2HIOA

Histone octamer (chicken), chromosomal protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein,dna binding protein
molecule keywords PROTEIN (HISTONE H2A)
publication title The nucleosomal core histone octamer at 3.1 A resolution: a tripartite protein assembly and a left-handed superhelix.
pubmed doi rcsb
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hioA00
5G49A 5DNNC 3WA9C 1ZLAB 3AN2B 1P3MC 3MVDC 3UTAA 3WAAB 1EQZB 2BYMB 5BT1D 4AWLB 5B0ZB 3B6GD 1BH8B 5JRGA 4YM6D 3LZ0D 4HGAC 3B0CW 5AY8A 1P3IC 3R45B 4YS3C 4J8VD 2HIOB 3AYWD 2AROD 5AVCB 3X1TC 4WNNB 5GT3A 5BO0B 3MGRA 3AV2C 4NE6A 1HQ3D 1P3BC 3WKJC 3REHA 1P3LD 3X1SC 2FJ7B 1P3KC 1ULYA 5B32D 3A6NC 3X1UD 3W97C 5KDMA 3UTAD 4NE5A 4XZQC 1S32B 3AZNA 3B0DC 2NQBC 1P3PA 5AV9A 5JRGD 3AZJA 5CPJA 1P3FA 1Q9CA 5B33C 2YFVB 5AY8D 4NE3A 1P34B 3B6FC 5B2IC 4LD9C 5CPIC 5AV5A 5B24C 1KX5C 4QLCA 5C3IB 4WU8A 3O62B 3MGQB 5GT3D 3MGRD 2NZDC 4J8XA 5B0YC 3W96A 2CV5C 3REHD 4R8PC 4J8WC 1ID3B 5GSUA 3MGPA 3UT9A 3NQUB 2RVQC 3LELA 3RELC 3UTBC 4KUDA 3AZND 1TZYB 4KHAB 3AZMC 3C1CB 5AVBB 4WU9A 1TAFA 1P3PD 3NQJB 4Z2MG 3REIA 5AV9D 3MGSA 3MNNA 3B6GC 5CPKB 3AZJD 5CPJD 3AZGC 1P3FD 3AZLC 2IO5B 4ZUXA 1KX3A 1M1AB 5AV5D 1WWSA 3WTPB 4X23B 4QLCD 5CP6C 3TU4A 4WU8D 5BS7C 5DNNB 3AFAA 3WA9B 4J8XD 3AYWC 1U35A 2AROC 1P3MB 3MVDB 3W96D 5E5AA 1HQ3C 5B31G 5GSUD 3KXBC 3MGPD 4Z5TC 3UT9D 1P3LC 3W99A 4KUDD 3LELD 4Z2MH 3AZIC 3AZEA 3VH5A 2HUEC 4HGAB 3V9RA 1P3IB 4WU9D 5GXQA 5F99C 3REKC 4YS3B 4H9OB 3MGSD 3MNND 3X1TB 5JRGC 1H3OA 3AV2B 4ZUXD 1KX3D 3B0CT 1P3BB 2F8NG 5B2JC 3WKJB 3X1SB 1P3KB 3TU4D 3A6NB 3W97B 3AFAD 5B1MA 1U35D 4Z66A 4XZQB 3MGRC 1ZLAA 3B0DB 4JJND 3AN2A 5B40A 5B31C 5E5AD 1EQZA 2NQBB 5BNXA 5B0ZA 1BH8A 3W99D 1F66C 2YFWB 3AZED 5B33B 3KWQC 4J8UA 3KSYA 5GXQD 3B6FB 5B2IB 4LD9B 1AOIB 5CPIB 5B24B 1KX5B 3R45A 3REJC 1M19C 2HIOA 3AZFA 2NZDB 5AVCA 5B0YB 5BO0A 4KGCC 5AV6C 1M18A 3VH5W 2CV5B 4R8PB 5B1LD 4J8WB 5AV8D 2FJ7A 5B1MD 4Z66D 3UTBB 3RELB 3W98B 1ZLAD 1P3OA 4G92C 3AN2D 5B40D 3AZMB 1B6WA 1S32A 1EQZD 3W96C 5BNVB 4CAYA 5B0ZD 1JFIB 3B6GB 5GSUC 3AZGB 3UT9C 3AZLB 4J8UD 1B67A 2YFVA 3X1VC 3B0BA 1BH9B 4WU9C 5CP6B 3REIC 2HIOD 3AZFD 3MGSC 5AVCD 3O62A 3LZ1C 2AROB 3MGQA 1M18D 3AZKC 1P3GC 4M6BA 1HQ3B 3KXBB 2FJ7D 4Z5TB 5DNMC 1P3LB 3KUYC 3WTPE 3TU4C 3AZIB 3VH6A 4H9RA 5FUGB 1P3OD 3AZHC 3NQUA 2HUEB 4XUJC 1S32D 4KHAA 5F99B 3REKB 3C1CA 5AVBA 3NQJA 4G91C 5GT0C 3C1BC 5CPKA 5JRGB 4H9SA 1P3AA 5B2JB 5GXQC 1M1AA 2PYOC 3WTPA 3LJAC 4X23A 3O62D 3MGQD 5DNNA 3MGRB 3WA9A 3MVDA 2LY8A 5B31B 5BT1C 1ID3D 1F66B 5CHLB 5JA4B 3KWQB 4H9PB 4E45A 4YM6C 3LZ0C 3C1CD 5B40C 5AVBD 4UUZB 3REJB 4YS3A 1M19B 4J8VC 5CPKD 3X1TA 2F8NB 4H9NB 1P3AD 3VH6W 4KGCB 5AV6B 4J8UC 3AV2A 4JJNA 1P3BA 1M1AD 3WKJA 3WTPD 3X1SA 4X23D 1P3KA 3W97A 5B32C 5DNND 3AZFC 3WA9D 3X1UC 4G92B 3AV1A 1P3MD 3MVDD 4XZQA 3UTAC 3VH5T 1M18C 5GSUB 4CSRB 2YFWA 4WZSB 5B33A 2BYKA 3X1VB 1P3OC 1KX4A 1P3ID 5AY8C 3B6FA 5B2IA 4WU9B 1AOIA 4YS3D 5CPIA 5B1LA 1N1JB 3REIB 1KX5A 3MGSB 5AV8A 3X1TD 3LZ1B 2NZDA 5GT3C 3AV2D 5B0YA 3AZKB 1P3GB 1P3BD 3WAAA 1KU5A 3WKJD 2CV5A 2BYMA 3X1SD 4R8PA 2JSSA 5DNMB 3KUYB 4J8WA 3REHC 1P3KD 3TU4B 3W97D 3AZHB 3UTBA 3AV1D 4XUJB 4XZQD 4H9QB 3W98A 3AZMA 3AZNC 1F1EA 2F8NH 5BNVA 4G91B 5GT0B 3C1BB 1P3PC 1JFIA 5AV9C 3AZGA 3AZJC 4WNNA 5B33D 3AZLA 5CPJC 1P3FC 1KX4D 3V9RB 3B6FD 5B2ID 5GXQB 1AOID 5CPID 2PYOB 1KX5D 3LJAB 1BH9A 5AV5C 5CP6A 4ZBJC 4QLCC 5BS7A 4WU8C 2NZDD 5B0YD 4J8XC 3WAAD 4H9SC 1P3AC 2CV5D 4R8PD 4J8WD 4EO5C 3KXBA 4Z5TA 3MGPC 3UTBD 3RELD 3AZIA 3W98D 4KUDC 3LELC 5FUGA 3AZMD 4YM6B 5B40B 3LZ0B 1P34A 5F99A 3REKA 1R4VA 5BNXB 4J8VB 3MNNC 3AZGD 3AYWB 3AZLD 4J8UB 4ZUXC 1KX3C 5B2JA 5CP6D 1ID3A 5B32B 3AZFB 3X1UB 3AFAC 5G49B 1U35C 3VH6T 3UTAB 1M18B 4NFTA 1TZYA 5B31A 4JJNC 5E5AC 3KXBD 4Z5TD 2L5AA 3AZID 1F66A 3W99C 3AZEC 5JA4A 1P3OB 3KWQA 3AV1C 4H9PA 1P34D 5AY8B 5F99D 3REKD 4CAYB 4UUZA 3REJA 1M19A 5GT3B 5B32G 2F8NA 4H9NA 1P3MA 4KGCA 1A7WA 5AV6A 5B2JD 1KX4C 3REHB 1AOIC 5B1LC 5AV8C 5B1MC 4Z66C 5KDMB 3AZNB 1ZLAC 1TZYD 5B31D 3AN2C 3WAAC 4E44A 1P3IA 1EQZC 1P3PB 4AWLC 4H9OA 5AV9B 5B0ZC 1F66D 4WV4B 4H9RB 4CSRA 3AZJB 3KWQD 5CPJB 1P3FB 3W98C 3X1VA 3REJD 5AV5B 1M19D 1N1JA 4ZBJB 4QLCB 3A6NA 4WU8B 2HIOC 3LZ1A 2F8ND 1BFMA 5AVCC 4J8XB 4KGCD 5AV6D 1P3AB 3W96B 3AZKA 1P3GA 2F8NK 4EO5B 2NQBA 5DNMA 3MGPB 3KUYA 3UT9B 2CWEA 2FJ7C 4KUDB 3LELB 3AZHA 4XUJA 4H9QA 1S32C 4LD9A 1TAFB 5B24A 5GT0A 3MNNB 3C1BA 3X1VD 4ZUXB 1KX3B 1P34C 2PYOA 3REID 4DRBA 3LJAA 3A6ND 3LZ1D 3AFAB 5C3IC 3O62C 3RELA 3MGQC 1U35B 3AZKD 1P3GD 4JJNB 5E5AB 2NQBD 5DNMD 3KUYD 1ID3C 3B6GA 4DRAA 3W99B 3AZHD 3AZEB 4XUJD 3AV1B 4LD9D 4YM6A 3LZ0A 1TZYC 5B24D 3C1CC 5AVBC 5GT0D 3C1BD 4J8VA 5CPKC 3AYWA 2AROA 1H3OB 1HTAA 2BYKB 1KX4B 1WWIA 2IO5C 2PYOD 1HQ3A 3LJAD 1M1AC 5B1LB 3WTPC 5AV8B 1P3LA 4X23C 5B1MB 2RVQD 4Z66B 5B32A 3X1UA
chains in the Genus database with same CATH superfamily
5G49A 5DNNC 3WA9C 1ZLAB 3AN2B 1P3MC 3MVDC 3UTAA 3WAAB 1EQZB 2BYMB 5BT1D 4AWLB 5B0ZB 3B6GD 1BH8B 5JRGA 4YM6D 3LZ0D 4HGAC 3B0CW 5AY8A 1P3IC 3R45B 4YS3C 4J8VD 2HIOB 3AYWD 2AROD 5AVCB 3X1TC 4WNNB 5GT3A 2Y2MA 4UPKA 5BO0B 3MGRA 3AV2C 4NE6A 1HQ3D 1P3BC 3WKJC 3REHA 1P3LD 3X1SC 2FJ7B 1P3KC 1ULYA 5B32D 3A6NC 3X1UD 3W97C 5KDMA 2Y2NA 3UTAD 4NE5A 4XZQC 1S32B 3AZNA 3B0DC 2Y2OA 2NQBC 1P3PA 5AV9A 5JRGD 3AZJA 5CPJA 1P3FA 1Q9CA 5B33C 2YFVB 5AY8D 4NE3A 1P34B 3EPLA 3B6FC 5B2IC 4LD9C 5CPIC 5AV5A 5B24C 1KX5C 3EPJA 2J8PA 4QLCA 5C3IB 4WU8A 3O62B 3MGQB 5GT3D 3MGRD 2NZDC 4J8XA 5B0YC 3W96A 2CV5C 3REHD 2G5IC 4R8PC 4J8WC 1ID3B 5GSUA 3MGPA 3UT9A 3NQUB 2RVQC 3LELA 3RELC 3UTBC 4KUDA 3AZND 1TZYB 4KHAB 3AZMC 3C1CB 5AVBB 4WU9A 1TAFA 1P3PD 3NQJB 4Z2MG 3REIA 5AV9D 3MGSA 3MNNA 3B6GC 5CPKB 3AZJD 5CPJD 3AZGC 1P3FD 3AZLC 2IO5B 4ZUXA 1KX3A 2Y2QA 1M1AB 5AV5D 1WWSA 3WTPB 4X23B 4QLCD 5CP6C 3TU4A 4WU8D 5BS7C 5DNNB 3AFAA 3WA9B 1PZRA 4J8XD 3AYWC 1U35A 2AROC 1P3MB 3MVDB 3W96D 2VQRA 5E5AA 1HQ3C 5B31G 5GSUD 3KXBC 3MGPD 4Z5TC 3UT9D 1P3LC 3W99A 4KUDD 3LELD 4Z2MH 3AZIC 3AZEA 3VH5A 2HUEC 4HGAB 3V9RA 1P3IB 4WU9D 2Y2LA 5GXQA 5F99C 3REKC 4YS3B 4H9OB 3MGSD 3MNND 3X1TB 5JRGC 1H3OA 3AV2B 2ZY5A 4ZUXD 1KX3D 3B0CT 1P3BB 2F8NG 5B2JC 3WKJB 3X1SB 1P3KB 3TU4D 3A1IA 3A6NB 3W97B 3AFAD 5B1MA 1U35D 4Z66A 4XZQB 3MGRC 1ZLAA 3B0DB 4JJND 3AN2A 5B40A 5B31C 5E5AD 1EQZA 2NQBB 5BNXA 5B0ZA 1BH8A 3W99D 1F66C 2YFWB 3AZED 5B33B 3KWQC 4J8UA 3KSYA 5GXQD 3B6FB 5B2IB 4LD9B 1AOIB 5CPIB 5B24B 1KX5B 3R45A 2Y2PA 3REJC 1M19C 2HIOA 3AZFA 2NZDB 5AVCA 5B0YB 5BO0A 4KGCC 5AV6C 1M18A 3VH5W 2UWXA 2CV5B 2ZY4A 4R8PB 5B1LD 4J8WB 5AV8D 2XD1A 2FJ7A 5B1MD 4Z66D 3UTBB 3RELB 3W98B 1ZLAD 1P3OA 4G92C 3AN2D 5B40D 3AZMB 1B6WA 1S32A 1EQZD 3W96C 5BNVB 4CAYA 5B0ZD 1JFIB 3B6GB 5GSUC 3EPHA 3AZGB 3UT9C 3AZLB 4J8UD 1B67A 2YFVA 3X1VC 3B0BA 1BH9B 4WU9C 5CP6B 3REIC 2HIOD 3AZFD 3MGSC 5AVCD 3O62A 3LZ1C 2AROB 3MGQA 1M18D 3AZKC 1P3GC 4M6BA 1HQ3B 3KXBB 2FJ7D 4Z5TB 5DNMC 1P3LB 3KUYC 3WTPE 3TU4C 3AZIB 3VH6A 4H9RA 5FUGB 1P3OD 3AZHC 3NQUA 2HUEB 2W8SA 4XUJC 1S32D 4KHAA 5F99B 3REKB 3C1CA 5AVBA 3EPKA 3NQJA 4G91C 5GT0C 2ZY2A 3C1BC 5CPKA 5JRGB 1W2EA 4H9SA 1P3AA 5B2JB 1Z2CB 5GXQC 1M1AA 2BG1A 2PYOC 3WTPA 3LJAC 4X23A 3O62D 3MGQD 3F6TA 5DNNA 3MGRB 3WA9A 3MVDA 2LY8A 3H0RC 5B31B 5BT1C 1ID3D 1F66B 5CHLB 5JA4B 3KWQB 4H9PB 4E45A 2XD5A 4YM6C 3LZ0C 3C1CD 5AVBD 5B40C 4UUZB 3REJB 4YS3A 1M19B 4J8VC 5CPKD 3X1TA 2F8NB 2Y2GA 4H9NB 1P3AD 3VH6W 4KGCB 5AV6B 4J8UC 3AV2A 4JJNA 1P3BA 1M1AD 3WKJA 3WTPD 3X1SA 4X23D 1P3KA 3W97A 5B32C 5DNND 3AZFC 3WA9D 3X1UC 4G92B 3AV1A 1P3MD 3MVDD 4XZQA 3UTAC 3VH5T 1M18C 5GSUB 4CSRB 3H0MC 2YFWA 4WZSB 5B33A 2BYKA 3X1VB 1P3OC 1KX4A 1P3ID 5AY8C 3B6FA 5B2IA 4WU9B 1AOIA 4YS3D 5CPIA 5B1LA 1N1JB 3REIB 1KX5A 2Y2KA 3MGSB 5AV8A 3X1TD 3LZ1B 2NZDA 5GT3C 3AV2D 5B0YA 3AZKB 1P3GB 1P3BD 3WAAA 1KU5A 3WKJD 2CV5A 2BYMA 3X1SD 4R8PA 2JSSA 5DNMB 3KUYB 4J8WA 3REHC 1P3KD 3TU4B 3W97D 3AZHB 3UTBA 3AV1D 4XUJB 4XZQD 4H9QB 3W98A 3AZMA 3A1KA 3AZNC 1F1EA 2F8NH 5BNVA 4G91B 5GT0B 3C1BB 1P3PC 1JFIA 5AV9C 3AZGA 3AZJC 4WNNA 5B33D 3AZLA 5CPJC 1P3FC 1KX4D 3V9RB 3B6FD 5B2ID 2RIQA 5GXQB 5CPID 1AOID 2PYOB 1KX5D 3LJAB 1BH9A 5AV5C 5CP6A 4ZBJC 4QLCC 5BS7A 4WU8C 2NZDD 5B0YD 4J8XC 3WAAD 4H9SC 1P3AC 2CV5D 4R8PD 4J8WD 4EO5C 3KXBA 4Z5TA 3MGPC 3UTBD 3RELD 3AZIA 3W98D 4KUDC 3LELC 5FUGA 3P5JB 3KFUG 3AZMD 4YM6B 5B40B 3LZ0B 1P34A 5F99A 3REKA 1R4VA 5BNXB 4J8VB 3MNNC 3AZGD 3AYWB 3AZLD 2Y2HA 4J8UB 4ZUXC 1KX3C 5B2JA 5CP6D 1ID3A 2ZY3A 5B32B 3AZFB 3X1UB 3AFAC 5G49B 1U35C 3VH6T 3UTAB 1M18B 4NFTA 1TZYA 5B31A 4JJNC 5E5AC 3KXBD 4Z5TD 2L5AA 3AZID 1F66A 3W99C 3AZEC 5JA4A 1P3OB 3KWQA 3AV1C 4H9PA 1P34D 5AY8B 5F99D 3REKD 4CAYB 4UUZA 3REJA 1M19A 5GT3B 5B32G 2F8NA 4H9NA 1P3MA 4KGCA 1A7WA 5AV6A 5B2JD 1KX4C 2FFFB 3REHB 1AOIC 3EG5B 4WJ3C 5B1LC 5AV8C 5B1MC 4Z66C 5KDMB 3AZNB 1ZLAC 1TZYD 5B31D 3AN2C 3WAAC 4E44A 1P3IA 1EQZC 1P3PB 4AWLC 4H9OA 5AV9B 5B0ZC 1F66D 4WV4B 4H9RB 4CSRA 3AZJB 3KWQD 2ZM5A 5CPJB 1P3FB 3W98C 3X1VA 3REJD 5AV5B 1M19D 1N1JA 4ZBJB 4QLCB 3A6NA 4WU8B 2HIOC 3LZ1A 2F8ND 1BFMA 5AVCC 4J8XB 4KGCD 5AV6D 2Y2IA 1P3AB 3W96B 3AZKA 1P3GA 2JE5A 2F8NK 4EO5B 2NQBA 5DNMA 3IP4C 3MGPB 3KUYA 3UT9B 2CWEA 2FJ7C 2JCHA 4KUDB 3LELB 3AZHA 4XUJA 2G5HC 4H9QA 1S32C 4LD9A 1TAFB 5B24A 5GT0A 3MNNB 3C1BA 3X1VD 2DF4C 4ZUXB 1KX3B 1P34C 2PYOA 3REID 4DRBA 3LJAA 3A6ND 3LZ1D 3AFAB 5C3IC 3O62C 3RELA 3MGQC 1U35B 2DQNC 3AZKD 1T3UA 1P3GD 4JJNB 5E5AB 2NQBD 5DNMD 3KUYD 1ID3C 3B6GA 4DRAA 3W99B 3AZHD 3AZEB 4XUJD 3AV1B 4LD9D 4YM6A 3LZ0A 1TZYC 5B24D 3H0LC 3C1CC 5AVBC 5GT0D 3C1BD 2Y2JA 4J8VA 5CPKC 3AYWA 2AROA 1H3OB 1HTAA 3AL0C 2BYKB 1KX4B 1WWIA 2F2AC 2IO5C 4DQYB 1HQ3A 2PYOD 3LJAD 1M1AC 5B1LB 3FDDA 3WTPC 5AV8B 1P3LA 4X23C 5B1MB 2RVQD 4Z66B 5B32A 3X1UA
chains in the Genus database with same CATH topology
5G49A 5DNNC 3WA9C 1ZLAB 3AN2B 1P3MC 3MVDC 3UTAA 3WAAB 1EQZB 2BYMB 5BT1D 4AWLB 5B0ZB 3B6GD 1BH8B 5JRGA 4YM6D 3LZ0D 4HGAC 3B0CW 5AY8A 1P3IC 3R45B 4YS3C 4J8VD 2HIOB 3AYWD 2AROD 5AVCB 3X1TC 4WNNB 5GT3A 2Y2MA 4UPKA 5BO0B 3MGRA 3AV2C 4NE6A 1HQ3D 1P3BC 3WKJC 3REHA 1P3LD 3X1SC 2FJ7B 1P3KC 1ULYA 5B32D 3A6NC 3X1UD 3W97C 5KDMA 2Y2NA 3UTAD 4NE5A 4XZQC 1S32B 3AZNA 3B0DC 2Y2OA 2NQBC 1P3PA 5AV9A 5JRGD 3AZJA 5CPJA 1P3FA 1Q9CA 5B33C 2YFVB 5AY8D 4NE3A 1P34B 3EPLA 3B6FC 5B2IC 4LD9C 5CPIC 5AV5A 5B24C 1KX5C 3EPJA 2J8PA 4QLCA 5C3IB 4WU8A 3O62B 3MGQB 5GT3D 3MGRD 2NZDC 4J8XA 5B0YC 3W96A 2CV5C 3REHD 2G5IC 4R8PC 4J8WC 1ID3B 5GSUA 3MGPA 3UT9A 3NQUB 2RVQC 3LELA 3RELC 3UTBC 4KUDA 3AZND 1TZYB 4KHAB 3AZMC 3C1CB 5AVBB 4WU9A 1TAFA 1P3PD 3NQJB 4Z2MG 3REIA 5AV9D 3MGSA 3MNNA 3B6GC 5CPKB 3AZJD 5CPJD 3AZGC 1P3FD 3AZLC 2IO5B 4ZUXA 1KX3A 2Y2QA 1M1AB 5AV5D 1WWSA 3WTPB 4X23B 4QLCD 5CP6C 3TU4A 4WU8D 5BS7C 5DNNB 3AFAA 3WA9B 1PZRA 4J8XD 3AYWC 1U35A 2AROC 1P3MB 3MVDB 3W96D 2VQRA 5E5AA 1HQ3C 5B31G 5GSUD 3KXBC 3MGPD 4Z5TC 3UT9D 1P3LC 3W99A 4KUDD 3LELD 4Z2MH 3AZIC 3AZEA 3VH5A 2HUEC 4HGAB 3V9RA 1P3IB 4WU9D 2Y2LA 5GXQA 5F99C 3REKC 4YS3B 4H9OB 3MGSD 3MNND 3X1TB 5JRGC 1H3OA 3AV2B 2ZY5A 4ZUXD 1KX3D 3B0CT 1P3BB 2F8NG 5B2JC 3WKJB 3X1SB 1P3KB 3TU4D 3A1IA 3A6NB 3W97B 3AFAD 5B1MA 1U35D 4Z66A 4XZQB 3MGRC 1ZLAA 3B0DB 4JJND 3AN2A 5B40A 5B31C 5E5AD 1EQZA 2NQBB 5BNXA 5B0ZA 1BH8A 3W99D 1F66C 2YFWB 3AZED 5B33B 3KWQC 4J8UA 3KSYA 5GXQD 3B6FB 5B2IB 4LD9B 1AOIB 5CPIB 5B24B 1KX5B 3R45A 2Y2PA 3REJC 1M19C 2HIOA 3AZFA 2NZDB 5AVCA 5B0YB 5BO0A 4KGCC 5AV6C 1M18A 3VH5W 2UWXA 2CV5B 2ZY4A 4R8PB 5B1LD 4J8WB 5AV8D 2XD1A 2FJ7A 5B1MD 4Z66D 3UTBB 3RELB 3W98B 1ZLAD 1P3OA 4G92C 3AN2D 5B40D 3AZMB 1B6WA 1S32A 1EQZD 3W96C 5BNVB 4CAYA 5B0ZD 1JFIB 3B6GB 5GSUC 3EPHA 3AZGB 3UT9C 3AZLB 4J8UD 1B67A 2YFVA 3X1VC 3B0BA 1BH9B 4WU9C 5CP6B 3REIC 2HIOD 3AZFD 3MGSC 5AVCD 3O62A 3LZ1C 2AROB 3MGQA 1M18D 3AZKC 1P3GC 4M6BA 1HQ3B 3KXBB 2FJ7D 4Z5TB 5DNMC 1P3LB 3KUYC 3WTPE 3TU4C 3AZIB 3VH6A 4H9RA 5FUGB 1P3OD 3AZHC 3NQUA 2HUEB 2W8SA 4XUJC 1S32D 4KHAA 5F99B 3REKB 3C1CA 5AVBA 3EPKA 3NQJA 4G91C 5GT0C 2ZY2A 3C1BC 5CPKA 5JRGB 1W2EA 4H9SA 1P3AA 5B2JB 1Z2CB 5GXQC 1M1AA 2BG1A 2PYOC 3WTPA 3LJAC 4X23A 3O62D 3MGQD 3F6TA 5DNNA 3MGRB 3WA9A 3MVDA 2LY8A 3H0RC 5B31B 5BT1C 1ID3D 1F66B 5CHLB 5JA4B 3KWQB 4H9PB 4E45A 2XD5A 4YM6C 3LZ0C 3C1CD 5AVBD 5B40C 4UUZB 3REJB 4YS3A 1M19B 4J8VC 5CPKD 3X1TA 2F8NB 2Y2GA 4H9NB 1P3AD 3VH6W 4KGCB 5AV6B 4J8UC 3AV2A 4JJNA 1P3BA 1M1AD 3WKJA 3WTPD 3X1SA 4X23D 1P3KA 3W97A 5B32C 5DNND 3AZFC 3WA9D 3X1UC 4G92B 3AV1A 1P3MD 3MVDD 4XZQA 3UTAC 3VH5T 1M18C 5GSUB 4CSRB 3H0MC 2YFWA 4WZSB 5B33A 2BYKA 3X1VB 1P3OC 1KX4A 1P3ID 5AY8C 3B6FA 5B2IA 4WU9B 1AOIA 4YS3D 5CPIA 5B1LA 1N1JB 3REIB 1KX5A 2Y2KA 3MGSB 5AV8A 3X1TD 3LZ1B 2NZDA 5GT3C 3AV2D 5B0YA 3AZKB 1P3GB 1P3BD 3WAAA 1KU5A 3WKJD 2CV5A 2BYMA 3X1SD 4R8PA 2JSSA 5DNMB 3KUYB 4J8WA 3REHC 1P3KD 3TU4B 3W97D 3AZHB 3UTBA 3AV1D 4XUJB 4XZQD 4H9QB 3W98A 3AZMA 3A1KA 3AZNC 1F1EA 2F8NH 5BNVA 4G91B 5GT0B 3C1BB 1P3PC 1JFIA 5AV9C 3AZGA 3AZJC 4WNNA 5B33D 3AZLA 5CPJC 1P3FC 1KX4D 3V9RB 3B6FD 5B2ID 2RIQA 5GXQB 5CPID 1AOID 2PYOB 1KX5D 3LJAB 1BH9A 5AV5C 5CP6A 4ZBJC 4QLCC 5BS7A 4WU8C 2NZDD 5B0YD 4J8XC 3WAAD 4H9SC 1P3AC 2CV5D 4R8PD 4J8WD 4EO5C 3KXBA 4Z5TA 3MGPC 3UTBD 3RELD 3AZIA 3W98D 4KUDC 3LELC 5FUGA 3P5JB 3KFUG 3AZMD 4YM6B 5B40B 3LZ0B 1P34A 5F99A 3REKA 1R4VA 5BNXB 4J8VB 3MNNC 3AZGD 3AYWB 3AZLD 2Y2HA 4J8UB 4ZUXC 1KX3C 5B2JA 5CP6D 1ID3A 2ZY3A 5B32B 3AZFB 3X1UB 3AFAC 5G49B 1U35C 3VH6T 3UTAB 1M18B 4NFTA 1TZYA 5B31A 4JJNC 5E5AC 3KXBD 4Z5TD 2L5AA 3AZID 1F66A 3W99C 3AZEC 5JA4A 1P3OB 3KWQA 3AV1C 4H9PA 1P34D 5AY8B 5F99D 3REKD 4CAYB 4UUZA 3REJA 1M19A 5GT3B 5B32G 2F8NA 4H9NA 1P3MA 4KGCA 1A7WA 5AV6A 5B2JD 1KX4C 2FFFB 3REHB 1AOIC 3EG5B 4WJ3C 5B1LC 5AV8C 5B1MC 4Z66C 5KDMB 3AZNB 1ZLAC 1TZYD 5B31D 3AN2C 3WAAC 4E44A 1P3IA 1EQZC 1P3PB 4AWLC 4H9OA 5AV9B 5B0ZC 1F66D 4WV4B 4H9RB 4CSRA 3AZJB 3KWQD 2ZM5A 5CPJB 1P3FB 3W98C 3X1VA 3REJD 5AV5B 1M19D 1N1JA 4ZBJB 4QLCB 3A6NA 4WU8B 2HIOC 3LZ1A 2F8ND 1BFMA 5AVCC 4J8XB 4KGCD 5AV6D 2Y2IA 1P3AB 3W96B 3AZKA 1P3GA 2JE5A 2F8NK 4EO5B 2NQBA 5DNMA 3IP4C 3MGPB 3KUYA 3UT9B 2CWEA 2FJ7C 2JCHA 4KUDB 3LELB 3AZHA 4XUJA 2G5HC 4H9QA 1S32C 4LD9A 1TAFB 5B24A 5GT0A 3MNNB 3C1BA 3X1VD 2DF4C 4ZUXB 1KX3B 1P34C 2PYOA 3REID 4DRBA 3LJAA 3A6ND 3LZ1D 3AFAB 5C3IC 3O62C 3RELA 3MGQC 1U35B 2DQNC 3AZKD 1T3UA 1P3GD 4JJNB 5E5AB 2NQBD 5DNMD 3KUYD 1ID3C 3B6GA 4DRAA 3W99B 3AZHD 3AZEB 4XUJD 3AV1B 4LD9D 4YM6A 3LZ0A 1TZYC 5B24D 3H0LC 3C1CC 5AVBC 5GT0D 3C1BD 2Y2JA 4J8VA 5CPKC 3AYWA 2AROA 1H3OB 1HTAA 3AL0C 2BYKB 1KX4B 1WWIA 2F2AC 2IO5C 4DQYB 1HQ3A 2PYOD 3LJAD 1M1AC 5B1LB 3FDDA 3WTPC 5AV8B 1P3LA 4X23C 5B1MB 2RVQD 4Z66B 5B32A 3X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G49 A;  5DNN C;  3WA9 C;  1ZLA B;  3AN2 B;  1P3M C;  3MVD C;  3UTA A;  3WAA B;  1EQZ B;  2BYM B;  5BT1 D;  4AWL B;  5B0Z B;  3B6G D;  1BH8 B;  5JRG A;  4YM6 D;  3LZ0 D;  4HGA C;  3B0C W;  5AY8 A;  1P3I C;  3R45 B;  4YS3 C;  4J8V D;  2HIO B;  3AYW D;  2ARO D;  5AVC B;  3X1T C;  4WNN B;  5GT3 A;  5BO0 B;  3MGR A;  3AV2 C;  4NE6 A;  1HQ3 D;  1P3B C;  3WKJ C;  3REH A;  1P3L D;  3X1S C;  2FJ7 B;  1P3K C;  1ULY A;  5B32 D;  3A6N C;  3X1U D;  3W97 C;  5KDM A;  3UTA D;  4NE5 A;  4XZQ C;  1S32 B;  3AZN A;  3B0D C;  2NQB C;  1P3P A;  5AV9 A;  5JRG D;  3AZJ A;  5CPJ A;  1P3F A;  1Q9C A;  5B33 C;  2YFV B;  5AY8 D;  4NE3 A;  1P34 B;  3B6F C;  5B2I C;  4LD9 C;  5CPI C;  5AV5 A;  5B24 C;  1KX5 C;  4QLC A;  5C3I B;  4WU8 A;  3O62 B;  3MGQ B;  5GT3 D;  3MGR D;  2NZD C;  4J8X A;  5B0Y C;  3W96 A;  2CV5 C;  3REH D;  4R8P C;  4J8W C;  1ID3 B;  5GSU A;  3MGP A;  3UT9 A;  3NQU B;  2RVQ C;  3LEL A;  3REL C;  3UTB C;  4KUD A;  3AZN D;  1TZY B;  4KHA B;  3AZM C;  3C1C B;  5AVB B;  4WU9 A;  1TAF A;  1P3P D;  3NQJ B;  4Z2M G;  3REI A;  5AV9 D;  3MGS A;  3MNN A;  3B6G C;  5CPK B;  3AZJ D;  5CPJ D;  3AZG C;  1P3F D;  3AZL C;  2IO5 B;  4ZUX A;  1KX3 A;  1M1A B;  5AV5 D;  1WWS A;  3WTP B;  4X23 B;  4QLC D;  5CP6 C;  3TU4 A;  4WU8 D;  5BS7 C;  5DNN B;  3AFA A;  3WA9 B;  4J8X D;  3AYW C;  1U35 A;  2ARO C;  1P3M B;  3MVD B;  3W96 D;  5E5A A;  1HQ3 C;  5B31 G;  5GSU D;  3KXB C;  3MGP D;  4Z5T C;  3UT9 D;  1P3L C;  3W99 A;  4KUD D;  3LEL D;  4Z2M H;  3AZI C;  3AZE A;  3VH5 A;  2HUE C;  4HGA B;  3V9R A;  1P3I B;  4WU9 D;  5GXQ A;  5F99 C;  3REK C;  4YS3 B;  4H9O B;  3MGS D;  3MNN D;  3X1T B;  5JRG C;  1H3O A;  3AV2 B;  4ZUX D;  1KX3 D;  3B0C T;  1P3B B;  2F8N G;  5B2J C;  3WKJ B;  3X1S B;  1P3K B;  3TU4 D;  3A6N B;  3W97 B;  3AFA D;  5B1M A;  1U35 D;  4Z66 A;  4XZQ B;  3MGR C;  1ZLA A;  3B0D B;  4JJN D;  3AN2 A;  5B40 A;  5B31 C;  5E5A D;  1EQZ A;  2NQB B;  5BNX A;  5B0Z A;  1BH8 A;  3W99 D;  1F66 C;  2YFW B;  3AZE D;  5B33 B;  3KWQ C;  4J8U A;  3KSY A;  5GXQ D;  3B6F B;  5B2I B;  4LD9 B;  1AOI B;  5CPI B;  5B24 B;  1KX5 B;  3R45 A;  3REJ C;  1M19 C;  2HIO A;  3AZF A;  2NZD B;  5AVC A;  5B0Y B;  5BO0 A;  4KGC C;  5AV6 C;  1M18 A;  3VH5 W;  2CV5 B;  4R8P B;  5B1L D;  4J8W B;  5AV8 D;  2FJ7 A;  5B1M D;  4Z66 D;  3UTB B;  3REL B;  3W98 B;  1ZLA D;  1P3O A;  4G92 C;  3AN2 D;  5B40 D;  3AZM B;  1B6W A;  1S32 A;  1EQZ D;  3W96 C;  5BNV B;  4CAY A;  5B0Z D;  1JFI B;  3B6G B;  5GSU C;  3AZG B;  3UT9 C;  3AZL B;  4J8U D;  1B67 A;  2YFV A;  3X1V C;  3B0B A;  1BH9 B;  4WU9 C;  5CP6 B;  3REI C;  2HIO D;  3AZF D;  3MGS C;  5AVC D;  3O62 A;  3LZ1 C;  2ARO B;  3MGQ A;  1M18 D;  3AZK C;  1P3G C;  4M6B A;  1HQ3 B;  3KXB B;  2FJ7 D;  4Z5T B;  5DNM C;  1P3L B;  3KUY C;  3WTP E;  3TU4 C;  3AZI B;  3VH6 A;  4H9R A;  5FUG B;  1P3O D;  3AZH C;  3NQU A;  2HUE B;  4XUJ C;  1S32 D;  4KHA A;  5F99 B;  3REK B;  3C1C A;  5AVB A;  3NQJ A;  4G91 C;  5GT0 C;  3C1B C;  5CPK A;  5JRG B;  4H9S A;  1P3A A;  5B2J B;  5GXQ C;  1M1A A;  2PYO C;  3WTP A;  3LJA C;  4X23 A;  3O62 D;  3MGQ D;  5DNN A;  3MGR B;  3WA9 A;  3MVD A;  2LY8 A;  5B31 B;  5BT1 C;  1ID3 D;  1F66 B;  5CHL B;  5JA4 B;  3KWQ B;  4H9P B;  4E45 A;  4YM6 C;  3LZ0 C;  3C1C D;  5B40 C;  5AVB D;  4UUZ B;  3REJ B;  4YS3 A;  1M19 B;  4J8V C;  5CPK D;  3X1T A;  2F8N B;  4H9N B;  1P3A D;  3VH6 W;  4KGC B;  5AV6 B;  4J8U C;  3AV2 A;  4JJN A;  1P3B A;  1M1A D;  3WKJ A;  3WTP D;  3X1S A;  4X23 D;  1P3K A;  3W97 A;  5B32 C;  5DNN D;  3AZF C;  3WA9 D;  3X1U C;  4G92 B;  3AV1 A;  1P3M D;  3MVD D;  4XZQ A;  3UTA C;  3VH5 T;  1M18 C;  5GSU B;  4CSR B;  2YFW A;  4WZS B;  5B33 A;  2BYK A;  3X1V B;  1P3O C;  1KX4 A;  1P3I D;  5AY8 C;  3B6F A;  5B2I A;  4WU9 B;  1AOI A;  4YS3 D;  5CPI A;  5B1L A;  1N1J B;  3REI B;  1KX5 A;  3MGS B;  5AV8 A;  3X1T D;  3LZ1 B;  2NZD A;  5GT3 C;  3AV2 D;  5B0Y A;  3AZK B;  1P3G B;  1P3B D;  3WAA A;  1KU5 A;  3WKJ D;  2CV5 A;  2BYM A;  3X1S D;  4R8P A;  2JSS A;  5DNM B;  3KUY B;  4J8W A;  3REH C;  1P3K D;  3TU4 B;  3W97 D;  3AZH B;  3UTB A;  3AV1 D;  4XUJ B;  4XZQ D;  4H9Q B;  3W98 A;  3AZM A;  3AZN C;  1F1E A;  2F8N H;  5BNV A;  4G91 B;  5GT0 B;  3C1B B;  1P3P C;  1JFI A;  5AV9 C;  3AZG A;  3AZJ C;  4WNN A;  5B33 D;  3AZL A;  5CPJ C;  1P3F C;  1KX4 D;  3V9R B;  3B6F D;  5B2I D;  5GXQ B;  1AOI D;  5CPI D;  2PYO B;  1KX5 D;  3LJA B;  1BH9 A;  5AV5 C;  5CP6 A;  4ZBJ C;  4QLC C;  5BS7 A;  4WU8 C;  2NZD D;  5B0Y D;  4J8X C;  3WAA D;  4H9S C;  1P3A C;  2CV5 D;  4R8P D;  4J8W D;  4EO5 C;  3KXB A;  4Z5T A;  3MGP C;  3UTB D;  3REL D;  3AZI A;  3W98 D;  4KUD C;  3LEL C;  5FUG A;  3AZM D;  4YM6 B;  5B40 B;  3LZ0 B;  1P34 A;  5F99 A;  3REK A;  1R4V A;  5BNX B;  4J8V B;  3MNN C;  3AZG D;  3AYW B;  3AZL D;  4J8U B;  4ZUX C;  1KX3 C;  5B2J A;  5CP6 D;  1ID3 A;  5B32 B;  3AZF B;  3X1U B;  3AFA C;  5G49 B;  1U35 C;  3VH6 T;  3UTA B;  1M18 B;  4NFT A;  1TZY A;  5B31 A;  4JJN C;  5E5A C;  3KXB D;  4Z5T D;  2L5A A;  3AZI D;  1F66 A;  3W99 C;  3AZE C;  5JA4 A;  1P3O B;  3KWQ A;  3AV1 C;  4H9P A;  1P34 D;  5AY8 B;  5F99 D;  3REK D;  4CAY B;  4UUZ A;  3REJ A;  1M19 A;  5GT3 B;  5B32 G;  2F8N A;  4H9N A;  1P3M A;  4KGC A;  1A7W A;  5AV6 A;  5B2J D;  1KX4 C;  3REH B;  1AOI C;  5B1L C;  5AV8 C;  5B1M C;  4Z66 C;  5KDM B;  3AZN B;  1ZLA C;  1TZY D;  5B31 D;  3AN2 C;  3WAA C;  4E44 A;  1P3I A;  1EQZ C;  1P3P B;  4AWL C;  4H9O A;  5AV9 B;  5B0Z C;  1F66 D;  4WV4 B;  4H9R B;  4CSR A;  3AZJ B;  3KWQ D;  5CPJ B;  1P3F B;  3W98 C;  3X1V A;  3REJ D;  5AV5 B;  1M19 D;  1N1J A;  4ZBJ B;  4QLC B;  3A6N A;  4WU8 B;  2HIO C;  3LZ1 A;  2F8N D;  1BFM A;  5AVC C;  4J8X B;  4KGC D;  5AV6 D;  1P3A B;  3W96 B;  3AZK A;  1P3G A;  2F8N K;  4EO5 B;  2NQB A;  5DNM A;  3MGP B;  3KUY A;  3UT9 B;  2CWE A;  2FJ7 C;  4KUD B;  3LEL B;  3AZH A;  4XUJ A;  4H9Q A;  1S32 C;  4LD9 A;  1TAF B;  5B24 A;  5GT0 A;  3MNN B;  3C1B A;  3X1V D;  4ZUX B;  1KX3 B;  1P34 C;  2PYO A;  3REI D;  4DRB A;  3LJA A;  3A6N D;  3LZ1 D;  3AFA B;  5C3I C;  3O62 C;  3REL A;  3MGQ C;  1U35 B;  3AZK D;  1P3G D;  4JJN B;  5E5A B;  2NQB D;  5DNM D;  3KUY D;  1ID3 C;  3B6G A;  4DRA A;  3W99 B;  3AZH D;  3AZE B;  4XUJ D;  3AV1 B;  4LD9 D;  4YM6 A;  3LZ0 A;  1TZY C;  5B24 D;  3C1C C;  5AVB C;  5GT0 D;  3C1B D;  4J8V A;  5CPK C;  3AYW A;  2ARO A;  1H3O B;  1HTA A;  2BYK B;  1KX4 B;  1WWI A;  2IO5 C;  2PYO D;  1HQ3 A;  3LJA D;  1M1A C;  5B1L B;  3WTP C;  5AV8 B;  1P3L A;  4X23 C;  5B1M B;  2RVQ D;  4Z66 B;  5B32 A;  3X1U A; 
#chains in the Genus database with same CATH topology
 5G49 A;  5DNN C;  3WA9 C;  1ZLA B;  3AN2 B;  1P3M C;  3MVD C;  3UTA A;  3WAA B;  1EQZ B;  2BYM B;  5BT1 D;  4AWL B;  5B0Z B;  3B6G D;  1BH8 B;  5JRG A;  4YM6 D;  3LZ0 D;  4HGA C;  3B0C W;  5AY8 A;  1P3I C;  3R45 B;  4YS3 C;  4J8V D;  2HIO B;  3AYW D;  2ARO D;  5AVC B;  3X1T C;  4WNN B;  5GT3 A;  2Y2M A;  4UPK A;  5BO0 B;  3MGR A;  3AV2 C;  4NE6 A;  1HQ3 D;  1P3B C;  3WKJ C;  3REH A;  1P3L D;  3X1S C;  2FJ7 B;  1P3K C;  1ULY A;  5B32 D;  3A6N C;  3X1U D;  3W97 C;  5KDM A;  2Y2N A;  3UTA D;  4NE5 A;  4XZQ C;  1S32 B;  3AZN A;  3B0D C;  2Y2O A;  2NQB C;  1P3P A;  5AV9 A;  5JRG D;  3AZJ A;  5CPJ A;  1P3F A;  1Q9C A;  5B33 C;  2YFV B;  5AY8 D;  4NE3 A;  1P34 B;  3EPL A;  3B6F C;  5B2I C;  4LD9 C;  5CPI C;  5AV5 A;  5B24 C;  1KX5 C;  3EPJ A;  2J8P A;  4QLC A;  5C3I B;  4WU8 A;  3O62 B;  3MGQ B;  5GT3 D;  3MGR D;  2NZD C;  4J8X A;  5B0Y C;  3W96 A;  2CV5 C;  3REH D;  2G5I C;  4R8P C;  4J8W C;  1ID3 B;  5GSU A;  3MGP A;  3UT9 A;  3NQU B;  2RVQ C;  3LEL A;  3REL C;  3UTB C;  4KUD A;  3AZN D;  1TZY B;  4KHA B;  3AZM C;  3C1C B;  5AVB B;  4WU9 A;  1TAF A;  1P3P D;  3NQJ B;  4Z2M G;  3REI A;  5AV9 D;  3MGS A;  3MNN A;  3B6G C;  5CPK B;  3AZJ D;  5CPJ D;  3AZG C;  1P3F D;  3AZL C;  2IO5 B;  4ZUX A;  1KX3 A;  2Y2Q A;  1M1A B;  5AV5 D;  1WWS A;  3WTP B;  4X23 B;  4QLC D;  5CP6 C;  3TU4 A;  4WU8 D;  5BS7 C;  5DNN B;  3AFA A;  3WA9 B;  1PZR A;  4J8X D;  3AYW C;  1U35 A;  2ARO C;  1P3M B;  3MVD B;  3W96 D;  2VQR A;  5E5A A;  1HQ3 C;  5B31 G;  5GSU D;  3KXB C;  3MGP D;  4Z5T C;  3UT9 D;  1P3L C;  3W99 A;  4KUD D;  3LEL D;  4Z2M H;  3AZI C;  3AZE A;  3VH5 A;  2HUE C;  4HGA B;  3V9R A;  1P3I B;  4WU9 D;  2Y2L A;  5GXQ A;  5F99 C;  3REK C;  4YS3 B;  4H9O B;  3MGS D;  3MNN D;  3X1T B;  5JRG C;  1H3O A;  3AV2 B;  2ZY5 A;  4ZUX D;  1KX3 D;  3B0C T;  1P3B B;  2F8N G;  5B2J C;  3WKJ B;  3X1S B;  1P3K B;  3TU4 D;  3A1I A;  3A6N B;  3W97 B;  3AFA D;  5B1M A;  1U35 D;  4Z66 A;  4XZQ B;  3MGR C;  1ZLA A;  3B0D B;  4JJN D;  3AN2 A;  5B40 A;  5B31 C;  5E5A D;  1EQZ A;  2NQB B;  5BNX A;  5B0Z A;  1BH8 A;  3W99 D;  1F66 C;  2YFW B;  3AZE D;  5B33 B;  3KWQ C;  4J8U A;  3KSY A;  5GXQ D;  3B6F B;  5B2I B;  4LD9 B;  1AOI B;  5CPI B;  5B24 B;  1KX5 B;  3R45 A;  2Y2P A;  3REJ C;  1M19 C;  2HIO A;  3AZF A;  2NZD B;  5AVC A;  5B0Y B;  5BO0 A;  4KGC C;  5AV6 C;  1M18 A;  3VH5 W;  2UWX A;  2CV5 B;  2ZY4 A;  4R8P B;  5B1L D;  4J8W B;  5AV8 D;  2XD1 A;  2FJ7 A;  5B1M D;  4Z66 D;  3UTB B;  3REL B;  3W98 B;  1ZLA D;  1P3O A;  4G92 C;  3AN2 D;  5B40 D;  3AZM B;  1B6W A;  1S32 A;  1EQZ D;  3W96 C;  5BNV B;  4CAY A;  5B0Z D;  1JFI B;  3B6G B;  5GSU C;  3EPH A;  3AZG B;  3UT9 C;  3AZL B;  4J8U D;  1B67 A;  2YFV A;  3X1V C;  3B0B A;  1BH9 B;  4WU9 C;  5CP6 B;  3REI C;  2HIO D;  3AZF D;  3MGS C;  5AVC D;  3O62 A;  3LZ1 C;  2ARO B;  3MGQ A;  1M18 D;  3AZK C;  1P3G C;  4M6B A;  1HQ3 B;  3KXB B;  2FJ7 D;  4Z5T B;  5DNM C;  1P3L B;  3KUY C;  3WTP E;  3TU4 C;  3AZI B;  3VH6 A;  4H9R A;  5FUG B;  1P3O D;  3AZH C;  3NQU A;  2HUE B;  2W8S A;  4XUJ C;  1S32 D;  4KHA A;  5F99 B;  3REK B;  3C1C A;  5AVB A;  3EPK A;  3NQJ A;  4G91 C;  5GT0 C;  2ZY2 A;  3C1B C;  5CPK A;  5JRG B;  1W2E A;  4H9S A;  1P3A A;  5B2J B;  1Z2C B;  5GXQ C;  1M1A A;  2BG1 A;  2PYO C;  3WTP A;  3LJA C;  4X23 A;  3O62 D;  3MGQ D;  3F6T A;  5DNN A;  3MGR B;  3WA9 A;  3MVD A;  2LY8 A;  3H0R C;  5B31 B;  5BT1 C;  1ID3 D;  1F66 B;  5CHL B;  5JA4 B;  3KWQ B;  4H9P B;  4E45 A;  2XD5 A;  4YM6 C;  3LZ0 C;  3C1C D;  5AVB D;  5B40 C;  4UUZ B;  3REJ B;  4YS3 A;  1M19 B;  4J8V C;  5CPK D;  3X1T A;  2F8N B;  2Y2G A;  4H9N B;  1P3A D;  3VH6 W;  4KGC B;  5AV6 B;  4J8U C;  3AV2 A;  4JJN A;  1P3B A;  1M1A D;  3WKJ A;  3WTP D;  3X1S A;  4X23 D;  1P3K A;  3W97 A;  5B32 C;  5DNN D;  3AZF C;  3WA9 D;  3X1U C;  4G92 B;  3AV1 A;  1P3M D;  3MVD D;  4XZQ A;  3UTA C;  3VH5 T;  1M18 C;  5GSU B;  4CSR B;  3H0M C;  2YFW A;  4WZS B;  5B33 A;  2BYK A;  3X1V B;  1P3O C;  1KX4 A;  1P3I D;  5AY8 C;  3B6F A;  5B2I A;  4WU9 B;  1AOI A;  4YS3 D;  5CPI A;  5B1L A;  1N1J B;  3REI B;  1KX5 A;  2Y2K A;  3MGS B;  5AV8 A;  3X1T D;  3LZ1 B;  2NZD A;  5GT3 C;  3AV2 D;  5B0Y A;  3AZK B;  1P3G B;  1P3B D;  3WAA A;  1KU5 A;  3WKJ D;  2CV5 A;  2BYM A;  3X1S D;  4R8P A;  2JSS A;  5DNM B;  3KUY B;  4J8W A;  3REH C;  1P3K D;  3TU4 B;  3W97 D;  3AZH B;  3UTB A;  3AV1 D;  4XUJ B;  4XZQ D;  4H9Q B;  3W98 A;  3AZM A;  3A1K A;  3AZN C;  1F1E A;  2F8N H;  5BNV A;  4G91 B;  5GT0 B;  3C1B B;  1P3P C;  1JFI A;  5AV9 C;  3AZG A;  3AZJ C;  4WNN A;  5B33 D;  3AZL A;  5CPJ C;  1P3F C;  1KX4 D;  3V9R B;  3B6F D;  5B2I D;  2RIQ A;  5GXQ B;  5CPI D;  1AOI D;  2PYO B;  1KX5 D;  3LJA B;  1BH9 A;  5AV5 C;  5CP6 A;  4ZBJ C;  4QLC C;  5BS7 A;  4WU8 C;  2NZD D;  5B0Y D;  4J8X C;  3WAA D;  4H9S C;  1P3A C;  2CV5 D;  4R8P D;  4J8W D;  4EO5 C;  3KXB A;  4Z5T A;  3MGP C;  3UTB D;  3REL D;  3AZI A;  3W98 D;  4KUD C;  3LEL C;  5FUG A;  3P5J B;  3KFU G;  3AZM D;  4YM6 B;  5B40 B;  3LZ0 B;  1P34 A;  5F99 A;  3REK A;  1R4V A;  5BNX B;  4J8V B;  3MNN C;  3AZG D;  3AYW B;  3AZL D;  2Y2H A;  4J8U B;  4ZUX C;  1KX3 C;  5B2J A;  5CP6 D;  1ID3 A;  2ZY3 A;  5B32 B;  3AZF B;  3X1U B;  3AFA C;  5G49 B;  1U35 C;  3VH6 T;  3UTA B;  1M18 B;  4NFT A;  1TZY A;  5B31 A;  4JJN C;  5E5A C;  3KXB D;  4Z5T D;  2L5A A;  3AZI D;  1F66 A;  3W99 C;  3AZE C;  5JA4 A;  1P3O B;  3KWQ A;  3AV1 C;  4H9P A;  1P34 D;  5AY8 B;  5F99 D;  3REK D;  4CAY B;  4UUZ A;  3REJ A;  1M19 A;  5GT3 B;  5B32 G;  2F8N A;  4H9N A;  1P3M A;  4KGC A;  1A7W A;  5AV6 A;  5B2J D;  1KX4 C;  2FFF B;  3REH B;  1AOI C;  3EG5 B;  4WJ3 C;  5B1L C;  5AV8 C;  5B1M C;  4Z66 C;  5KDM B;  3AZN B;  1ZLA C;  1TZY D;  5B31 D;  3AN2 C;  3WAA C;  4E44 A;  1P3I A;  1EQZ C;  1P3P B;  4AWL C;  4H9O A;  5AV9 B;  5B0Z C;  1F66 D;  4WV4 B;  4H9R B;  4CSR A;  3AZJ B;  3KWQ D;  2ZM5 A;  5CPJ B;  1P3F B;  3W98 C;  3X1V A;  3REJ D;  5AV5 B;  1M19 D;  1N1J A;  4ZBJ B;  4QLC B;  3A6N A;  4WU8 B;  2HIO C;  3LZ1 A;  2F8N D;  1BFM A;  5AVC C;  4J8X B;  4KGC D;  5AV6 D;  2Y2I A;  1P3A B;  3W96 B;  3AZK A;  1P3G A;  2JE5 A;  2F8N K;  4EO5 B;  2NQB A;  5DNM A;  3IP4 C;  3MGP B;  3KUY A;  3UT9 B;  2CWE A;  2FJ7 C;  2JCH A;  4KUD B;  3LEL B;  3AZH A;  4XUJ A;  2G5H C;  4H9Q A;  1S32 C;  4LD9 A;  1TAF B;  5B24 A;  5GT0 A;  3MNN B;  3C1B A;  3X1V D;  2DF4 C;  4ZUX B;  1KX3 B;  1P34 C;  2PYO A;  3REI D;  4DRB A;  3LJA A;  3A6N D;  3LZ1 D;  3AFA B;  5C3I C;  3O62 C;  3REL A;  3MGQ C;  1U35 B;  2DQN C;  3AZK D;  1T3U A;  1P3G D;  4JJN B;  5E5A B;  2NQB D;  5DNM D;  3KUY D;  1ID3 C;  3B6G A;  4DRA A;  3W99 B;  3AZH D;  3AZE B;  4XUJ D;  3AV1 B;  4LD9 D;  4YM6 A;  3LZ0 A;  1TZY C;  5B24 D;  3H0L C;  3C1C C;  5AVB C;  5GT0 D;  3C1B D;  2Y2J A;  4J8V A;  5CPK C;  3AYW A;  2ARO A;  1H3O B;  1HTA A;  3AL0 C;  2BYK B;  1KX4 B;  1WWI A;  2F2A C;  2IO5 C;  4DQY B;  1HQ3 A;  2PYO D;  3LJA D;  1M1A C;  5B1L B;  3FDD A;  3WTP C;  5AV8 B;  1P3L A;  4X23 C;  5B1M B;  2RVQ D;  4Z66 B;  5B32 A;  3X1U A; 
#chains in the Genus database with same CATH homology
 5G49 A;  5DNN C;  3WA9 C;  1ZLA B;  3AN2 B;  1P3M C;  3MVD C;  3UTA A;  3WAA B;  1EQZ B;  2BYM B;  5BT1 D;  4AWL B;  5B0Z B;  3B6G D;  1BH8 B;  5JRG A;  4YM6 D;  3LZ0 D;  4HGA C;  3B0C W;  5AY8 A;  1P3I C;  3R45 B;  4YS3 C;  4J8V D;  2HIO B;  3AYW D;  2ARO D;  5AVC B;  3X1T C;  4WNN B;  5GT3 A;  2Y2M A;  4UPK A;  5BO0 B;  3MGR A;  3AV2 C;  4NE6 A;  1HQ3 D;  1P3B C;  3WKJ C;  3REH A;  1P3L D;  3X1S C;  2FJ7 B;  1P3K C;  1ULY A;  5B32 D;  3A6N C;  3X1U D;  3W97 C;  5KDM A;  2Y2N A;  3UTA D;  4NE5 A;  4XZQ C;  1S32 B;  3AZN A;  3B0D C;  2Y2O A;  2NQB C;  1P3P A;  5AV9 A;  5JRG D;  3AZJ A;  5CPJ A;  1P3F A;  1Q9C A;  5B33 C;  2YFV B;  5AY8 D;  4NE3 A;  1P34 B;  3EPL A;  3B6F C;  5B2I C;  4LD9 C;  5CPI C;  5AV5 A;  5B24 C;  1KX5 C;  3EPJ A;  2J8P A;  4QLC A;  5C3I B;  4WU8 A;  3O62 B;  3MGQ B;  5GT3 D;  3MGR D;  2NZD C;  4J8X A;  5B0Y C;  3W96 A;  2CV5 C;  3REH D;  2G5I C;  4R8P C;  4J8W C;  1ID3 B;  5GSU A;  3MGP A;  3UT9 A;  3NQU B;  2RVQ C;  3LEL A;  3REL C;  3UTB C;  4KUD A;  3AZN D;  1TZY B;  4KHA B;  3AZM C;  3C1C B;  5AVB B;  4WU9 A;  1TAF A;  1P3P D;  3NQJ B;  4Z2M G;  3REI A;  5AV9 D;  3MGS A;  3MNN A;  3B6G C;  5CPK B;  3AZJ D;  5CPJ D;  3AZG C;  1P3F D;  3AZL C;  2IO5 B;  4ZUX A;  1KX3 A;  2Y2Q A;  1M1A B;  5AV5 D;  1WWS A;  3WTP B;  4X23 B;  4QLC D;  5CP6 C;  3TU4 A;  4WU8 D;  5BS7 C;  5DNN B;  3AFA A;  3WA9 B;  1PZR A;  4J8X D;  3AYW C;  1U35 A;  2ARO C;  1P3M B;  3MVD B;  3W96 D;  2VQR A;  5E5A A;  1HQ3 C;  5B31 G;  5GSU D;  3KXB C;  3MGP D;  4Z5T C;  3UT9 D;  1P3L C;  3W99 A;  4KUD D;  3LEL D;  4Z2M H;  3AZI C;  3AZE A;  3VH5 A;  2HUE C;  4HGA B;  3V9R A;  1P3I B;  4WU9 D;  2Y2L A;  5GXQ A;  5F99 C;  3REK C;  4YS3 B;  4H9O B;  3MGS D;  3MNN D;  3X1T B;  5JRG C;  1H3O A;  3AV2 B;  2ZY5 A;  4ZUX D;  1KX3 D;  3B0C T;  1P3B B;  2F8N G;  5B2J C;  3WKJ B;  3X1S B;  1P3K B;  3TU4 D;  3A1I A;  3A6N B;  3W97 B;  3AFA D;  5B1M A;  1U35 D;  4Z66 A;  4XZQ B;  3MGR C;  1ZLA A;  3B0D B;  4JJN D;  3AN2 A;  5B40 A;  5B31 C;  5E5A D;  1EQZ A;  2NQB B;  5BNX A;  5B0Z A;  1BH8 A;  3W99 D;  1F66 C;  2YFW B;  3AZE D;  5B33 B;  3KWQ C;  4J8U A;  3KSY A;  5GXQ D;  3B6F B;  5B2I B;  4LD9 B;  1AOI B;  5CPI B;  5B24 B;  1KX5 B;  3R45 A;  2Y2P A;  3REJ C;  1M19 C;  2HIO A;  3AZF A;  2NZD B;  5AVC A;  5B0Y B;  5BO0 A;  4KGC C;  5AV6 C;  1M18 A;  3VH5 W;  2UWX A;  2CV5 B;  2ZY4 A;  4R8P B;  5B1L D;  4J8W B;  5AV8 D;  2XD1 A;  2FJ7 A;  5B1M D;  4Z66 D;  3UTB B;  3REL B;  3W98 B;  1ZLA D;  1P3O A;  4G92 C;  3AN2 D;  5B40 D;  3AZM B;  1B6W A;  1S32 A;  1EQZ D;  3W96 C;  5BNV B;  4CAY A;  5B0Z D;  1JFI B;  3B6G B;  5GSU C;  3EPH A;  3AZG B;  3UT9 C;  3AZL B;  4J8U D;  1B67 A;  2YFV A;  3X1V C;  3B0B A;  1BH9 B;  4WU9 C;  5CP6 B;  3REI C;  2HIO D;  3AZF D;  3MGS C;  5AVC D;  3O62 A;  3LZ1 C;  2ARO B;  3MGQ A;  1M18 D;  3AZK C;  1P3G C;  4M6B A;  1HQ3 B;  3KXB B;  2FJ7 D;  4Z5T B;  5DNM C;  1P3L B;  3KUY C;  3WTP E;  3TU4 C;  3AZI B;  3VH6 A;  4H9R A;  5FUG B;  1P3O D;  3AZH C;  3NQU A;  2HUE B;  2W8S A;  4XUJ C;  1S32 D;  4KHA A;  5F99 B;  3REK B;  3C1C A;  5AVB A;  3EPK A;  3NQJ A;  4G91 C;  5GT0 C;  2ZY2 A;  3C1B C;  5CPK A;  5JRG B;  1W2E A;  4H9S A;  1P3A A;  5B2J B;  1Z2C B;  5GXQ C;  1M1A A;  2BG1 A;  2PYO C;  3WTP A;  3LJA C;  4X23 A;  3O62 D;  3MGQ D;  3F6T A;  5DNN A;  3MGR B;  3WA9 A;  3MVD A;  2LY8 A;  3H0R C;  5B31 B;  5BT1 C;  1ID3 D;  1F66 B;  5CHL B;  5JA4 B;  3KWQ B;  4H9P B;  4E45 A;  2XD5 A;  4YM6 C;  3LZ0 C;  3C1C D;  5AVB D;  5B40 C;  4UUZ B;  3REJ B;  4YS3 A;  1M19 B;  4J8V C;  5CPK D;  3X1T A;  2F8N B;  2Y2G A;  4H9N B;  1P3A D;  3VH6 W;  4KGC B;  5AV6 B;  4J8U C;  3AV2 A;  4JJN A;  1P3B A;  1M1A D;  3WKJ A;  3WTP D;  3X1S A;  4X23 D;  1P3K A;  3W97 A;  5B32 C;  5DNN D;  3AZF C;  3WA9 D;  3X1U C;  4G92 B;  3AV1 A;  1P3M D;  3MVD D;  4XZQ A;  3UTA C;  3VH5 T;  1M18 C;  5GSU B;  4CSR B;  3H0M C;  2YFW A;  4WZS B;  5B33 A;  2BYK A;  3X1V B;  1P3O C;  1KX4 A;  1P3I D;  5AY8 C;  3B6F A;  5B2I A;  4WU9 B;  1AOI A;  4YS3 D;  5CPI A;  5B1L A;  1N1J B;  3REI B;  1KX5 A;  2Y2K A;  3MGS B;  5AV8 A;  3X1T D;  3LZ1 B;  2NZD A;  5GT3 C;  3AV2 D;  5B0Y A;  3AZK B;  1P3G B;  1P3B D;  3WAA A;  1KU5 A;  3WKJ D;  2CV5 A;  2BYM A;  3X1S D;  4R8P A;  2JSS A;  5DNM B;  3KUY B;  4J8W A;  3REH C;  1P3K D;  3TU4 B;  3W97 D;  3AZH B;  3UTB A;  3AV1 D;  4XUJ B;  4XZQ D;  4H9Q B;  3W98 A;  3AZM A;  3A1K A;  3AZN C;  1F1E A;  2F8N H;  5BNV A;  4G91 B;  5GT0 B;  3C1B B;  1P3P C;  1JFI A;  5AV9 C;  3AZG A;  3AZJ C;  4WNN A;  5B33 D;  3AZL A;  5CPJ C;  1P3F C;  1KX4 D;  3V9R B;  3B6F D;  5B2I D;  2RIQ A;  5GXQ B;  5CPI D;  1AOI D;  2PYO B;  1KX5 D;  3LJA B;  1BH9 A;  5AV5 C;  5CP6 A;  4ZBJ C;  4QLC C;  5BS7 A;  4WU8 C;  2NZD D;  5B0Y D;  4J8X C;  3WAA D;  4H9S C;  1P3A C;  2CV5 D;  4R8P D;  4J8W D;  4EO5 C;  3KXB A;  4Z5T A;  3MGP C;  3UTB D;  3REL D;  3AZI A;  3W98 D;  4KUD C;  3LEL C;  5FUG A;  3P5J B;  3KFU G;  3AZM D;  4YM6 B;  5B40 B;  3LZ0 B;  1P34 A;  5F99 A;  3REK A;  1R4V A;  5BNX B;  4J8V B;  3MNN C;  3AZG D;  3AYW B;  3AZL D;  2Y2H A;  4J8U B;  4ZUX C;  1KX3 C;  5B2J A;  5CP6 D;  1ID3 A;  2ZY3 A;  5B32 B;  3AZF B;  3X1U B;  3AFA C;  5G49 B;  1U35 C;  3VH6 T;  3UTA B;  1M18 B;  4NFT A;  1TZY A;  5B31 A;  4JJN C;  5E5A C;  3KXB D;  4Z5T D;  2L5A A;  3AZI D;  1F66 A;  3W99 C;  3AZE C;  5JA4 A;  1P3O B;  3KWQ A;  3AV1 C;  4H9P A;  1P34 D;  5AY8 B;  5F99 D;  3REK D;  4CAY B;  4UUZ A;  3REJ A;  1M19 A;  5GT3 B;  5B32 G;  2F8N A;  4H9N A;  1P3M A;  4KGC A;  1A7W A;  5AV6 A;  5B2J D;  1KX4 C;  2FFF B;  3REH B;  1AOI C;  3EG5 B;  4WJ3 C;  5B1L C;  5AV8 C;  5B1M C;  4Z66 C;  5KDM B;  3AZN B;  1ZLA C;  1TZY D;  5B31 D;  3AN2 C;  3WAA C;  4E44 A;  1P3I A;  1EQZ C;  1P3P B;  4AWL C;  4H9O A;  5AV9 B;  5B0Z C;  1F66 D;  4WV4 B;  4H9R B;  4CSR A;  3AZJ B;  3KWQ D;  2ZM5 A;  5CPJ B;  1P3F B;  3W98 C;  3X1V A;  3REJ D;  5AV5 B;  1M19 D;  1N1J A;  4ZBJ B;  4QLC B;  3A6N A;  4WU8 B;  2HIO C;  3LZ1 A;  2F8N D;  1BFM A;  5AVC C;  4J8X B;  4KGC D;  5AV6 D;  2Y2I A;  1P3A B;  3W96 B;  3AZK A;  1P3G A;  2JE5 A;  2F8N K;  4EO5 B;  2NQB A;  5DNM A;  3IP4 C;  3MGP B;  3KUY A;  3UT9 B;  2CWE A;  2FJ7 C;  2JCH A;  4KUD B;  3LEL B;  3AZH A;  4XUJ A;  2G5H C;  4H9Q A;  1S32 C;  4LD9 A;  1TAF B;  5B24 A;  5GT0 A;  3MNN B;  3C1B A;  3X1V D;  2DF4 C;  4ZUX B;  1KX3 B;  1P34 C;  2PYO A;  3REI D;  4DRB A;  3LJA A;  3A6N D;  3LZ1 D;  3AFA B;  5C3I C;  3O62 C;  3REL A;  3MGQ C;  1U35 B;  2DQN C;  3AZK D;  1T3U A;  1P3G D;  4JJN B;  5E5A B;  2NQB D;  5DNM D;  3KUY D;  1ID3 C;  3B6G A;  4DRA A;  3W99 B;  3AZH D;  3AZE B;  4XUJ D;  3AV1 B;  4LD9 D;  4YM6 A;  3LZ0 A;  1TZY C;  5B24 D;  3H0L C;  3C1C C;  5AVB C;  5GT0 D;  3C1B D;  2Y2J A;  4J8V A;  5CPK C;  3AYW A;  2ARO A;  1H3O B;  1HTA A;  3AL0 C;  2BYK B;  1KX4 B;  1WWI A;  2F2A C;  2IO5 C;  4DQY B;  1HQ3 A;  2PYO D;  3LJA D;  1M1A C;  5B1L B;  3FDD A;  3WTP C;  5AV8 B;  1P3L A;  4X23 C;  5B1M B;  2RVQ D;  4Z66 B;  5B32 A;  3X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...