B 3LELB 5B33C 5FUGB 3AN2A 2RVQD 5B31G 4YM6D 4Z66C 1BH8B 3MGPD 1ID3D 3AZFC 4YS3B 1AOIB 3KSYA 5B1MB 5B2IA 3REHA 5G49A 1M18A 3AZEB 4LD9B 2RVQC 3UT9B 5AV8D 3AFAA 3LELD 4EO5C 4YM6C 3AV2A 4NFTA 1BH9A 3VH5A 3X1SA 5CPKC 1KX5B 1ID3C 3MGPC 2BYKB 3B6FA 2L5AA 4YS3D 1AOID 3C1CA 1P3MA 5B1MD 4G92B 1M19B 3NQUB 5CPIA 5E5AA 3AZED 3C1BB 3MGSA 3RELC 3REJB 4LD9D 2F8NH 1KX5D 3W97D 3AZNB 3W96A 4YS3C 4R8PA 4J8WA 1AOIC 1KX4A 5B1MC 1P3GD 5AVCB 1KX3A 1P3AA 3AZEC 1M19D 1P34A 4LD9C 3AV1A 3MGRA 3C1BD 4XUJA 3REJD 3UTBA 3W97C 1P3IA 1R4VA 4G91B 5BT1C 1P3BB 1P3GC 4WNNB 4KHAB 3TU4A 2FJ7D 4WU8A 1EQZC 5GSUB 3AZLB 1M19C 4G92C 1M1AA 5AVCD 5F99B 1Q9CA 3R45B 3WTPB 3C1BC 2NZDA 4J8UA 3W98D 1HTAA 5GXQA 1P3OB 5AY8B 2AROB 3NQJA 3AZIB 5AVBB 2FJ7C 1TZYA 3AZMB 1P3BD 5AVCC 1P3FC 5GSUD 3REKB 3W98C 5F99D 4QLCA 3LZ0B 5BNXB 3WTPD 5DNNA 4H9OA 3LZ1C 5B24A 1F66A 4G91C 3UTAB 5AY8D 1P3BC 2AROD 3REIB 4H9SC 3AZID 5AVBD 5GSUC 3AZMD 3B0CT 5AV6A 5F99C 1WWSA 2CV5B 3REKD 1P3KB 1HQ3A 5GT0A 4JJNB 3WKJB 3LZ0D 5GT3B 5AY8C 3VH5T 1S32A 3AZKA 5B33B 3UTAD 3AZMC 3V9RA 3AZHA 4WU9A 1ZLAA 5B0ZA 3REID 5B32B 5AV9B 5AV5B 4Z66B 3REKC 1P3PB 5B31B 2YFVA 2CV5D 1P3KD 4JJND 4ZUXA 5C3IB 5GT3D 3O62B 3WAAA 3UTAC 3AZJB 3REIC 5B1LB 3X1TD 5CPKB 5B32D 5AV9D 5AV5D 4Z66D 1P3KC 1P3PD 3MVDD 4JJNC 5B31D 3MGQB 1A7WA 3MNNA 3O62D 5JA4B 5AV8A 3X1TC 3LELA 4XZQA 3AZJD 5FUGA 3RELB 5B1LD 5B32C 5AV9C 5AV5C 1N1JB 5B40A 3WTPE 3MVDC 4J8XB 5CPKD 1P3PC 2IO5B 4E44A 5B31C 5C3IC 5DNMA 3O62C 3MGQD 2YFWB 5BS7A 1P3LA 2NQBA 3KWQB 4UUZA 3AZJC 5B1LC 3UT9A 3X1UA 3RELD 1KX5A 3W97B 3KUYA 4J8XD 3VH6A 4CAYA 3AN2B 3X1VA 5CPJD 1P3GB 3MGQC 4HGAB 1EQZB 4DRAA 5B0YD 1U35D 3KWQD 3REJA 1B6WA 5B2IB 3LJAA 3REHB 4X23C 4J8XC 1M18B 2PYOD 4H9RB 2IO5C 3AZNA 5CPJC 3AFAB 5BT1D 2FJ7B 5B0YC 3AZGA 1BH9B 3AN2D 3X1SB 5KDMA 1P3FB 1EQZD 4Z5TA 1U35C 3KWQC 5CP6A 3W98B 4KGCA 2PYOC 1P3MB 3LZ1B 5CPIB 5B2ID 3REHD 5E5AB 4Z2MH 1M18D 4WZSB 5CHLB 3MGSB 3AN2C 4WNNA 4CSRB 3AFAD 4HGAC 3AZLA 2CWEA 3X1SD 3WA9A 1P3FD 3W96B 3R45A 5BO0A 3WTPA 3W99A 1KX4B 1KX3B 4E45A 5B2IC 3REHC 1P3AB 3C1CD 1P3OA 1M18C 1P3MD 3LZ1D 2AROA 1P34B 3AV2C 3AZIA 3AFAC 5AVBA 3MGRB 5E5AD 5CPID 4XUJB 3MGSD 3X1SC 2HUEB 3UTBB 3B6FC 3WKJD 3AYWA 3LZ0A 1ULYA 1TAFA 3W96D 3TU4B 4J8WD 2F8NB 4WU8B 3C1CC 4H9PA 1KX4D 1P3MC 1KX3D 5CPIC 1P3AD 3B0DB 5E5AC 3A6NA 3MGSC 1P34D 4J8UB 3AV1D 3B6GA 3MGRD 5JRGA 5GXQB 4XUJD 3UTBD 1P3ID 3NQJB 3W96C 4R8PC 4J8WC 1TZYB 2CV5A 4J8VA 3WKJA 1KX4C 5GT3A 1KX3C 3TU4D 1P3AC 4WU8D 2F8ND 4KUDA 2HIOA 5B2JA 3KXBA 4QLCB 3AV1C 1P34C 1M1AD 3MGRC 5B33A 3X1TB 4XUJC 4H9OB 4J8UD 2NZDD 3VH6T 2HUEC 3UTBC 1P3IC 5B24B 1JFIA 1F66B 4Z66A 5GXQD 3MVDB 5BNVA 3TU4C 1TZYD 3AZFA 4M6BA 4WU8C 4H9QB 5AV6B 1M1AC 3B0DC 2LY8A 1HQ3B 5GT0B 2NZDC 4J8UC 4QLCD 4YM6A 5GXQC 5CPKA 1S32B 5B24D 1ID3A 3MGPA 4AWLC 3AZKB 3B0CW 1F66D 1TZYC 1ZLAB 4WU9B 5B0ZB 4Z2MG 4H9NA 5AV6D 4QLCC 5JA4A 2YFVB 1HQ3D 5GT0D 5DNNC 3VH5W 4ZUXB 3RELA 2BYMB 5B24C 1F66C 4NE3A 3WAAB 4X23B 1S32D 1BH8A 3AZKD 5CPJB 4YS3A 1AOIA 1ZLAD 4WU9D 5B0YB 5AV6C 5B0ZD 5B1MA 2YFWA 1U35B 1HQ3C 5GT0C 3AZEA 4LD9A 4NE6A 4ZUXD 3MNNB 2PYOB 3W97A 1S32C 1H3OB 3AZKC 3WAAD 2BYKA 4XZQB 4X23D 3AZHC 4WU9C 1ZLAC 5B0ZC 1P3GA 1EQZA 1KU5A 5B40B 1M19A 3NQUA 4ZUXC 3C1BA 5DNMB 4WV4B 3WAAC 1P3LB 2NQBB 5G49B 1B67A 4UUZB 3MNND 4H9RA 3B0BA 3AV2B 3X1UB 4XZQD 2FJ7A 5AVCA 1P3FA 3KUYB 3B6FB 5B40D 4CAYB 3X1VB 3W98A 3C1CB 3MNNC 5DNMD 3LZ1A 5AV8C 2F8NK 3LELC 1P3LD 4XZQC 2NQBD 1P3BA 3UT9D 4CSRA 4H9SA 4KHAA 3AV2D 3X1UD 5GSUA 3LJAB 5B40C 5F99A 1F1EA 3KUYD 3B6FD 4R8PB 4J8WB 3AZGB 3X1VD 5DNMC 5KDMB 5BS7C 4Z5TB 1P3LC 2NQBC 5AY8A 5CP6B 3AV1B 3UT9C 3X1UC 4KGCB 3AZMA 4ZBJB 1KX5C 1P3IB 3LJAD 3KUYC 3REKA 3X1VC 3AZND 5BNXA 4R8PD 2F8NA 1BFMA 3AZGD 3WA9B 1M1AB 4Z5TD 5BO0B 3UTAA 5CP6D 3W99B 3REJC 2NZDB 3REIA 4KGCD 3LJAC 4DRBA 3AZNC 4AWLB 1P3KA 4JJNA 3AZGC 4Z5TC 3AZLD 3WA9D 5CP6C 3AYWB 1TAFB 3X1TA 4KGCC 5DNNB 4H9PB 4ZBJC 3W99D 5B32A 5AV9A 5AV5A 3A6NB 1P3OD 1P3PA 3MVDA 5B31A 3B6GB 5JRGB 3AZLC 4H9QA 3WA9C 3O62A 3WTPC 4J8VB 3AZJA 3AYWD 3W99C 5B1LA 1P3OC 5DNND 4KUDB 2AROC 2HIOB 5B2JB 3KXBB 3AZIC 5AVBC 3A6ND 3V9RB 3AZHB 3B6GD 5JRGD 3MGQA 1JFIB 2F8NG 3AYWC 3LZ0C 2JSSA 5BNVB 3AZFB 4J8VD
chains in the Genus database with same CATH superfamily
2Y2GA 2BYMA 3A6NC 2BG1A 3VH6W 1N1JA 4X23A 2HIOD 5B2JD 3KXBD 4J8XA 4KUDD 3B6GC 5CPJA 5JRGC 2Y2OA 5B33D 4EO5B 4YM6B 3AZHD 5B0YA 1ID3B 3MGPB 3P5JB 2CV5C 1U35A 3KWQA 4J8VC 3WKJC 1WWIA 4H9NB 5GT3C 3AZFD 4KUDC 2PYOA 2HIOC 5B2JC 3KXBC 1H3OA 5B32G 4NE5A 5AV8B 3LELB 5B33C 2XD5A 5FUGB 3AN2A 2RVQD 5B31G 4YM6D 4Z66C 1BH8B 3MGPD 1ID3D 3AZFC 4YS3B 1AOIB 3KSYA 5B1MB 5B2IA 3REHA 5G49A 1M18A 2DQNC 3AZEB 4LD9B 2RVQC 3UT9B 5AV8D 3AFAA 3LELD 4EO5C 4YM6C 3AV2A 4NFTA 1BH9A 3VH5A 3X1SA 5CPKC 1KX5B 1ID3C 2DF4C 3MGPC 2BYKB 3B6FA 2L5AA 2Y2PA 2Y2NA 4YS3D 1AOID 3C1CA 1T3UA 1P3MA 5B1MD 4G92B 1M19B 3NQUB 5CPIA 5E5AA 3AZED 3C1BB 3MGSA 3RELC 3REJB 4LD9D 3EPLA 2F8NH 1KX5D 3W97D 3AZNB 3W96A 4YS3C 4R8PA 4J8WA 1AOIC 1KX4A 5B1MC 1P3GD 5AVCB 1KX3A 1P3AA 3AZEC 1M19D 1P34A 4LD9C 3AV1A 3MGRA 2ZM5A 3C1BD 4XUJA 3REJD 3UTBA 3W97C 1P3IA 1R4VA 4G91B 5BT1C 1P3BB 1P3GC 4WNNB 4KHAB 3TU4A 2FJ7D 4WU8A 1EQZC 5GSUB 3AZLB 1M19C 4G92C 1M1AA 5AVCD 5F99B 1Q9CA 3R45B 3WTPB 3C1BC 2NZDA 4J8UA 3W98D 1W2EA 1HTAA 5GXQA 1P3OB 5AY8B 2AROB 3NQJA 3AZIB 5AVBB 2FJ7C 1TZYA 3AZMB 1P3BD 5AVCC 1P3FC 5GSUD 3REKB 3W98C 5F99D 4QLCA 3H0RC 5BNXB 3LZ0B 3WTPD 5DNNA 4H9OA 3LZ1C 5B24A 1F66A 4G91C 3UTAB 5AY8D 1P3BC 2AROD 3REIB 4H9SC 3AZID 5AVBD 3H0LC 5GSUC 3AZMD 3B0CT 5AV6A 5F99C 1WWSA 2CV5B 3REKD 1P3KB 1HQ3A 5GT0A 4JJNB 3WKJB 3LZ0D 5GT3B 5AY8C 3VH5T 1S32A 3AZKA 1PZRA 5B33B 3UTAD 3AZMC 3V9RA 3AZHA 4WU9A 1ZLAA 5B0ZA 3REID 5B32B 3A1IA 5AV9B 5AV5B 4Z66B 3REKC 1P3PB 5B31B 3EPJA 2YFVA 2CV5D 1P3KD 4JJND 4ZUXA 5C3IB 5GT3D 3O62B 3WAAA 3UTAC 3AZJB 3REIC 2VQRA 5B1LB 3X1TD 5CPKB 5B32D 5AV9D 5AV5D 4Z66D 3EPHA 1P3KC 1P3PD 3MVDD 4JJNC 5B31D 3MGQB 1A7WA 3MNNA 2ZY5A 3O62D 5JA4B 4WJ3C 5AV8A 3X1TC 3LELA 4XZQA 3AZJD 5FUGA 3RELB 5B1LD 5B32C 5AV9C 5AV5C 2Y2IA 2Y2QA 1N1JB 5B40A 3WTPE 3MVDC 4J8XB 5CPKD 1P3PC 2IO5B 4E44A 5B31C 5C3IC 5DNMA 3O62C 3IP4C 3MGQD 2YFWB 5BS7A 1P3LA 2NQBA 3KWQB 4UUZA 3AZJC 5B1LC 3UT9A 3X1UA 3RELD 2ZY4A 1KX5A 3W97B 3EPKA 3KUYA 4J8XD 3VH6A 4CAYA 3AN2B 3X1VA 5CPJD 1P3GB 3MGQC 4HGAB 1EQZB 4DRAA 5B0YD 1U35D 3KWQD 3REJA 1B6WA 5B2IB 3LJAA 3REHB 2Y2JA 4X23C 4J8XC 1M18B 2PYOD 4H9RB 2IO5C 3AZNA 5CPJC 3AFAB 5BT1D 2FJ7B 5B0YC 3AZGA 1BH9B 3AN2D 3X1SB 5KDMA 2Y2HA 1P3FB 1EQZD 4Z5TA 1U35C 3KWQC 5CP6A 3W98B 3H0MC 4KGCA 2PYOC 1P3MB 3LZ1B 5CPIB 5B2ID 3REHD 5E5AB 4Z2MH 1M18D 4WZSB 5CHLB 3MGSB 3AN2C 2ZY3A 4WNNA 4CSRB 3AFAD 4HGAC 3AZLA 2CWEA 3X1SD 3WA9A 1P3FD 3W96B 3R45A 5BO0A 3WTPA 4DQYB 3W99A 1KX4B 1KX3B 4E45A 5B2IC 3REHC 1P3AB 3EG5B 3C1CD 1P3OA 1M18C 1P3MD 3LZ1D 2AROA 1P34B 3AV2C 3AZIA 3AFAC 5AVBA 3MGRB 5E5AD 5CPID 4XUJB 3MGSD 2W8SA 3X1SC 2HUEB 3UTBB 3B6FC 3WKJD 3A1KA 3AYWA 3LZ0A 1ULYA 1TAFA 3W96D 3TU4B 4J8WD 2F2AC 4WU8B 2F8NB 3C1CC 4H9PA 1KX4D 1P3MC 1KX3D 5CPIC 1P3AD 3B0DB 5E5AC 3A6NA 3MGSC 1P34D 4J8UB 3AV1D 3B6GA 3MGRD 5JRGA 5GXQB 4XUJD 2RIQA 3UTBD 1P3ID 3NQJB 3W96C 4R8PC 4J8WC 1TZYB 2CV5A 4J8VA 3WKJA 1KX4C 5GT3A 1KX3C 3TU4D 1P3AC 4WU8D 2F8ND 4KUDA 2HIOA 5B2JA 3KXBA 4QLCB 3AV1C 1P34C 1M1AD 3MGRC 2Y2MA 5B33A 3X1TB 4XUJC 4H9OB 4J8UD 2NZDD 3VH6T 2HUEC 3UTBC 1P3IC 5B24B 1JFIA 1F66B 4Z66A 5GXQD 3MVDB 5BNVA 3TU4C 1TZYD 3AZFA 4M6BA 4WU8C 4H9QB 5AV6B 1M1AC 3B0DC 2ZY2A 2LY8A 1HQ3B 5GT0B 2NZDC 4J8UC 4QLCD 4YM6A 5GXQC 5CPKA 2Y2KA 1S32B 5B24D 1ID3A 3MGPA 4AWLC 3AZKB 3B0CW 1F66D 1TZYC 2J8PA 1ZLAB 4WU9B 5B0ZB 4Z2MG 4H9NA 5AV6D 4QLCC 5JA4A 2YFVB 1HQ3D 5DNNC 5GT0D 3VH5W 4ZUXB 3RELA 2BYMB 5B24C 1F66C 4NE3A 3WAAB 4X23B 1S32D 1BH8A 3AZKD 5CPJB 4YS3A 1AOIA 1ZLAD 4WU9D 5B0YB 5AV6C 5B0ZD 5B1MA 2YFWA 2G5IC 1U35B 1HQ3C 5GT0C 3AZEA 4LD9A 4NE6A 4ZUXD 3MNNB 2PYOB 2UWXA 3W97A 1S32C 1H3OB 3AZKC 3WAAD 2BYKA 4XZQB 4X23D 3AZHC 4WU9C 1ZLAC 5B0ZC 1P3GA 1EQZA 1KU5A 2JCHA 5B40B 1M19A 3NQUA 4ZUXC 3C1BA 2JE5A 5DNMB 4WV4B 3WAAC 1P3LB 2NQBB 5G49B 1B67A 4UUZB 3MNND 4H9RA 3B0BA 3AV2B 3X1UB 4XZQD 2FJ7A 5AVCA 1P3FA 3KUYB 3B6FB 5B40D 4CAYB 3X1VB 3W98A 3C1CB 3MNNC 5DNMD 3LZ1A 5AV8C 2F8NK 3LELC 1P3LD 4XZQC 2NQBD 1P3BA 3UT9D 4CSRA 4H9SA 4KHAA 3AV2D 3X1UD 5GSUA 3LJAB 5B40C 5F99A 1F1EA 3KUYD 3B6FD 4R8PB 4J8WB 3AZGB 3X1VD 5DNMC 5KDMB 5BS7C 4Z5TB 2G5HC 1P3LC 2NQBC 2FFFB 5AY8A 5CP6B 3AV1B 3UT9C 3X1UC 4KGCB 3AZMA 4ZBJB 1KX5C 1P3IB 3LJAD 3KUYC 3REKA 3X1VC 3KFUG 3AZND 5BNXA 1Z2CB 4UPKA 3F6TA 4R8PD 2F8NA 1BFMA 3AZGD 3WA9B 2Y2LA 1M1AB 4Z5TD 5BO0B 3UTAA 5CP6D 3W99B 3REJC 2NZDB 2XD1A 3REIA 4KGCD 3LJAC 4DRBA 3AZNC 4AWLB 1P3KA 4JJNA 3AZGC 4Z5TC 3AZLD 3WA9D 5CP6C 3AYWB 1TAFB 3X1TA 4KGCC 5DNNB 4H9PB 4ZBJC 3W99D 5B32A 5AV9A 5AV5A 3A6NB 1P3OD 1P3PA 3MVDA 5B31A 3B6GB 5JRGB 3AZLC 4H9QA 3WA9C 3O62A 3WTPC 4J8VB 3AZJA 3AYWD 3W99C 5B1LA 1P3OC 5DNND 4KUDB 2AROC 2HIOB 5B2JB 3KXBB 3AZIC 5AVBC 3A6ND 3FDDA 3V9RB 3AZHB 3B6GD 5JRGD 3MGQA 1JFIB 2F8NG 3AYWC 3LZ0C 2JSSA 5BNVB 3AL0C 3AZFB 4J8VD
chains in the Genus database with same CATH topology
2Y2GA 2BYMA 3A6NC 2BG1A 3VH6W 1N1JA 4X23A 2HIOD 5B2JD 3KXBD 4J8XA 4KUDD 3B6GC 5CPJA 5JRGC 2Y2OA 5B33D 4EO5B 4YM6B 3AZHD 5B0YA 1ID3B 3MGPB 3P5JB 2CV5C 1U35A 3KWQA 4J8VC 3WKJC 1WWIA 4H9NB 5GT3C 3AZFD 4KUDC 2PYOA 2HIOC 5B2JC 3KXBC 1H3OA 5B32G 4NE5A 5AV8B 3LELB 5B33C 2XD5A 5FUGB 3AN2A 2RVQD 5B31G 4YM6D 4Z66C 1BH8B 3MGPD 1ID3D 3AZFC 4YS3B 1AOIB 3KSYA 5B1MB 5B2IA 3REHA 5G49A 1M18A 2DQNC 3AZEB 4LD9B 2RVQC 3UT9B 5AV8D 3AFAA 3LELD 4EO5C 4YM6C 3AV2A 4NFTA 1BH9A 3VH5A 3X1SA 5CPKC 1KX5B 1ID3C 2DF4C 3MGPC 2BYKB 3B6FA 2L5AA 2Y2PA 2Y2NA 4YS3D 1AOID 3C1CA 1T3UA 1P3MA 5B1MD 4G92B 1M19B 3NQUB 5CPIA 5E5AA 3AZED 3C1BB 3MGSA 3RELC 3REJB 4LD9D 3EPLA 2F8NH 1KX5D 3W97D 3AZNB 3W96A 4YS3C 4R8PA 4J8WA 1AOIC 1KX4A 5B1MC 1P3GD 5AVCB 1KX3A 1P3AA 3AZEC 1M19D 1P34A 4LD9C 3AV1A 3MGRA 2ZM5A 3C1BD 4XUJA 3REJD 3UTBA 3W97C 1P3IA 1R4VA 4G91B 5BT1C 1P3BB 1P3GC 4WNNB 4KHAB 3TU4A 2FJ7D 4WU8A 1EQZC 5GSUB 3AZLB 1M19C 4G92C 1M1AA 5AVCD 5F99B 1Q9CA 3R45B 3WTPB 3C1BC 2NZDA 4J8UA 3W98D 1W2EA 1HTAA 5GXQA 1P3OB 5AY8B 2AROB 3NQJA 3AZIB 5AVBB 2FJ7C 1TZYA 3AZMB 1P3BD 5AVCC 1P3FC 5GSUD 3REKB 3W98C 5F99D 4QLCA 3H0RC 5BNXB 3LZ0B 3WTPD 5DNNA 4H9OA 3LZ1C 5B24A 1F66A 4G91C 3UTAB 5AY8D 1P3BC 2AROD 3REIB 4H9SC 3AZID 5AVBD 3H0LC 5GSUC 3AZMD 3B0CT 5AV6A 5F99C 1WWSA 2CV5B 3REKD 1P3KB 1HQ3A 5GT0A 4JJNB 3WKJB 3LZ0D 5GT3B 5AY8C 3VH5T 1S32A 3AZKA 1PZRA 5B33B 3UTAD 3AZMC 3V9RA 3AZHA 4WU9A 1ZLAA 5B0ZA 3REID 5B32B 3A1IA 5AV9B 5AV5B 4Z66B 3REKC 1P3PB 5B31B 3EPJA 2YFVA 2CV5D 1P3KD 4JJND 4ZUXA 5C3IB 5GT3D 3O62B 3WAAA 3UTAC 3AZJB 3REIC 2VQRA 5B1LB 3X1TD 5CPKB 5B32D 5AV9D 5AV5D 4Z66D 3EPHA 1P3KC 1P3PD 3MVDD 4JJNC 5B31D 3MGQB 1A7WA 3MNNA 2ZY5A 3O62D 5JA4B 4WJ3C 5AV8A 3X1TC 3LELA 4XZQA 3AZJD 5FUGA 3RELB 5B1LD 5B32C 5AV9C 5AV5C 2Y2IA 2Y2QA 1N1JB 5B40A 3WTPE 3MVDC 4J8XB 5CPKD 1P3PC 2IO5B 4E44A 5B31C 5C3IC 5DNMA 3O62C 3IP4C 3MGQD 2YFWB 5BS7A 1P3LA 2NQBA 3KWQB 4UUZA 3AZJC 5B1LC 3UT9A 3X1UA 3RELD 2ZY4A 1KX5A 3W97B 3EPKA 3KUYA 4J8XD 3VH6A 4CAYA 3AN2B 3X1VA 5CPJD 1P3GB 3MGQC 4HGAB 1EQZB 4DRAA 5B0YD 1U35D 3KWQD 3REJA 1B6WA 5B2IB 3LJAA 3REHB 2Y2JA 4X23C 4J8XC 1M18B 2PYOD 4H9RB 2IO5C 3AZNA 5CPJC 3AFAB 5BT1D 2FJ7B 5B0YC 3AZGA 1BH9B 3AN2D 3X1SB 5KDMA 2Y2HA 1P3FB 1EQZD 4Z5TA 1U35C 3KWQC 5CP6A 3W98B 3H0MC 4KGCA 2PYOC 1P3MB 3LZ1B 5CPIB 5B2ID 3REHD 5E5AB 4Z2MH 1M18D 4WZSB 5CHLB 3MGSB 3AN2C 2ZY3A 4WNNA 4CSRB 3AFAD 4HGAC 3AZLA 2CWEA 3X1SD 3WA9A 1P3FD 3W96B 3R45A 5BO0A 3WTPA 4DQYB 3W99A 1KX4B 1KX3B 4E45A 5B2IC 3REHC 1P3AB 3EG5B 3C1CD 1P3OA 1M18C 1P3MD 3LZ1D 2AROA 1P34B 3AV2C 3AZIA 3AFAC 5AVBA 3MGRB 5E5AD 5CPID 4XUJB 3MGSD 2W8SA 3X1SC 2HUEB 3UTBB 3B6FC 3WKJD 3A1KA 3AYWA 3LZ0A 1ULYA 1TAFA 3W96D 3TU4B 4J8WD 2F2AC 4WU8B 2F8NB 3C1CC 4H9PA 1KX4D 1P3MC 1KX3D 5CPIC 1P3AD 3B0DB 5E5AC 3A6NA 3MGSC 1P34D 4J8UB 3AV1D 3B6GA 3MGRD 5JRGA 5GXQB 4XUJD 2RIQA 3UTBD 1P3ID 3NQJB 3W96C 4R8PC 4J8WC 1TZYB 2CV5A 4J8VA 3WKJA 1KX4C 5GT3A 1KX3C 3TU4D 1P3AC 4WU8D 2F8ND 4KUDA 2HIOA 5B2JA 3KXBA 4QLCB 3AV1C 1P34C 1M1AD 3MGRC 2Y2MA 5B33A 3X1TB 4XUJC 4H9OB 4J8UD 2NZDD 3VH6T 2HUEC 3UTBC 1P3IC 5B24B 1JFIA 1F66B 4Z66A 5GXQD 3MVDB 5BNVA 3TU4C 1TZYD 3AZFA 4M6BA 4WU8C 4H9QB 5AV6B 1M1AC 3B0DC 2ZY2A 2LY8A 1HQ3B 5GT0B 2NZDC 4J8UC 4QLCD 4YM6A 5GXQC 5CPKA 2Y2KA 1S32B 5B24D 1ID3A 3MGPA 4AWLC 3AZKB 3B0CW 1F66D 1TZYC 2J8PA 1ZLAB 4WU9B 5B0ZB 4Z2MG 4H9NA 5AV6D 4QLCC 5JA4A 2YFVB 1HQ3D 5DNNC 5GT0D 3VH5W 4ZUXB 3RELA 2BYMB 5B24C 1F66C 4NE3A 3WAAB 4X23B 1S32D 1BH8A 3AZKD 5CPJB 4YS3A 1AOIA 1ZLAD 4WU9D 5B0YB 5AV6C 5B0ZD 5B1MA 2YFWA 2G5IC 1U35B 1HQ3C 5GT0C 3AZEA 4LD9A 4NE6A 4ZUXD 3MNNB 2PYOB 2UWXA 3W97A 1S32C 1H3OB 3AZKC 3WAAD 2BYKA 4XZQB 4X23D 3AZHC 4WU9C 1ZLAC 5B0ZC 1P3GA 1EQZA 1KU5A 2JCHA 5B40B 1M19A 3NQUA 4ZUXC 3C1BA 2JE5A 5DNMB 4WV4B 3WAAC 1P3LB 2NQBB 5G49B 1B67A 4UUZB 3MNND 4H9RA 3B0BA 3AV2B 3X1UB 4XZQD 2FJ7A 5AVCA 1P3FA 3KUYB 3B6FB 5B40D 4CAYB 3X1VB 3W98A 3C1CB 3MNNC 5DNMD 3LZ1A 5AV8C 2F8NK 3LELC 1P3LD 4XZQC 2NQBD 1P3BA 3UT9D 4CSRA 4H9SA 4KHAA 3AV2D 3X1UD 5GSUA 3LJAB 5B40C 5F99A 1F1EA 3KUYD 3B6FD 4R8PB 4J8WB 3AZGB 3X1VD 5DNMC 5KDMB 5BS7C 4Z5TB 2G5HC 1P3LC 2NQBC 2FFFB 5AY8A 5CP6B 3AV1B 3UT9C 3X1UC 4KGCB 3AZMA 4ZBJB 1KX5C 1P3IB 3LJAD 3KUYC 3REKA 3X1VC 3KFUG 3AZND 5BNXA 1Z2CB 4UPKA 3F6TA 4R8PD 2F8NA 1BFMA 3AZGD 3WA9B 2Y2LA 1M1AB 4Z5TD 5BO0B 3UTAA 5CP6D 3W99B 3REJC 2NZDB 2XD1A 3REIA 4KGCD 3LJAC 4DRBA 3AZNC 4AWLB 1P3KA 4JJNA 3AZGC 4Z5TC 3AZLD 3WA9D 5CP6C 3AYWB 1TAFB 3X1TA 4KGCC 5DNNB 4H9PB 4ZBJC 3W99D 5B32A 5AV9A 5AV5A 3A6NB 1P3OD 1P3PA 3MVDA 5B31A 3B6GB 5JRGB 3AZLC 4H9QA 3WA9C 3O62A 3WTPC 4J8VB 3AZJA 3AYWD 3W99C 5B1LA 1P3OC 5DNND 4KUDB 2AROC 2HIOB 5B2JB 3KXBB 3AZIC 5AVBC 3A6ND 3FDDA 3V9RB 3AZHB 3B6GD 5JRGD 3MGQA 1JFIB 2F8NG 3AYWC 3LZ0C 2JSSA 5BNVB 3AL0C 3AZFB 4J8VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYM A;  3A6N C;  4KUD D;  3VH6 W;  1N1J A;  4X23 A;  2HIO D;  5B2J D;  3KXB D;  4J8X A;  3B6G C;  5CPJ A;  5JRG C;  5B33 D;  4EO5 B;  4YM6 B;  3AZH D;  5B0Y A;  1ID3 B;  3MGP B;  2CV5 C;  1U35 A;  3KWQ A;  4J8V C;  3WKJ C;  1WWI A;  4H9N B;  5GT3 C;  3AZF D;  4KUD C;  2PYO A;  2HIO C;  5B2J C;  3KXB C;  1H3O A;  5B32 G;  4NE5 A;  5AV8 B;  3LEL B;  5B33 C;  5FUG B;  3AN2 A;  2RVQ D;  5B31 G;  4YM6 D;  4Z66 C;  1BH8 B;  3MGP D;  1ID3 D;  3AZF C;  4YS3 B;  1AOI B;  3KSY A;  5B1M B;  5B2I A;  3REH A;  5G49 A;  1M18 A;  3AZE B;  4LD9 B;  2RVQ C;  3UT9 B;  5AV8 D;  3AFA A;  3LEL D;  4EO5 C;  4YM6 C;  3AV2 A;  4NFT A;  1BH9 A;  3VH5 A;  3X1S A;  5CPK C;  1KX5 B;  1ID3 C;  3MGP C;  2BYK B;  3B6F A;  2L5A A;  4YS3 D;  1AOI D;  3C1C A;  1P3M A;  5B1M D;  4G92 B;  1M19 B;  3NQU B;  5CPI A;  5E5A A;  3AZE D;  3C1B B;  3MGS A;  3REL C;  3REJ B;  4LD9 D;  2F8N H;  1KX5 D;  3W97 D;  3AZN B;  3W96 A;  4YS3 C;  4R8P A;  4J8W A;  1AOI C;  1KX4 A;  5B1M C;  1P3G D;  5AVC B;  1KX3 A;  1P3A A;  3AZE C;  1M19 D;  1P34 A;  4LD9 C;  3AV1 A;  3MGR A;  3C1B D;  4XUJ A;  3REJ D;  3UTB A;  3W97 C;  1P3I A;  1R4V A;  4G91 B;  5BT1 C;  1P3B B;  1P3G C;  4WNN B;  4KHA B;  3TU4 A;  2FJ7 D;  4WU8 A;  1EQZ C;  5GSU B;  3AZL B;  1M19 C;  4G92 C;  1M1A A;  5AVC D;  5F99 B;  1Q9C A;  3R45 B;  3WTP B;  3C1B C;  2NZD A;  4J8U A;  3W98 D;  1HTA A;  5GXQ A;  1P3O B;  5AY8 B;  2ARO B;  3NQJ A;  3AZI B;  5AVB B;  2FJ7 C;  1TZY A;  3AZM B;  1P3B D;  5AVC C;  1P3F C;  5GSU D;  3REK B;  3W98 C;  5F99 D;  4QLC A;  3LZ0 B;  5BNX B;  3WTP D;  5DNN A;  4H9O A;  3LZ1 C;  5B24 A;  1F66 A;  4G91 C;  3UTA B;  5AY8 D;  1P3B C;  2ARO D;  3REI B;  4H9S C;  3AZI D;  5AVB D;  5GSU C;  3AZM D;  3B0C T;  5AV6 A;  5F99 C;  1WWS A;  2CV5 B;  3REK D;  1P3K B;  1HQ3 A;  5GT0 A;  4JJN B;  3WKJ B;  3LZ0 D;  5GT3 B;  5AY8 C;  3VH5 T;  1S32 A;  3AZK A;  5B33 B;  3UTA D;  3AZM C;  3V9R A;  3AZH A;  4WU9 A;  1ZLA A;  5B0Z A;  3REI D;  5B32 B;  5AV9 B;  5AV5 B;  4Z66 B;  3REK C;  1P3P B;  5B31 B;  2YFV A;  2CV5 D;  1P3K D;  4JJN D;  4ZUX A;  5C3I B;  5GT3 D;  3O62 B;  3WAA A;  3UTA C;  3AZJ B;  3REI C;  5B1L B;  3X1T D;  5CPK B;  5B32 D;  5AV9 D;  5AV5 D;  4Z66 D;  1P3K C;  1P3P D;  3MVD D;  4JJN C;  5B31 D;  3MGQ B;  1A7W A;  3MNN A;  3O62 D;  5JA4 B;  5AV8 A;  3X1T C;  3LEL A;  4XZQ A;  3AZJ D;  5FUG A;  3REL B;  5B1L D;  5B32 C;  5AV9 C;  5AV5 C;  1N1J B;  5B40 A;  3WTP E;  3MVD C;  4J8X B;  5CPK D;  1P3P C;  2IO5 B;  4E44 A;  5B31 C;  5C3I C;  5DNM A;  3O62 C;  3MGQ D;  2YFW B;  5BS7 A;  1P3L A;  2NQB A;  3KWQ B;  4UUZ A;  3AZJ C;  5B1L C;  3UT9 A;  3X1U A;  3REL D;  1KX5 A;  3W97 B;  3KUY A;  4J8X D;  3VH6 A;  4CAY A;  3AN2 B;  3X1V A;  5CPJ D;  1P3G B;  3MGQ C;  4HGA B;  1EQZ B;  4DRA A;  5B0Y D;  1U35 D;  3KWQ D;  3REJ A;  1B6W A;  5B2I B;  3LJA A;  3REH B;  4X23 C;  4J8X C;  1M18 B;  2PYO D;  4H9R B;  2IO5 C;  3AZN A;  5CPJ C;  3AFA B;  5BT1 D;  2FJ7 B;  5B0Y C;  3AZG A;  1BH9 B;  3AN2 D;  3X1S B;  5KDM A;  1P3F B;  1EQZ D;  4Z5T A;  1U35 C;  3KWQ C;  5CP6 A;  3W98 B;  4KGC A;  2PYO C;  1P3M B;  3LZ1 B;  5CPI B;  5B2I D;  3REH D;  5E5A B;  4Z2M H;  1M18 D;  4WZS B;  5CHL B;  3MGS B;  3AN2 C;  4WNN A;  4CSR B;  3AFA D;  4HGA C;  3AZL A;  2CWE A;  3X1S D;  3WA9 A;  1P3F D;  3W96 B;  3R45 A;  5BO0 A;  3WTP A;  3W99 A;  1KX4 B;  1KX3 B;  4E45 A;  5B2I C;  3REH C;  1P3A B;  3C1C D;  1P3O A;  1M18 C;  1P3M D;  3LZ1 D;  2ARO A;  1P34 B;  3AV2 C;  3AZI A;  3AFA C;  5AVB A;  3MGR B;  5E5A D;  5CPI D;  4XUJ B;  3MGS D;  3X1S C;  2HUE B;  3UTB B;  3B6F C;  3WKJ D;  3AYW A;  3LZ0 A;  1ULY A;  1TAF A;  3W96 D;  3TU4 B;  4J8W D;  2F8N B;  4WU8 B;  3C1C C;  4H9P A;  1KX4 D;  1P3M C;  1KX3 D;  5CPI C;  1P3A D;  3B0D B;  5E5A C;  3A6N A;  3MGS C;  1P34 D;  4J8U B;  3AV1 D;  3B6G A;  3MGR D;  5JRG A;  5GXQ B;  4XUJ D;  3UTB D;  1P3I D;  3NQJ B;  3W96 C;  4R8P C;  4J8W C;  1TZY B;  2CV5 A;  4J8V A;  3WKJ A;  1KX4 C;  5GT3 A;  1KX3 C;  3TU4 D;  1P3A C;  4WU8 D;  2F8N D;  4KUD A;  2HIO A;  5B2J A;  3KXB A;  4QLC B;  3AV1 C;  1P34 C;  1M1A D;  3MGR C;  5B33 A;  3X1T B;  4XUJ C;  4H9O B;  4J8U D;  2NZD D;  3VH6 T;  2HUE C;  3UTB C;  1P3I C;  5B24 B;  1JFI A;  1F66 B;  4Z66 A;  5GXQ D;  3MVD B;  5BNV A;  3TU4 C;  1TZY D;  3AZF A;  4M6B A;  4WU8 C;  4H9Q B;  5AV6 B;  1M1A C;  3B0D C;  2LY8 A;  1HQ3 B;  5GT0 B;  2NZD C;  4J8U C;  4QLC D;  4YM6 A;  5GXQ C;  5CPK A;  1S32 B;  5B24 D;  1ID3 A;  3MGP A;  4AWL C;  3AZK B;  3B0C W;  1F66 D;  1TZY C;  1ZLA B;  4WU9 B;  5B0Z B;  4Z2M G;  4H9N A;  5AV6 D;  4QLC C;  5JA4 A;  2YFV B;  1HQ3 D;  5GT0 D;  5DNN C;  3VH5 W;  4ZUX B;  3REL A;  2BYM B;  5B24 C;  1F66 C;  4NE3 A;  3WAA B;  4X23 B;  1S32 D;  1BH8 A;  3AZK D;  5CPJ B;  4YS3 A;  1AOI A;  1ZLA D;  4WU9 D;  5B0Y B;  5AV6 C;  5B0Z D;  5B1M A;  2YFW A;  1U35 B;  1HQ3 C;  5GT0 C;  3AZE A;  4LD9 A;  4NE6 A;  4ZUX D;  3MNN B;  2PYO B;  3W97 A;  1S32 C;  1H3O B;  3AZK C;  3WAA D;  2BYK A;  4XZQ B;  4X23 D;  3AZH C;  4WU9 C;  1ZLA C;  5B0Z C;  1P3G A;  1EQZ A;  1KU5 A;  5B40 B;  1M19 A;  3NQU A;  4ZUX C;  3C1B A;  5DNM B;  4WV4 B;  3WAA C;  1P3L B;  2NQB B;  5G49 B;  1B67 A;  4UUZ B;  3MNN D;  4H9R A;  3B0B A;  3AV2 B;  3X1U B;  4XZQ D;  2FJ7 A;  5AVC A;  1P3F A;  3KUY B;  3B6F B;  5B40 D;  4CAY B;  3X1V B;  3W98 A;  3C1C B;  3MNN C;  5DNM D;  3LZ1 A;  5AV8 C;  2F8N K;  3LEL C;  1P3L D;  4XZQ C;  2NQB D;  1P3B A;  3UT9 D;  4CSR A;  4H9S A;  4KHA A;  3AV2 D;  3X1U D;  5GSU A;  3LJA B;  5B40 C;  5F99 A;  1F1E A;  3KUY D;  3B6F D;  4R8P B;  4J8W B;  3AZG B;  3X1V D;  5DNM C;  5KDM B;  5BS7 C;  4Z5T B;  1P3L C;  2NQB C;  5AY8 A;  5CP6 B;  3AV1 B;  3UT9 C;  3X1U C;  4KGC B;  3AZM A;  4ZBJ B;  1KX5 C;  1P3I B;  3LJA D;  3KUY C;  3REK A;  3X1V C;  3AZN D;  5BNX A;  4R8P D;  2F8N A;  1BFM A;  3AZG D;  3WA9 B;  1M1A B;  4Z5T D;  5BO0 B;  3UTA A;  5CP6 D;  3W99 B;  3REJ C;  2NZD B;  3REI A;  4KGC D;  3LJA C;  4DRB A;  3AZN C;  4AWL B;  1P3K A;  4JJN A;  3AZG C;  4Z5T C;  3AZL D;  3WA9 D;  5CP6 C;  3AYW B;  1TAF B;  3X1T A;  4KGC C;  5DNN B;  4H9P B;  4ZBJ C;  3W99 D;  5B32 A;  5AV9 A;  5AV5 A;  3A6N B;  1P3O D;  1P3P A;  3MVD A;  5B31 A;  3B6G B;  5JRG B;  3AZL C;  4H9Q A;  3WA9 C;  3O62 A;  3WTP C;  4J8V B;  3AZJ A;  3AYW D;  3W99 C;  5B1L A;  1P3O C;  5DNN D;  4KUD B;  2ARO C;  2HIO B;  5B2J B;  3KXB B;  3AZI C;  5AVB C;  3A6N D;  3V9R B;  3AZH B;  3B6G D;  5JRG D;  3MGQ A;  1JFI B;  2F8N G;  3AYW C;  3LZ0 C;  2JSS A;  5BNV B;  3AZF B;  4J8V D; 
#chains in the Genus database with same CATH topology
 2Y2G A;  2BYM A;  3A6N C;  2BG1 A;  3VH6 W;  1N1J A;  4X23 A;  2HIO D;  5B2J D;  3KXB D;  4J8X A;  4KUD D;  3B6G C;  5CPJ A;  5JRG C;  2Y2O A;  5B33 D;  4EO5 B;  4YM6 B;  3AZH D;  5B0Y A;  1ID3 B;  3MGP B;  3P5J B;  2CV5 C;  1U35 A;  3KWQ A;  4J8V C;  3WKJ C;  1WWI A;  4H9N B;  5GT3 C;  3AZF D;  4KUD C;  2PYO A;  2HIO C;  5B2J C;  3KXB C;  1H3O A;  5B32 G;  4NE5 A;  5AV8 B;  3LEL B;  5B33 C;  2XD5 A;  5FUG B;  3AN2 A;  2RVQ D;  5B31 G;  4YM6 D;  4Z66 C;  1BH8 B;  3MGP D;  1ID3 D;  3AZF C;  4YS3 B;  1AOI B;  3KSY A;  5B1M B;  5B2I A;  3REH A;  5G49 A;  1M18 A;  2DQN C;  3AZE B;  4LD9 B;  2RVQ C;  3UT9 B;  5AV8 D;  3AFA A;  3LEL D;  4EO5 C;  4YM6 C;  3AV2 A;  4NFT A;  1BH9 A;  3VH5 A;  3X1S A;  5CPK C;  1KX5 B;  1ID3 C;  2DF4 C;  3MGP C;  2BYK B;  3B6F A;  2L5A A;  2Y2P A;  2Y2N A;  4YS3 D;  1AOI D;  3C1C A;  1T3U A;  1P3M A;  5B1M D;  4G92 B;  1M19 B;  3NQU B;  5CPI A;  5E5A A;  3AZE D;  3C1B B;  3MGS A;  3REL C;  3REJ B;  4LD9 D;  3EPL A;  2F8N H;  1KX5 D;  3W97 D;  3AZN B;  3W96 A;  4YS3 C;  4R8P A;  4J8W A;  1AOI C;  1KX4 A;  5B1M C;  1P3G D;  5AVC B;  1KX3 A;  1P3A A;  3AZE C;  1M19 D;  1P34 A;  4LD9 C;  3AV1 A;  3MGR A;  2ZM5 A;  3C1B D;  4XUJ A;  3REJ D;  3UTB A;  3W97 C;  1P3I A;  1R4V A;  4G91 B;  5BT1 C;  1P3B B;  1P3G C;  4WNN B;  4KHA B;  3TU4 A;  2FJ7 D;  4WU8 A;  1EQZ C;  5GSU B;  3AZL B;  1M19 C;  4G92 C;  1M1A A;  5AVC D;  5F99 B;  1Q9C A;  3R45 B;  3WTP B;  3C1B C;  2NZD A;  4J8U A;  3W98 D;  1W2E A;  1HTA A;  5GXQ A;  1P3O B;  5AY8 B;  2ARO B;  3NQJ A;  3AZI B;  5AVB B;  2FJ7 C;  1TZY A;  3AZM B;  1P3B D;  5AVC C;  1P3F C;  5GSU D;  3REK B;  3W98 C;  5F99 D;  4QLC A;  3H0R C;  5BNX B;  3LZ0 B;  3WTP D;  5DNN A;  4H9O A;  3LZ1 C;  5B24 A;  1F66 A;  4G91 C;  3UTA B;  5AY8 D;  1P3B C;  2ARO D;  3REI B;  4H9S C;  3AZI D;  5AVB D;  3H0L C;  5GSU C;  3AZM D;  3B0C T;  5AV6 A;  5F99 C;  1WWS A;  2CV5 B;  3REK D;  1P3K B;  1HQ3 A;  5GT0 A;  4JJN B;  3WKJ B;  3LZ0 D;  5GT3 B;  5AY8 C;  3VH5 T;  1S32 A;  3AZK A;  1PZR A;  5B33 B;  3UTA D;  3AZM C;  3V9R A;  3AZH A;  4WU9 A;  1ZLA A;  5B0Z A;  3REI D;  5B32 B;  3A1I A;  5AV9 B;  5AV5 B;  4Z66 B;  3REK C;  1P3P B;  5B31 B;  3EPJ A;  2YFV A;  2CV5 D;  1P3K D;  4JJN D;  4ZUX A;  5C3I B;  5GT3 D;  3O62 B;  3WAA A;  3UTA C;  3AZJ B;  3REI C;  2VQR A;  5B1L B;  3X1T D;  5CPK B;  5B32 D;  5AV9 D;  5AV5 D;  4Z66 D;  3EPH A;  1P3K C;  1P3P D;  3MVD D;  4JJN C;  5B31 D;  3MGQ B;  1A7W A;  3MNN A;  2ZY5 A;  3O62 D;  5JA4 B;  4WJ3 C;  5AV8 A;  3X1T C;  3LEL A;  4XZQ A;  3AZJ D;  5FUG A;  3REL B;  5B1L D;  5B32 C;  5AV9 C;  5AV5 C;  2Y2I A;  2Y2Q A;  1N1J B;  5B40 A;  3WTP E;  3MVD C;  4J8X B;  5CPK D;  1P3P C;  2IO5 B;  4E44 A;  5B31 C;  5C3I C;  5DNM A;  3O62 C;  3IP4 C;  3MGQ D;  2YFW B;  5BS7 A;  1P3L A;  2NQB A;  3KWQ B;  4UUZ A;  3AZJ C;  5B1L C;  3UT9 A;  3X1U A;  3REL D;  2ZY4 A;  1KX5 A;  3W97 B;  3EPK A;  3KUY A;  4J8X D;  3VH6 A;  4CAY A;  3AN2 B;  3X1V A;  5CPJ D;  1P3G B;  3MGQ C;  4HGA B;  1EQZ B;  4DRA A;  5B0Y D;  1U35 D;  3KWQ D;  3REJ A;  1B6W A;  5B2I B;  3LJA A;  3REH B;  2Y2J A;  4X23 C;  4J8X C;  1M18 B;  2PYO D;  4H9R B;  2IO5 C;  3AZN A;  5CPJ C;  3AFA B;  5BT1 D;  2FJ7 B;  5B0Y C;  3AZG A;  1BH9 B;  3AN2 D;  3X1S B;  5KDM A;  2Y2H A;  1P3F B;  1EQZ D;  4Z5T A;  1U35 C;  3KWQ C;  5CP6 A;  3W98 B;  3H0M C;  4KGC A;  2PYO C;  1P3M B;  3LZ1 B;  5CPI B;  5B2I D;  3REH D;  5E5A B;  4Z2M H;  1M18 D;  4WZS B;  5CHL B;  3MGS B;  3AN2 C;  2ZY3 A;  4WNN A;  4CSR B;  3AFA D;  4HGA C;  3AZL A;  2CWE A;  3X1S D;  3WA9 A;  1P3F D;  3W96 B;  3R45 A;  5BO0 A;  3WTP A;  4DQY B;  3W99 A;  1KX4 B;  1KX3 B;  4E45 A;  5B2I C;  3REH C;  1P3A B;  3EG5 B;  3C1C D;  1P3O A;  1M18 C;  1P3M D;  3LZ1 D;  2ARO A;  1P34 B;  3AV2 C;  3AZI A;  3AFA C;  5AVB A;  3MGR B;  5E5A D;  5CPI D;  4XUJ B;  3MGS D;  2W8S A;  3X1S C;  2HUE B;  3UTB B;  3B6F C;  3WKJ D;  3A1K A;  3AYW A;  3LZ0 A;  1ULY A;  1TAF A;  3W96 D;  3TU4 B;  4J8W D;  2F2A C;  4WU8 B;  2F8N B;  3C1C C;  4H9P A;  1KX4 D;  1P3M C;  1KX3 D;  5CPI C;  1P3A D;  3B0D B;  5E5A C;  3A6N A;  3MGS C;  1P34 D;  4J8U B;  3AV1 D;  3B6G A;  3MGR D;  5JRG A;  5GXQ B;  4XUJ D;  2RIQ A;  3UTB D;  1P3I D;  3NQJ B;  3W96 C;  4R8P C;  4J8W C;  1TZY B;  2CV5 A;  4J8V A;  3WKJ A;  1KX4 C;  5GT3 A;  1KX3 C;  3TU4 D;  1P3A C;  4WU8 D;  2F8N D;  4KUD A;  2HIO A;  5B2J A;  3KXB A;  4QLC B;  3AV1 C;  1P34 C;  1M1A D;  3MGR C;  2Y2M A;  5B33 A;  3X1T B;  4XUJ C;  4H9O B;  4J8U D;  2NZD D;  3VH6 T;  2HUE C;  3UTB C;  1P3I C;  5B24 B;  1JFI A;  1F66 B;  4Z66 A;  5GXQ D;  3MVD B;  5BNV A;  3TU4 C;  1TZY D;  3AZF A;  4M6B A;  4WU8 C;  4H9Q B;  5AV6 B;  1M1A C;  3B0D C;  2ZY2 A;  2LY8 A;  1HQ3 B;  5GT0 B;  2NZD C;  4J8U C;  4QLC D;  4YM6 A;  5GXQ C;  5CPK A;  2Y2K A;  1S32 B;  5B24 D;  1ID3 A;  3MGP A;  4AWL C;  3AZK B;  3B0C W;  1F66 D;  1TZY C;  2J8P A;  1ZLA B;  4WU9 B;  5B0Z B;  4Z2M G;  4H9N A;  5AV6 D;  4QLC C;  5JA4 A;  2YFV B;  1HQ3 D;  5DNN C;  5GT0 D;  3VH5 W;  4ZUX B;  3REL A;  2BYM B;  5B24 C;  1F66 C;  4NE3 A;  3WAA B;  4X23 B;  1S32 D;  1BH8 A;  3AZK D;  5CPJ B;  4YS3 A;  1AOI A;  1ZLA D;  4WU9 D;  5B0Y B;  5AV6 C;  5B0Z D;  5B1M A;  2YFW A;  2G5I C;  1U35 B;  1HQ3 C;  5GT0 C;  3AZE A;  4LD9 A;  4NE6 A;  4ZUX D;  3MNN B;  2PYO B;  2UWX A;  3W97 A;  1S32 C;  1H3O B;  3AZK C;  3WAA D;  2BYK A;  4XZQ B;  4X23 D;  3AZH C;  4WU9 C;  1ZLA C;  5B0Z C;  1P3G A;  1EQZ A;  1KU5 A;  2JCH A;  5B40 B;  1M19 A;  3NQU A;  4ZUX C;  3C1B A;  2JE5 A;  5DNM B;  4WV4 B;  3WAA C;  1P3L B;  2NQB B;  5G49 B;  1B67 A;  4UUZ B;  3MNN D;  4H9R A;  3B0B A;  3AV2 B;  3X1U B;  4XZQ D;  2FJ7 A;  5AVC A;  1P3F A;  3KUY B;  3B6F B;  5B40 D;  4CAY B;  3X1V B;  3W98 A;  3C1C B;  3MNN C;  5DNM D;  3LZ1 A;  5AV8 C;  2F8N K;  3LEL C;  1P3L D;  4XZQ C;  2NQB D;  1P3B A;  3UT9 D;  4CSR A;  4H9S A;  4KHA A;  3AV2 D;  3X1U D;  5GSU A;  3LJA B;  5B40 C;  5F99 A;  1F1E A;  3KUY D;  3B6F D;  4R8P B;  4J8W B;  3AZG B;  3X1V D;  5DNM C;  5KDM B;  5BS7 C;  4Z5T B;  2G5H C;  1P3L C;  2NQB C;  2FFF B;  5AY8 A;  5CP6 B;  3AV1 B;  3UT9 C;  3X1U C;  4KGC B;  3AZM A;  4ZBJ B;  1KX5 C;  1P3I B;  3LJA D;  3KUY C;  3REK A;  3X1V C;  3KFU G;  3AZN D;  5BNX A;  1Z2C B;  4UPK A;  3F6T A;  4R8P D;  2F8N A;  1BFM A;  3AZG D;  3WA9 B;  2Y2L A;  1M1A B;  4Z5T D;  5BO0 B;  3UTA A;  5CP6 D;  3W99 B;  3REJ C;  2NZD B;  2XD1 A;  3REI A;  4KGC D;  3LJA C;  4DRB A;  3AZN C;  4AWL B;  1P3K A;  4JJN A;  3AZG C;  4Z5T C;  3AZL D;  3WA9 D;  5CP6 C;  3AYW B;  1TAF B;  3X1T A;  4KGC C;  5DNN B;  4H9P B;  4ZBJ C;  3W99 D;  5B32 A;  5AV9 A;  5AV5 A;  3A6N B;  1P3O D;  1P3P A;  3MVD A;  5B31 A;  3B6G B;  5JRG B;  3AZL C;  4H9Q A;  3WA9 C;  3O62 A;  3WTP C;  4J8V B;  3AZJ A;  3AYW D;  3W99 C;  5B1L A;  1P3O C;  5DNN D;  4KUD B;  2ARO C;  2HIO B;  5B2J B;  3KXB B;  3AZI C;  5AVB C;  3A6N D;  3FDD A;  3V9R B;  3AZH B;  3B6G D;  5JRG D;  3MGQ A;  1JFI B;  2F8N G;  3AYW C;  3LZ0 C;  2JSS A;  5BNV B;  3AL0 C;  3AZF B;  4J8V D; 
#chains in the Genus database with same CATH homology
 2Y2G A;  2BYM A;  3A6N C;  2BG1 A;  3VH6 W;  1N1J A;  4X23 A;  2HIO D;  5B2J D;  3KXB D;  4J8X A;  4KUD D;  3B6G C;  5CPJ A;  5JRG C;  2Y2O A;  5B33 D;  4EO5 B;  4YM6 B;  3AZH D;  5B0Y A;  1ID3 B;  3MGP B;  3P5J B;  2CV5 C;  1U35 A;  3KWQ A;  4J8V C;  3WKJ C;  1WWI A;  4H9N B;  5GT3 C;  3AZF D;  4KUD C;  2PYO A;  2HIO C;  5B2J C;  3KXB C;  1H3O A;  5B32 G;  4NE5 A;  5AV8 B;  3LEL B;  5B33 C;  2XD5 A;  5FUG B;  3AN2 A;  2RVQ D;  5B31 G;  4YM6 D;  4Z66 C;  1BH8 B;  3MGP D;  1ID3 D;  3AZF C;  4YS3 B;  1AOI B;  3KSY A;  5B1M B;  5B2I A;  3REH A;  5G49 A;  1M18 A;  2DQN C;  3AZE B;  4LD9 B;  2RVQ C;  3UT9 B;  5AV8 D;  3AFA A;  3LEL D;  4EO5 C;  4YM6 C;  3AV2 A;  4NFT A;  1BH9 A;  3VH5 A;  3X1S A;  5CPK C;  1KX5 B;  1ID3 C;  2DF4 C;  3MGP C;  2BYK B;  3B6F A;  2L5A A;  2Y2P A;  2Y2N A;  4YS3 D;  1AOI D;  3C1C A;  1T3U A;  1P3M A;  5B1M D;  4G92 B;  1M19 B;  3NQU B;  5CPI A;  5E5A A;  3AZE D;  3C1B B;  3MGS A;  3REL C;  3REJ B;  4LD9 D;  3EPL A;  2F8N H;  1KX5 D;  3W97 D;  3AZN B;  3W96 A;  4YS3 C;  4R8P A;  4J8W A;  1AOI C;  1KX4 A;  5B1M C;  1P3G D;  5AVC B;  1KX3 A;  1P3A A;  3AZE C;  1M19 D;  1P34 A;  4LD9 C;  3AV1 A;  3MGR A;  2ZM5 A;  3C1B D;  4XUJ A;  3REJ D;  3UTB A;  3W97 C;  1P3I A;  1R4V A;  4G91 B;  5BT1 C;  1P3B B;  1P3G C;  4WNN B;  4KHA B;  3TU4 A;  2FJ7 D;  4WU8 A;  1EQZ C;  5GSU B;  3AZL B;  1M19 C;  4G92 C;  1M1A A;  5AVC D;  5F99 B;  1Q9C A;  3R45 B;  3WTP B;  3C1B C;  2NZD A;  4J8U A;  3W98 D;  1W2E A;  1HTA A;  5GXQ A;  1P3O B;  5AY8 B;  2ARO B;  3NQJ A;  3AZI B;  5AVB B;  2FJ7 C;  1TZY A;  3AZM B;  1P3B D;  5AVC C;  1P3F C;  5GSU D;  3REK B;  3W98 C;  5F99 D;  4QLC A;  3H0R C;  5BNX B;  3LZ0 B;  3WTP D;  5DNN A;  4H9O A;  3LZ1 C;  5B24 A;  1F66 A;  4G91 C;  3UTA B;  5AY8 D;  1P3B C;  2ARO D;  3REI B;  4H9S C;  3AZI D;  5AVB D;  3H0L C;  5GSU C;  3AZM D;  3B0C T;  5AV6 A;  5F99 C;  1WWS A;  2CV5 B;  3REK D;  1P3K B;  1HQ3 A;  5GT0 A;  4JJN B;  3WKJ B;  3LZ0 D;  5GT3 B;  5AY8 C;  3VH5 T;  1S32 A;  3AZK A;  1PZR A;  5B33 B;  3UTA D;  3AZM C;  3V9R A;  3AZH A;  4WU9 A;  1ZLA A;  5B0Z A;  3REI D;  5B32 B;  3A1I A;  5AV9 B;  5AV5 B;  4Z66 B;  3REK C;  1P3P B;  5B31 B;  3EPJ A;  2YFV A;  2CV5 D;  1P3K D;  4JJN D;  4ZUX A;  5C3I B;  5GT3 D;  3O62 B;  3WAA A;  3UTA C;  3AZJ B;  3REI C;  2VQR A;  5B1L B;  3X1T D;  5CPK B;  5B32 D;  5AV9 D;  5AV5 D;  4Z66 D;  3EPH A;  1P3K C;  1P3P D;  3MVD D;  4JJN C;  5B31 D;  3MGQ B;  1A7W A;  3MNN A;  2ZY5 A;  3O62 D;  5JA4 B;  4WJ3 C;  5AV8 A;  3X1T C;  3LEL A;  4XZQ A;  3AZJ D;  5FUG A;  3REL B;  5B1L D;  5B32 C;  5AV9 C;  5AV5 C;  2Y2I A;  2Y2Q A;  1N1J B;  5B40 A;  3WTP E;  3MVD C;  4J8X B;  5CPK D;  1P3P C;  2IO5 B;  4E44 A;  5B31 C;  5C3I C;  5DNM A;  3O62 C;  3IP4 C;  3MGQ D;  2YFW B;  5BS7 A;  1P3L A;  2NQB A;  3KWQ B;  4UUZ A;  3AZJ C;  5B1L C;  3UT9 A;  3X1U A;  3REL D;  2ZY4 A;  1KX5 A;  3W97 B;  3EPK A;  3KUY A;  4J8X D;  3VH6 A;  4CAY A;  3AN2 B;  3X1V A;  5CPJ D;  1P3G B;  3MGQ C;  4HGA B;  1EQZ B;  4DRA A;  5B0Y D;  1U35 D;  3KWQ D;  3REJ A;  1B6W A;  5B2I B;  3LJA A;  3REH B;  2Y2J A;  4X23 C;  4J8X C;  1M18 B;  2PYO D;  4H9R B;  2IO5 C;  3AZN A;  5CPJ C;  3AFA B;  5BT1 D;  2FJ7 B;  5B0Y C;  3AZG A;  1BH9 B;  3AN2 D;  3X1S B;  5KDM A;  2Y2H A;  1P3F B;  1EQZ D;  4Z5T A;  1U35 C;  3KWQ C;  5CP6 A;  3W98 B;  3H0M C;  4KGC A;  2PYO C;  1P3M B;  3LZ1 B;  5CPI B;  5B2I D;  3REH D;  5E5A B;  4Z2M H;  1M18 D;  4WZS B;  5CHL B;  3MGS B;  3AN2 C;  2ZY3 A;  4WNN A;  4CSR B;  3AFA D;  4HGA C;  3AZL A;  2CWE A;  3X1S D;  3WA9 A;  1P3F D;  3W96 B;  3R45 A;  5BO0 A;  3WTP A;  4DQY B;  3W99 A;  1KX4 B;  1KX3 B;  4E45 A;  5B2I C;  3REH C;  1P3A B;  3EG5 B;  3C1C D;  1P3O A;  1M18 C;  1P3M D;  3LZ1 D;  2ARO A;  1P34 B;  3AV2 C;  3AZI A;  3AFA C;  5AVB A;  3MGR B;  5E5A D;  5CPI D;  4XUJ B;  3MGS D;  2W8S A;  3X1S C;  2HUE B;  3UTB B;  3B6F C;  3WKJ D;  3A1K A;  3AYW A;  3LZ0 A;  1ULY A;  1TAF A;  3W96 D;  3TU4 B;  4J8W D;  2F2A C;  4WU8 B;  2F8N B;  3C1C C;  4H9P A;  1KX4 D;  1P3M C;  1KX3 D;  5CPI C;  1P3A D;  3B0D B;  5E5A C;  3A6N A;  3MGS C;  1P34 D;  4J8U B;  3AV1 D;  3B6G A;  3MGR D;  5JRG A;  5GXQ B;  4XUJ D;  2RIQ A;  3UTB D;  1P3I D;  3NQJ B;  3W96 C;  4R8P C;  4J8W C;  1TZY B;  2CV5 A;  4J8V A;  3WKJ A;  1KX4 C;  5GT3 A;  1KX3 C;  3TU4 D;  1P3A C;  4WU8 D;  2F8N D;  4KUD A;  2HIO A;  5B2J A;  3KXB A;  4QLC B;  3AV1 C;  1P34 C;  1M1A D;  3MGR C;  2Y2M A;  5B33 A;  3X1T B;  4XUJ C;  4H9O B;  4J8U D;  2NZD D;  3VH6 T;  2HUE C;  3UTB C;  1P3I C;  5B24 B;  1JFI A;  1F66 B;  4Z66 A;  5GXQ D;  3MVD B;  5BNV A;  3TU4 C;  1TZY D;  3AZF A;  4M6B A;  4WU8 C;  4H9Q B;  5AV6 B;  1M1A C;  3B0D C;  2ZY2 A;  2LY8 A;  1HQ3 B;  5GT0 B;  2NZD C;  4J8U C;  4QLC D;  4YM6 A;  5GXQ C;  5CPK A;  2Y2K A;  1S32 B;  5B24 D;  1ID3 A;  3MGP A;  4AWL C;  3AZK B;  3B0C W;  1F66 D;  1TZY C;  2J8P A;  1ZLA B;  4WU9 B;  5B0Z B;  4Z2M G;  4H9N A;  5AV6 D;  4QLC C;  5JA4 A;  2YFV B;  1HQ3 D;  5DNN C;  5GT0 D;  3VH5 W;  4ZUX B;  3REL A;  2BYM B;  5B24 C;  1F66 C;  4NE3 A;  3WAA B;  4X23 B;  1S32 D;  1BH8 A;  3AZK D;  5CPJ B;  4YS3 A;  1AOI A;  1ZLA D;  4WU9 D;  5B0Y B;  5AV6 C;  5B0Z D;  5B1M A;  2YFW A;  2G5I C;  1U35 B;  1HQ3 C;  5GT0 C;  3AZE A;  4LD9 A;  4NE6 A;  4ZUX D;  3MNN B;  2PYO B;  2UWX A;  3W97 A;  1S32 C;  1H3O B;  3AZK C;  3WAA D;  2BYK A;  4XZQ B;  4X23 D;  3AZH C;  4WU9 C;  1ZLA C;  5B0Z C;  1P3G A;  1EQZ A;  1KU5 A;  2JCH A;  5B40 B;  1M19 A;  3NQU A;  4ZUX C;  3C1B A;  2JE5 A;  5DNM B;  4WV4 B;  3WAA C;  1P3L B;  2NQB B;  5G49 B;  1B67 A;  4UUZ B;  3MNN D;  4H9R A;  3B0B A;  3AV2 B;  3X1U B;  4XZQ D;  2FJ7 A;  5AVC A;  1P3F A;  3KUY B;  3B6F B;  5B40 D;  4CAY B;  3X1V B;  3W98 A;  3C1C B;  3MNN C;  5DNM D;  3LZ1 A;  5AV8 C;  2F8N K;  3LEL C;  1P3L D;  4XZQ C;  2NQB D;  1P3B A;  3UT9 D;  4CSR A;  4H9S A;  4KHA A;  3AV2 D;  3X1U D;  5GSU A;  3LJA B;  5B40 C;  5F99 A;  1F1E A;  3KUY D;  3B6F D;  4R8P B;  4J8W B;  3AZG B;  3X1V D;  5DNM C;  5KDM B;  5BS7 C;  4Z5T B;  2G5H C;  1P3L C;  2NQB C;  2FFF B;  5AY8 A;  5CP6 B;  3AV1 B;  3UT9 C;  3X1U C;  4KGC B;  3AZM A;  4ZBJ B;  1KX5 C;  1P3I B;  3LJA D;  3KUY C;  3REK A;  3X1V C;  3KFU G;  3AZN D;  5BNX A;  1Z2C B;  4UPK A;  3F6T A;  4R8P D;  2F8N A;  1BFM A;  3AZG D;  3WA9 B;  2Y2L A;  1M1A B;  4Z5T D;  5BO0 B;  3UTA A;  5CP6 D;  3W99 B;  3REJ C;  2NZD B;  2XD1 A;  3REI A;  4KGC D;  3LJA C;  4DRB A;  3AZN C;  4AWL B;  1P3K A;  4JJN A;  3AZG C;  4Z5T C;  3AZL D;  3WA9 D;  5CP6 C;  3AYW B;  1TAF B;  3X1T A;  4KGC C;  5DNN B;  4H9P B;  4ZBJ C;  3W99 D;  5B32 A;  5AV9 A;  5AV5 A;  3A6N B;  1P3O D;  1P3P A;  3MVD A;  5B31 A;  3B6G B;  5JRG B;  3AZL C;  4H9Q A;  3WA9 C;  3O62 A;  3WTP C;  4J8V B;  3AZJ A;  3AYW D;  3W99 C;  5B1L A;  1P3O C;  5DNN D;  4KUD B;  2ARO C;  2HIO B;  5B2J B;  3KXB B;  3AZI C;  5AVB C;  3A6N D;  3FDD A;  3V9R B;  3AZH B;  3B6G D;  5JRG D;  3MGQ A;  1JFI B;  2F8N G;  3AYW C;  3LZ0 C;  2JSS A;  5BNV B;  3AL0 C;  3AZF B;  4J8V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...