4R8PA

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pA00
5B24A 1H3OB 4CSRB 5DNMD 3AZMD 3AZKD 3MVDB 4WU8C 2PYOD 1P3FC 3X1SC 2FJ7C 3WKJA 3B6FA 1B6WA 3UTAC 1P3OB 3W99C 1ULYA 1HQ3A 3KWQC 4AWLB 3AN2A 3W96D 4H9SC 1P3IA 4NE5A 3AZNB 2RVQC 1F66B 4ZUXB 4E45A 3AZGA 3MGQC 5B33B 3R45A 4J8VC 3C1CC 3AZHB 1F66D 1ZLAC 3X1VA 1TZYC 4ZUXD 5CPIA 5CPJC 5AV5B 5DNNB 4KGCC 3LJAB 1P3AA 3W97C 3AV2B 5AVBD 5DNND 4YM6A 3AZLA 3LJAD 2BYKB 5B31G 3REKC 1KX4D 1P3GA 2CV5D 3W98C 4J8XC 3AZFD 3AV1A 5B2IA 2F8NH 3MVDC 3B6FB 3VH6A 3WKJB 3LZ1A 2IO5B 1HQ3B 3AN2B 1KX3A 3B6FD 3WKJD 3NQUA 1P3OC 1P3IB 1HQ3D 4KUDB 3AZGB 3AZNC 3R45B 4XUJD 4KUDD 4G91B 4ZUXC 3X1VB 1U35C 3MGSC 5CPIB 3RELC 5B33C 3AZHC 1N1JA 4Z2MG 4DRAA 5AV5C 1P3AB 3AZLB 4NE3A 4YM6B 5B31A 3AZID 3LJAC 3X1UC 3AV2C 3MNNA 4YM6D 5E5AA 1P3GB 3AZED 5B24C 3REJC 3AV1B 5B2IB 1S32C 4XZQC 3AV1D 3LZ1B 1KX3B 4ZBJB 1M18C 1BH9A 3NQUB 1B67A 2IO5C 3LZ1D 1HQ3C 1P3PC 3AN2C 1KX3D 4WU9D 4KHAA 1P3IC 4NE6A 5DNMA 5B32D 3X1TD 3AZMA 5AVCC 3AZKA 3AZGC 1P3MD 3WTPD 4CSRA 2PYOA 3AYWA 4G91C 3X1VC 1KU5A 1N1JB 5CPIC 2NZDC 5B31B 3W96A 1EQZA 1P3AC 3AZLC 3MNNB 3KUYC 4LD9D 5AY8C 5E5AB 3MNND 1P3GC 5E5AD 2F8NA 1F66A 5B0YA 3AZJD 3KXBD 3AV1C 5B2IC 5AVBA 1P3BC 5BT1D 1BH9B 5B1LA 1KX4A 2CV5A 4ZBJC 4J8UC 4KHAB 5BS7A 3REID 3REHC 5B1MC 5C3IB 3AZMB 1P3KA 3AZKB 3AZFA 2HIOA 1BH8A 3O62C 3AYWB 2PYOB 4EO5B 1P34D 3AYWD 3W96B 3V9RA 1EQZB 3MGRD 5B31C 1EQZD 5CPKD 4Z5TC 3MNNC 3VH5T 5E5AC 3AFAD 2F8NB 4XUJA 3MGPA 3WAAD 4KUDA 5GXQC 4R8PA 5B32G 5B0YB 2F8ND 5B0YD 4X23A 3UT9A 5AVBB 3AZIA 1M1AA 5B1LB 1KX4B 3VH5W 3LELD 3AZEA 2CV5B 5GT3C 5FUGA 5B1LD 4WV4B 5CHLB 1P3LD 1P3KB 4YS3D 3AZFB 2HIOB 1BH8B 4HGAB 5C3IC 5DNMC 3AZMC 3B0DC 3AZKC 1P3KD 2HIOD 3AYWC 2PYOC 3B6GA 3V9RB 3WA9A 3W96C 1TAFA 5B0ZD 4WU9A 4AWLC 3X1TA 2LY8A 5B32A 4XUJB 3MGPB 1P3MA 4J8WD 4R8PB 3WTPA 5DNMB 3LZ0A 3B0BA 3MGPD 1F66C 4R8PD 5B0YC 4X23B 3UT9B 3AZIB 4JJND 1M1AB 5B2JD 5AV8D 4X23D 5AVBC 5DNNC 3UT9D 4LD9A 1M1AD 3UTBA 3AZEB 5FUGB 1KX5D 1KX4C 2CV5C 4QLCD 3C1BD 3AZJA 2F8NG 3KSYA 3KXBA 5AV9D 3AZFC 2HIOC 4HGAC 3B6GB 4WNNA 1P3FA 2FJ7A 3B6GD 3WKJC 3B6FC 3WA9B 1TAFB 5JRGA 4WU9B 3REIA 1R4VA 3WA9D 3X1TB 4H9SA 5B32B 1P3MB 1Q9CA 5CP6D 3WTPB 4G92B 4H9OB 2L5AA 3LZ0B 4XUJC 4KUDC 5GT0D 1P34A 3LZ0D 4J8VA 1ZLAA 5CPJA 2NQBD 5F99B 1JFIA 3MGRA 3UT9C 4LD9B 3AZIC 1M1AC 3UTBB 3TU4D 2AROA 5F99D 2HUEB 5CPKA 5BNXA 4YM6C 3AFAA 3AZEC 3UTBD 3A6ND 3WAAA 3REKA 1HTAA 3AZJB 4H9RA 5B40D 3KXBB 4Z66D 5GSUD 4WNNB 1AOIA 1ID3A 1P3FB 3B6GC 2FJ7B 3LELA 4H9PB 5JRGB 4H9QA 4WU8D 3LZ1C 1P3FD 3X1SD 3KWQB 2FJ7D 1KX3C 3REIB 3B0CW 3UTAD 4WU9C 5JRGD 1P3LA 3W99D 3KWQD 3WTPE 1M19A 2F8NK 4YS3A 3X1TC 5B32C 3VH5A 1P3MC 1WWSA 3WTPC 3NQJA 4G92C 1P34B 2RVQD 3LZ0C 4J8VB 1ZLAB 5AV6A 2CWEA 5CPJB 1U35A 3RELA 1JFIB 3MGRB 4J8VD 3C1CD 1ZLAD 5CPJD 2AROB 5B0ZA 3W97B 5CPKB 5BNXB 4LD9C 3AFAB 4KGCD 2AROD 3W97D 2HUEC 3X1UA 3WAAB 4J8WA 3REKB 4H9RB 3REKD 3W98D 3AZJC 1WWIA 4JJNA 5B2JA 4E44A 3KXBC 3REJA 1AOIB 5AV8A 4WZSB 1ID3B 4J8XD 1S32A 5BT1C 3LELB 1AOID 4XZQA 2JSSA 4H9QB 1KX5A 1ID3D 2BYMA 3MVDD 1M18A 5JRGC 4QLCA 3C1BA 1P3LB 1P3PA 3REIC 1M19B 4YS3B 1P3OD 5AV9A 3NQJB 1M19D 5AV6B 5AVCA 1U35B 3MGSB 3AZND 1P34C 3RELB 4EO5C 5AV6D 1U35D 3MGSD 5B0ZB 3RELD 2NZDA 5B33D 3MGRC 3AZHD 5JA4A 1BFMA 1EQZC 4UUZA 2AROC 5AV5D 5CPKC 3X1UB 5CP6A 3AFAC 5AY8A 3KUYA 4Z2MH 4J8WB 3WAAC 3X1UD 3AV2D 5GT0A 4H9OA 4JJNB 5B24B 5B2JB 3REJB 2NQBA 5AV8B 1S32B 5B24D 3TU4A 3REJD 5F99A 1AOIC 4XZQB 1ID3C 5BO0A 1KX5B 1P3BA 2BYMB 3LELC 1S32D 1M18B 3A6NA 4XZQD 1A7WA 4QLCB 5B1LC 3C1BB 1P3PB 4J8UA 1M18D 1P3LC 5B40A 1P3PD 3AN2D 5BS7C 1M19C 5AV9B 4YS3C 4Z66A 5G49A 3REHA 5B1MA 5GSUA 2YFVA 1P3KC 1P3ID 5AVCB 5BNVA 3O62A 4H9NA 5AV6C 5AVCD 3AZGD 3VH6T 4WU8A 2NZDB 3X1SA 4H9PA 4CAYA 5JA4B 3X1VD 5CPID 4UUZB 5B0ZC 3UTAA 2NZDD 3W99A 3KWQA 5CP6B 3KUYB 5AY8B 1P3AD 4Z5TA 3AZLD 4J8WC 3KUYD 5AY8D 5GT0B 3MGPC 4R8PC 5GXQA 1P3GD 2NQBB 3VH6W 3MGQA 3C1CA 4JJNC 1TZYA 5B2JC 3TU4B 5AV8C 4X23C 5BO0B 1P3BB 4KGCA 3W97A 3A6NB 5KDMA 1KX5C 5B2ID 1P3BD 4M6BA 4J8UB 5GT3A 4QLCC 3C1BC 5B40B 4J8UD 3W98A 3B0CT 4Z66B 5G49B 3REHB 5B1MB 5GSUB 2YFVB 2YFWA 5AV9C 5BNVB 3REHD 5B1MD 3O62B 4J8XA 4H9NB 1H3OA 4WU8B 3O62D 3X1SB 3MVDA 4CAYB 3UTAB 3W99B 3WA9C 1P3OA 4NFTA 4Z5TB 5B31D 5CP6C 1F1EA 4Z5TD 5GXQB 5GT0C 3AZNA 3MGQB 3C1CB 4ZUXA 2NQBC 1TZYB 5GXQD 3MGSA 5B33A 3MGQD 3AZHA 3TU4C 1TZYD 4KGCB 5F99C 5AV5A 5KDMB 5DNNA 3LJAA 3UTBC 5GT3B 3A6NC 3AV2A 2BYKA 3W98B 5GT3D 5B40C 2YFWB 4Z66C 5GSUC 4DRBA 4J8XB 3B0DB
chains in the Genus database with same CATH superfamily
5B24A 1H3OB 4CSRB 5DNMD 2ZM5A 3AZMD 3AZKD 3MVDB 4WU8C 2PYOD 1P3FC 3X1SC 1W2EA 2FJ7C 3WKJA 3B6FA 1B6WA 3UTAC 1P3OB 3W99C 1ULYA 1HQ3A 3KWQC 4AWLB 3AN2A 3W96D 4H9SC 1P3IA 4NE5A 3AZNB 2RVQC 1F66B 4ZUXB 4E45A 3AZGA 3MGQC 2Y2IA 5B33B 3R45A 4J8VC 3C1CC 3AZHB 1F66D 1ZLAC 3X1VA 1TZYC 4ZUXD 5CPIA 5CPJC 5AV5B 5DNNB 2FFFB 4KGCC 3LJAB 1P3AA 3W97C 3AV2B 2DF4C 5DNND 5AVBD 4YM6A 3AZLA 3EPHA 3LJAD 2BYKB 2Y2JA 5B31G 3REKC 1KX4D 1P3GA 2CV5D 3W98C 2W8SA 2Y2OA 4J8XC 3AZFD 3AV1A 5B2IA 2F8NH 3MVDC 3B6FB 3VH6A 3WKJB 3LZ1A 2IO5B 1HQ3B 3AN2B 1KX3A 3B6FD 3WKJD 3NQUA 1P3OC 2BG1A 1P3IB 1HQ3D 2JE5A 4KUDB 3AZGB 3AZNC 3R45B 4XUJD 4KUDD 4G91B 4ZUXC 3X1VB 1U35C 3MGSC 5CPIB 3RELC 5B33C 3AZHC 1N1JA 2J8PA 4Z2MG 4DRAA 5AV5C 1P3AB 3AZLB 4NE3A 5B31A 2ZY4A 4YM6B 3LJAC 3AZID 3X1UC 3AV2C 3MNNA 4YM6D 5E5AA 1P3GB 3AZED 5B24C 2Y2MA 3REJC 3EG5B 3AV1B 5B2IB 1S32C 4XZQC 3AV1D 3LZ1B 1KX3B 4ZBJB 1M18C 1BH9A 3NQUB 1B67A 2F2AC 2IO5C 3LZ1D 1HQ3C 1P3PC 3AN2C 1KX3D 4WU9D 4KHAA 1P3IC 4UPKA 4NE6A 5DNMA 5B32D 3X1TD 3AZMA 5AVCC 3AZKA 3AZGC 1P3MD 3WTPD 4CSRA 2PYOA 3AYWA 4G91C 3X1VC 1KU5A 1N1JB 2Y2PA 5CPIC 2NZDC 5B31B 3W96A 1EQZA 1P3AC 3AZLC 3MNNB 3KUYC 4LD9D 5AY8C 5E5AB 3F6TA 3MNND 1P3GC 5E5AD 2F8NA 1F66A 5B0YA 3AZJD 3KXBD 3AV1C 5B2IC 5AVBA 1P3BC 5BT1D 1BH9B 2VQRA 5B1LA 1KX4A 2CV5A 4ZBJC 4J8UC 2UWXA 3AL0C 4KHAB 5BS7A 3REID 3REHC 5B1MC 5C3IB 2Y2LA 3AZMB 3AZKB 1P3KA 3AZFA 2HIOA 1BH8A 3O62C 3AYWB 2PYOB 4EO5B 2Y2HA 1P34D 3AYWD 3W96B 3V9RA 1EQZB 4WJ3C 3MGRD 5B31C 1EQZD 5CPKD 4Z5TC 2XD5A 3MNNC 3VH5T 5E5AC 3AFAD 2F8NB 4XUJA 3MGPA 3WAAD 4KUDA 5GXQC 4R8PA 5B32G 5B0YB 2F8ND 5B0YD 2Y2QA 4X23A 3UT9A 5AVBB 3AZIA 1M1AA 1Z2CB 5B1LB 1KX4B 3VH5W 3LELD 3AZEA 2CV5B 5GT3C 5FUGA 5B1LD 4WV4B 5CHLB 1P3LD 1P3KB 4YS3D 3AZFB 2HIOB 5DNMC 1BH8B 4HGAB 5C3IC 3AZMC 3B0DC 3AZKC 1P3KD 2HIOD 3AYWC 2PYOC 3B6GA 3V9RB 3WA9A 3W96C 1TAFA 5B0ZD 4WU9A 4AWLC 3X1TA 2LY8A 5B32A 4XUJB 3MGPB 1P3MA 4J8WD 4R8PB 3WTPA 5DNMB 3LZ0A 3B0BA 3MGPD 1F66C 4R8PD 5B0YC 4X23B 2Y2KA 3UT9B 3AZIB 3EPJA 4JJND 5B2JD 1M1AB 5AV8D 4X23D 5AVBC 5DNNC 3UT9D 4LD9A 2Y2NA 1M1AD 3UTBA 3AZEB 5FUGB 1KX5D 1KX4C 2CV5C 4QLCD 3C1BD 3H0LC 3AZJA 2F8NG 3KSYA 3KXBA 5AV9D 3AZFC 2HIOC 4HGAC 2DQNC 3B6GB 4WNNA 1P3FA 2FJ7A 3B6GD 3WKJC 3B6FC 3WA9B 1TAFB 5JRGA 4WU9B 2G5HC 3REIA 1R4VA 3WA9D 3X1TB 4H9SA 5B32B 1P3MB 1Q9CA 5CP6D 3WTPB 4G92B 4H9OB 2L5AA 3LZ0B 4XUJC 4KUDC 5GT0D 1P34A 3LZ0D 4J8VA 1ZLAA 5CPJA 2NQBD 1PZRA 5F99B 1JFIA 3MGRA 3UT9C 4LD9B 3AZIC 1M1AC 3UTBB 3TU4D 2AROA 5F99D 2HUEB 5CPKA 5BNXA 4YM6C 3AFAA 3AZEC 3UTBD 3A6ND 3WAAA 3REKA 1HTAA 3AZJB 4H9RA 5B40D 3KXBB 4Z66D 5GSUD 4WNNB 1AOIA 1ID3A 1P3FB 3B6GC 2FJ7B 3LELA 4H9PB 3KFUG 3A1KA 5JRGB 4H9QA 4WU8D 3LZ1C 1P3FD 3X1SD 3KWQB 2FJ7D 1KX3C 3REIB 3B0CW 3UTAD 4WU9C 2XD1A 5JRGD 1P3LA 3W99D 3KWQD 3WTPE 1M19A 2F8NK 4YS3A 3X1TC 5B32C 3VH5A 1P3MC 1WWSA 3WTPC 3NQJA 4G92C 1P34B 2RVQD 3LZ0C 4J8VB 1ZLAB 5AV6A 2CWEA 5CPJB 1U35A 2RIQA 3RELA 1JFIB 3MGRB 4J8VD 3C1CD 1ZLAD 5CPJD 2AROB 5B0ZA 3W97B 5CPKB 5BNXB 4LD9C 3AFAB 4KGCD 2AROD 3W97D 2HUEC 3X1UA 3WAAB 3H0MC 4J8WA 3REKB 4H9RB 3REKD 3W98D 3EPLA 3AZJC 1WWIA 4JJNA 5B2JA 4E44A 3KXBC 3REJA 1AOIB 5AV8A 4WZSB 1ID3B 4J8XD 1S32A 5BT1C 3LELB 1AOID 4XZQA 2JSSA 4H9QB 1KX5A 1ID3D 2BYMA 3MVDD 1M18A 5JRGC 4QLCA 3C1BA 1P3LB 1P3PA 3REIC 1M19B 4YS3B 1P3OD 5AV9A 3NQJB 1M19D 5AV6B 5AVCA 1U35B 3MGSB 3AZND 1P34C 3RELB 4EO5C 5AV6D 1U35D 3MGSD 5B0ZB 3RELD 2NZDA 5B33D 3MGRC 3AZHD 5JA4A 1BFMA 1EQZC 4UUZA 3FDDA 2AROC 5AV5D 5CPKC 3X1UB 5CP6A 3AFAC 5AY8A 3KUYA 4Z2MH 4J8WB 3WAAC 3X1UD 3AV2D 5GT0A 4H9OA 4JJNB 5B24B 5B2JB 3REJB 2NQBA 5AV8B 1S32B 5B24D 3TU4A 3REJD 5F99A 1AOIC 4XZQB 1ID3C 5BO0A 1KX5B 1P3BA 2BYMB 3LELC 1S32D 1M18B 3A6NA 4XZQD 1A7WA 4QLCB 5B1LC 3C1BB 1P3PB 2ZY2A 4J8UA 2G5IC 1M18D 4DQYB 2Y2GA 1P3LC 5B40A 1P3PD 3AN2D 5BS7C 1M19C 5AV9B 3P5JB 4YS3C 5G49A 4Z66A 5B1MA 5GSUA 3REHA 2YFVA 1P3KC 1P3ID 5AVCB 2JCHA 5BNVA 3O62A 4H9NA 5AV6C 5AVCD 3AZGD 3IP4C 3VH6T 4WU8A 2NZDB 3X1SA 4H9PA 4CAYA 5JA4B 3X1VD 5CPID 4UUZB 5B0ZC 3UTAA 2NZDD 1T3UA 3W99A 3KWQA 5CP6B 3KUYB 5AY8B 1P3AD 3H0RC 4Z5TA 3AZLD 4J8WC 3KUYD 5AY8D 5GT0B 3MGPC 4R8PC 5GXQA 1P3GD 2NQBB 3VH6W 3MGQA 3C1CA 4JJNC 1TZYA 5B2JC 3TU4B 5AV8C 4X23C 5BO0B 1P3BB 4KGCA 3W97A 3A6NB 5KDMA 1KX5C 5B2ID 1P3BD 4M6BA 4J8UB 3A1IA 5GT3A 4QLCC 3C1BC 5B40B 2ZY3A 4J8UD 3W98A 3B0CT 4Z66B 5G49B 3REHB 5B1MB 5GSUB 2YFVB 2YFWA 5AV9C 5BNVB 3REHD 5B1MD 3O62B 4J8XA 4H9NB 2ZY5A 1H3OA 4WU8B 3O62D 3X1SB 3MVDA 4CAYB 3UTAB 3W99B 3WA9C 1P3OA 4NFTA 4Z5TB 5B31D 5CP6C 1F1EA 4Z5TD 5GXQB 5GT0C 3AZNA 3MGQB 3C1CB 4ZUXA 2NQBC 1TZYB 5GXQD 3MGSA 5B33A 3MGQD 3AZHA 3TU4C 1TZYD 4KGCB 5F99C 5AV5A 5KDMB 5DNNA 3LJAA 3UTBC 5GT3B 3A6NC 3AV2A 2BYKA 3W98B 5GT3D 3EPKA 5B40C 2YFWB 4Z66C 5GSUC 4DRBA 4J8XB 3B0DB
chains in the Genus database with same CATH topology
5B24A 1H3OB 4CSRB 5DNMD 2ZM5A 3AZMD 3AZKD 3MVDB 4WU8C 2PYOD 1P3FC 3X1SC 1W2EA 2FJ7C 3WKJA 3B6FA 1B6WA 3UTAC 1P3OB 3W99C 1ULYA 1HQ3A 3KWQC 4AWLB 3AN2A 3W96D 4H9SC 1P3IA 4NE5A 3AZNB 2RVQC 1F66B 4ZUXB 4E45A 3AZGA 3MGQC 2Y2IA 5B33B 3R45A 4J8VC 3C1CC 3AZHB 1F66D 1ZLAC 3X1VA 1TZYC 4ZUXD 5CPIA 5CPJC 5AV5B 5DNNB 2FFFB 4KGCC 3LJAB 1P3AA 3W97C 3AV2B 2DF4C 5DNND 5AVBD 4YM6A 3AZLA 3EPHA 3LJAD 2BYKB 2Y2JA 5B31G 3REKC 1KX4D 1P3GA 2CV5D 3W98C 2W8SA 2Y2OA 4J8XC 3AZFD 3AV1A 5B2IA 2F8NH 3MVDC 3B6FB 3VH6A 3WKJB 3LZ1A 2IO5B 1HQ3B 3AN2B 1KX3A 3B6FD 3WKJD 3NQUA 1P3OC 2BG1A 1P3IB 1HQ3D 2JE5A 4KUDB 3AZGB 3AZNC 3R45B 4XUJD 4KUDD 4G91B 4ZUXC 3X1VB 1U35C 3MGSC 5CPIB 3RELC 5B33C 3AZHC 1N1JA 2J8PA 4Z2MG 4DRAA 5AV5C 1P3AB 3AZLB 4NE3A 5B31A 2ZY4A 4YM6B 3LJAC 3AZID 3X1UC 3AV2C 3MNNA 4YM6D 5E5AA 1P3GB 3AZED 5B24C 2Y2MA 3REJC 3EG5B 3AV1B 5B2IB 1S32C 4XZQC 3AV1D 3LZ1B 1KX3B 4ZBJB 1M18C 1BH9A 3NQUB 1B67A 2F2AC 2IO5C 3LZ1D 1HQ3C 1P3PC 3AN2C 1KX3D 4WU9D 4KHAA 1P3IC 4UPKA 4NE6A 5DNMA 5B32D 3X1TD 3AZMA 5AVCC 3AZKA 3AZGC 1P3MD 3WTPD 4CSRA 2PYOA 3AYWA 4G91C 3X1VC 1KU5A 1N1JB 2Y2PA 5CPIC 2NZDC 5B31B 3W96A 1EQZA 1P3AC 3AZLC 3MNNB 3KUYC 4LD9D 5AY8C 5E5AB 3F6TA 3MNND 1P3GC 5E5AD 2F8NA 1F66A 5B0YA 3AZJD 3KXBD 3AV1C 5B2IC 5AVBA 1P3BC 5BT1D 1BH9B 2VQRA 5B1LA 1KX4A 2CV5A 4ZBJC 4J8UC 2UWXA 3AL0C 4KHAB 5BS7A 3REID 3REHC 5B1MC 5C3IB 2Y2LA 3AZMB 3AZKB 1P3KA 3AZFA 2HIOA 1BH8A 3O62C 3AYWB 2PYOB 4EO5B 2Y2HA 1P34D 3AYWD 3W96B 3V9RA 1EQZB 4WJ3C 3MGRD 5B31C 1EQZD 5CPKD 4Z5TC 2XD5A 3MNNC 3VH5T 5E5AC 3AFAD 2F8NB 4XUJA 3MGPA 3WAAD 4KUDA 5GXQC 4R8PA 5B32G 5B0YB 2F8ND 5B0YD 2Y2QA 4X23A 3UT9A 5AVBB 3AZIA 1M1AA 1Z2CB 5B1LB 1KX4B 3VH5W 3LELD 3AZEA 2CV5B 5GT3C 5FUGA 5B1LD 4WV4B 5CHLB 1P3LD 1P3KB 4YS3D 3AZFB 2HIOB 5DNMC 1BH8B 4HGAB 5C3IC 3AZMC 3B0DC 3AZKC 1P3KD 2HIOD 3AYWC 2PYOC 3B6GA 3V9RB 3WA9A 3W96C 1TAFA 5B0ZD 4WU9A 4AWLC 3X1TA 2LY8A 5B32A 4XUJB 3MGPB 1P3MA 4J8WD 4R8PB 3WTPA 5DNMB 3LZ0A 3B0BA 3MGPD 1F66C 4R8PD 5B0YC 4X23B 2Y2KA 3UT9B 3AZIB 3EPJA 4JJND 5B2JD 1M1AB 5AV8D 4X23D 5AVBC 5DNNC 3UT9D 4LD9A 2Y2NA 1M1AD 3UTBA 3AZEB 5FUGB 1KX5D 1KX4C 2CV5C 4QLCD 3C1BD 3H0LC 3AZJA 2F8NG 3KSYA 3KXBA 5AV9D 3AZFC 2HIOC 4HGAC 2DQNC 3B6GB 4WNNA 1P3FA 2FJ7A 3B6GD 3WKJC 3B6FC 3WA9B 1TAFB 5JRGA 4WU9B 2G5HC 3REIA 1R4VA 3WA9D 3X1TB 4H9SA 5B32B 1P3MB 1Q9CA 5CP6D 3WTPB 4G92B 4H9OB 2L5AA 3LZ0B 4XUJC 4KUDC 5GT0D 1P34A 3LZ0D 4J8VA 1ZLAA 5CPJA 2NQBD 1PZRA 5F99B 1JFIA 3MGRA 3UT9C 4LD9B 3AZIC 1M1AC 3UTBB 3TU4D 2AROA 5F99D 2HUEB 5CPKA 5BNXA 4YM6C 3AFAA 3AZEC 3UTBD 3A6ND 3WAAA 3REKA 1HTAA 3AZJB 4H9RA 5B40D 3KXBB 4Z66D 5GSUD 4WNNB 1AOIA 1ID3A 1P3FB 3B6GC 2FJ7B 3LELA 4H9PB 3KFUG 3A1KA 5JRGB 4H9QA 4WU8D 3LZ1C 1P3FD 3X1SD 3KWQB 2FJ7D 1KX3C 3REIB 3B0CW 3UTAD 4WU9C 2XD1A 5JRGD 1P3LA 3W99D 3KWQD 3WTPE 1M19A 2F8NK 4YS3A 3X1TC 5B32C 3VH5A 1P3MC 1WWSA 3WTPC 3NQJA 4G92C 1P34B 2RVQD 3LZ0C 4J8VB 1ZLAB 5AV6A 2CWEA 5CPJB 1U35A 2RIQA 3RELA 1JFIB 3MGRB 4J8VD 3C1CD 1ZLAD 5CPJD 2AROB 5B0ZA 3W97B 5CPKB 5BNXB 4LD9C 3AFAB 4KGCD 2AROD 3W97D 2HUEC 3X1UA 3WAAB 3H0MC 4J8WA 3REKB 4H9RB 3REKD 3W98D 3EPLA 3AZJC 1WWIA 4JJNA 5B2JA 4E44A 3KXBC 3REJA 1AOIB 5AV8A 4WZSB 1ID3B 4J8XD 1S32A 5BT1C 3LELB 1AOID 4XZQA 2JSSA 4H9QB 1KX5A 1ID3D 2BYMA 3MVDD 1M18A 5JRGC 4QLCA 3C1BA 1P3LB 1P3PA 3REIC 1M19B 4YS3B 1P3OD 5AV9A 3NQJB 1M19D 5AV6B 5AVCA 1U35B 3MGSB 3AZND 1P34C 3RELB 4EO5C 5AV6D 1U35D 3MGSD 5B0ZB 3RELD 2NZDA 5B33D 3MGRC 3AZHD 5JA4A 1BFMA 1EQZC 4UUZA 3FDDA 2AROC 5AV5D 5CPKC 3X1UB 5CP6A 3AFAC 5AY8A 3KUYA 4Z2MH 4J8WB 3WAAC 3X1UD 3AV2D 5GT0A 4H9OA 4JJNB 5B24B 5B2JB 3REJB 2NQBA 5AV8B 1S32B 5B24D 3TU4A 3REJD 5F99A 1AOIC 4XZQB 1ID3C 5BO0A 1KX5B 1P3BA 2BYMB 3LELC 1S32D 1M18B 3A6NA 4XZQD 1A7WA 4QLCB 5B1LC 3C1BB 1P3PB 2ZY2A 4J8UA 2G5IC 1M18D 4DQYB 2Y2GA 1P3LC 5B40A 1P3PD 3AN2D 5BS7C 1M19C 5AV9B 3P5JB 4YS3C 5G49A 4Z66A 5B1MA 5GSUA 3REHA 2YFVA 1P3KC 1P3ID 5AVCB 2JCHA 5BNVA 3O62A 4H9NA 5AV6C 5AVCD 3AZGD 3IP4C 3VH6T 4WU8A 2NZDB 3X1SA 4H9PA 4CAYA 5JA4B 3X1VD 5CPID 4UUZB 5B0ZC 3UTAA 2NZDD 1T3UA 3W99A 3KWQA 5CP6B 3KUYB 5AY8B 1P3AD 3H0RC 4Z5TA 3AZLD 4J8WC 3KUYD 5AY8D 5GT0B 3MGPC 4R8PC 5GXQA 1P3GD 2NQBB 3VH6W 3MGQA 3C1CA 4JJNC 1TZYA 5B2JC 3TU4B 5AV8C 4X23C 5BO0B 1P3BB 4KGCA 3W97A 3A6NB 5KDMA 1KX5C 5B2ID 1P3BD 4M6BA 4J8UB 3A1IA 5GT3A 4QLCC 3C1BC 5B40B 2ZY3A 4J8UD 3W98A 3B0CT 4Z66B 5G49B 3REHB 5B1MB 5GSUB 2YFVB 2YFWA 5AV9C 5BNVB 3REHD 5B1MD 3O62B 4J8XA 4H9NB 2ZY5A 1H3OA 4WU8B 3O62D 3X1SB 3MVDA 4CAYB 3UTAB 3W99B 3WA9C 1P3OA 4NFTA 4Z5TB 5B31D 5CP6C 1F1EA 4Z5TD 5GXQB 5GT0C 3AZNA 3MGQB 3C1CB 4ZUXA 2NQBC 1TZYB 5GXQD 3MGSA 5B33A 3MGQD 3AZHA 3TU4C 1TZYD 4KGCB 5F99C 5AV5A 5KDMB 5DNNA 3LJAA 3UTBC 5GT3B 3A6NC 3AV2A 2BYKA 3W98B 5GT3D 3EPKA 5B40C 2YFWB 4Z66C 5GSUC 4DRBA 4J8XB 3B0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 A;  1H3O B;  4CSR B;  5DNM D;  3AZM D;  3AZK D;  3MVD B;  4WU8 C;  2PYO D;  1P3F C;  3X1S C;  2FJ7 C;  3WKJ A;  3B6F A;  1B6W A;  3UTA C;  1P3O B;  3W99 C;  1ULY A;  1HQ3 A;  3KWQ C;  4AWL B;  3AN2 A;  3W96 D;  4H9S C;  1P3I A;  4NE5 A;  3AZN B;  2RVQ C;  1F66 B;  4ZUX B;  4E45 A;  3AZG A;  3MGQ C;  5B33 B;  3R45 A;  4J8V C;  3C1C C;  3AZH B;  1F66 D;  1ZLA C;  3X1V A;  1TZY C;  4ZUX D;  5CPI A;  5CPJ C;  5AV5 B;  5DNN B;  4KGC C;  3LJA B;  1P3A A;  3W97 C;  3AV2 B;  5AVB D;  5DNN D;  4YM6 A;  3AZL A;  3LJA D;  2BYK B;  5B31 G;  3REK C;  1KX4 D;  1P3G A;  2CV5 D;  3W98 C;  4J8X C;  3AZF D;  3AV1 A;  5B2I A;  2F8N H;  3MVD C;  3B6F B;  3VH6 A;  3WKJ B;  3LZ1 A;  2IO5 B;  1HQ3 B;  3AN2 B;  1KX3 A;  3B6F D;  3WKJ D;  3NQU A;  1P3O C;  1P3I B;  1HQ3 D;  4KUD B;  3AZG B;  3AZN C;  3R45 B;  4XUJ D;  4KUD D;  4G91 B;  4ZUX C;  3X1V B;  1U35 C;  3MGS C;  5CPI B;  3REL C;  5B33 C;  3AZH C;  1N1J A;  4Z2M G;  4DRA A;  5AV5 C;  1P3A B;  3AZL B;  4NE3 A;  4YM6 B;  5B31 A;  3AZI D;  3LJA C;  3X1U C;  3AV2 C;  3MNN A;  4YM6 D;  5E5A A;  1P3G B;  3AZE D;  5B24 C;  3REJ C;  3AV1 B;  5B2I B;  1S32 C;  4XZQ C;  3AV1 D;  3LZ1 B;  1KX3 B;  4ZBJ B;  1M18 C;  1BH9 A;  3NQU B;  1B67 A;  2IO5 C;  3LZ1 D;  1HQ3 C;  1P3P C;  3AN2 C;  1KX3 D;  4WU9 D;  4KHA A;  1P3I C;  4NE6 A;  5DNM A;  5B32 D;  3X1T D;  3AZM A;  5AVC C;  3AZK A;  3AZG C;  1P3M D;  3WTP D;  4CSR A;  2PYO A;  3AYW A;  4G91 C;  3X1V C;  1KU5 A;  1N1J B;  5CPI C;  2NZD C;  5B31 B;  3W96 A;  1EQZ A;  1P3A C;  3AZL C;  3MNN B;  3KUY C;  4LD9 D;  5AY8 C;  5E5A B;  3MNN D;  1P3G C;  5E5A D;  2F8N A;  1F66 A;  5B0Y A;  3AZJ D;  3KXB D;  3AV1 C;  5B2I C;  5AVB A;  1P3B C;  5BT1 D;  1BH9 B;  5B1L A;  1KX4 A;  2CV5 A;  4ZBJ C;  4J8U C;  4KHA B;  5BS7 A;  3REI D;  3REH C;  5B1M C;  5C3I B;  3AZM B;  1P3K A;  3AZK B;  3AZF A;  2HIO A;  1BH8 A;  3O62 C;  3AYW B;  2PYO B;  4EO5 B;  1P34 D;  3AYW D;  3W96 B;  3V9R A;  1EQZ B;  3MGR D;  5B31 C;  1EQZ D;  5CPK D;  4Z5T C;  3MNN C;  3VH5 T;  5E5A C;  3AFA D;  2F8N B;  4XUJ A;  3MGP A;  3WAA D;  4KUD A;  5GXQ C;  4R8P A;  5B32 G;  5B0Y B;  2F8N D;  5B0Y D;  4X23 A;  3UT9 A;  5AVB B;  3AZI A;  1M1A A;  5B1L B;  1KX4 B;  3VH5 W;  3LEL D;  3AZE A;  2CV5 B;  5GT3 C;  5FUG A;  5B1L D;  4WV4 B;  5CHL B;  1P3L D;  1P3K B;  4YS3 D;  3AZF B;  2HIO B;  1BH8 B;  4HGA B;  5C3I C;  5DNM C;  3AZM C;  3B0D C;  3AZK C;  1P3K D;  2HIO D;  3AYW C;  2PYO C;  3B6G A;  3V9R B;  3WA9 A;  3W96 C;  1TAF A;  5B0Z D;  4WU9 A;  4AWL C;  3X1T A;  2LY8 A;  5B32 A;  4XUJ B;  3MGP B;  1P3M A;  4J8W D;  4R8P B;  3WTP A;  5DNM B;  3LZ0 A;  3B0B A;  3MGP D;  1F66 C;  4R8P D;  5B0Y C;  4X23 B;  3UT9 B;  3AZI B;  4JJN D;  1M1A B;  5B2J D;  5AV8 D;  4X23 D;  5AVB C;  5DNN C;  3UT9 D;  4LD9 A;  1M1A D;  3UTB A;  3AZE B;  5FUG B;  1KX5 D;  1KX4 C;  2CV5 C;  4QLC D;  3C1B D;  3AZJ A;  2F8N G;  3KSY A;  3KXB A;  5AV9 D;  3AZF C;  2HIO C;  4HGA C;  3B6G B;  4WNN A;  1P3F A;  2FJ7 A;  3B6G D;  3WKJ C;  3B6F C;  3WA9 B;  1TAF B;  5JRG A;  4WU9 B;  3REI A;  1R4V A;  3WA9 D;  3X1T B;  4H9S A;  5B32 B;  1P3M B;  1Q9C A;  5CP6 D;  3WTP B;  4G92 B;  4H9O B;  2L5A A;  3LZ0 B;  4XUJ C;  4KUD C;  5GT0 D;  1P34 A;  3LZ0 D;  4J8V A;  1ZLA A;  5CPJ A;  2NQB D;  5F99 B;  1JFI A;  3MGR A;  3UT9 C;  4LD9 B;  3AZI C;  1M1A C;  3UTB B;  3TU4 D;  2ARO A;  5F99 D;  2HUE B;  5CPK A;  5BNX A;  4YM6 C;  3AFA A;  3AZE C;  3UTB D;  3A6N D;  3WAA A;  3REK A;  1HTA A;  3AZJ B;  4H9R A;  5B40 D;  3KXB B;  4Z66 D;  5GSU D;  4WNN B;  1AOI A;  1ID3 A;  1P3F B;  3B6G C;  2FJ7 B;  3LEL A;  4H9P B;  5JRG B;  4H9Q A;  4WU8 D;  3LZ1 C;  1P3F D;  3X1S D;  3KWQ B;  2FJ7 D;  1KX3 C;  3REI B;  3B0C W;  3UTA D;  4WU9 C;  5JRG D;  1P3L A;  3W99 D;  3KWQ D;  3WTP E;  1M19 A;  2F8N K;  4YS3 A;  3X1T C;  5B32 C;  3VH5 A;  1P3M C;  1WWS A;  3WTP C;  3NQJ A;  4G92 C;  1P34 B;  2RVQ D;  3LZ0 C;  4J8V B;  1ZLA B;  5AV6 A;  2CWE A;  5CPJ B;  1U35 A;  3REL A;  1JFI B;  3MGR B;  4J8V D;  3C1C D;  1ZLA D;  5CPJ D;  2ARO B;  5B0Z A;  3W97 B;  5CPK B;  5BNX B;  4LD9 C;  3AFA B;  4KGC D;  2ARO D;  3W97 D;  2HUE C;  3X1U A;  3WAA B;  4J8W A;  3REK B;  4H9R B;  3REK D;  3W98 D;  3AZJ C;  1WWI A;  4JJN A;  5B2J A;  4E44 A;  3KXB C;  3REJ A;  1AOI B;  5AV8 A;  4WZS B;  1ID3 B;  4J8X D;  1S32 A;  5BT1 C;  3LEL B;  1AOI D;  4XZQ A;  2JSS A;  4H9Q B;  1KX5 A;  1ID3 D;  2BYM A;  3MVD D;  1M18 A;  5JRG C;  4QLC A;  3C1B A;  1P3L B;  1P3P A;  3REI C;  1M19 B;  4YS3 B;  1P3O D;  5AV9 A;  3NQJ B;  1M19 D;  5AV6 B;  5AVC A;  1U35 B;  3MGS B;  3AZN D;  1P34 C;  3REL B;  4EO5 C;  5AV6 D;  1U35 D;  3MGS D;  5B0Z B;  3REL D;  2NZD A;  5B33 D;  3MGR C;  3AZH D;  5JA4 A;  1BFM A;  1EQZ C;  4UUZ A;  2ARO C;  5AV5 D;  5CPK C;  3X1U B;  5CP6 A;  3AFA C;  5AY8 A;  3KUY A;  4Z2M H;  4J8W B;  3WAA C;  3X1U D;  3AV2 D;  5GT0 A;  4H9O A;  4JJN B;  5B24 B;  5B2J B;  3REJ B;  2NQB A;  5AV8 B;  1S32 B;  5B24 D;  3TU4 A;  3REJ D;  5F99 A;  1AOI C;  4XZQ B;  1ID3 C;  5BO0 A;  1KX5 B;  1P3B A;  2BYM B;  3LEL C;  1S32 D;  1M18 B;  3A6N A;  4XZQ D;  1A7W A;  4QLC B;  5B1L C;  3C1B B;  1P3P B;  4J8U A;  1M18 D;  1P3L C;  5B40 A;  1P3P D;  3AN2 D;  5BS7 C;  1M19 C;  5AV9 B;  4YS3 C;  4Z66 A;  5G49 A;  3REH A;  5B1M A;  5GSU A;  2YFV A;  1P3K C;  1P3I D;  5AVC B;  5BNV A;  3O62 A;  4H9N A;  5AV6 C;  5AVC D;  3AZG D;  3VH6 T;  4WU8 A;  2NZD B;  3X1S A;  4H9P A;  4CAY A;  5JA4 B;  3X1V D;  5CPI D;  4UUZ B;  5B0Z C;  3UTA A;  2NZD D;  3W99 A;  3KWQ A;  5CP6 B;  3KUY B;  5AY8 B;  1P3A D;  4Z5T A;  3AZL D;  4J8W C;  3KUY D;  5AY8 D;  5GT0 B;  3MGP C;  4R8P C;  5GXQ A;  1P3G D;  2NQB B;  3VH6 W;  3MGQ A;  3C1C A;  4JJN C;  1TZY A;  5B2J C;  3TU4 B;  5AV8 C;  4X23 C;  5BO0 B;  1P3B B;  4KGC A;  3W97 A;  3A6N B;  5KDM A;  1KX5 C;  5B2I D;  1P3B D;  4M6B A;  4J8U B;  5GT3 A;  4QLC C;  3C1B C;  5B40 B;  4J8U D;  3W98 A;  3B0C T;  4Z66 B;  5G49 B;  3REH B;  5B1M B;  5GSU B;  2YFV B;  2YFW A;  5AV9 C;  5BNV B;  3REH D;  5B1M D;  3O62 B;  4J8X A;  4H9N B;  1H3O A;  4WU8 B;  3O62 D;  3X1S B;  3MVD A;  4CAY B;  3UTA B;  3W99 B;  3WA9 C;  1P3O A;  4NFT A;  4Z5T B;  5B31 D;  5CP6 C;  1F1E A;  4Z5T D;  5GXQ B;  5GT0 C;  3AZN A;  3MGQ B;  3C1C B;  4ZUX A;  2NQB C;  1TZY B;  5GXQ D;  3MGS A;  5B33 A;  3MGQ D;  3AZH A;  3TU4 C;  1TZY D;  4KGC B;  5F99 C;  5AV5 A;  5KDM B;  5DNN A;  3LJA A;  3UTB C;  5GT3 B;  3A6N C;  3AV2 A;  2BYK A;  3W98 B;  5GT3 D;  5B40 C;  2YFW B;  4Z66 C;  5GSU C;  4DRB A;  4J8X B;  3B0D B; 
#chains in the Genus database with same CATH topology
 5B24 A;  1H3O B;  4CSR B;  5DNM D;  2ZM5 A;  3AZM D;  3AZK D;  3MVD B;  4WU8 C;  2PYO D;  1P3F C;  3X1S C;  1W2E A;  2FJ7 C;  3WKJ A;  3B6F A;  1B6W A;  3UTA C;  1P3O B;  3W99 C;  1ULY A;  1HQ3 A;  3KWQ C;  4AWL B;  3AN2 A;  3W96 D;  4H9S C;  1P3I A;  4NE5 A;  3AZN B;  2RVQ C;  1F66 B;  4ZUX B;  4E45 A;  3AZG A;  3MGQ C;  2Y2I A;  5B33 B;  3R45 A;  4J8V C;  3C1C C;  3AZH B;  1F66 D;  1ZLA C;  3X1V A;  1TZY C;  4ZUX D;  5CPI A;  5CPJ C;  5AV5 B;  5DNN B;  2FFF B;  4KGC C;  3LJA B;  1P3A A;  3W97 C;  3AV2 B;  2DF4 C;  5DNN D;  5AVB D;  4YM6 A;  3AZL A;  3EPH A;  3LJA D;  2BYK B;  2Y2J A;  5B31 G;  3REK C;  1KX4 D;  1P3G A;  2CV5 D;  3W98 C;  2W8S A;  2Y2O A;  4J8X C;  3AZF D;  3AV1 A;  5B2I A;  2F8N H;  3MVD C;  3B6F B;  3VH6 A;  3WKJ B;  3LZ1 A;  2IO5 B;  1HQ3 B;  3AN2 B;  1KX3 A;  3B6F D;  3WKJ D;  3NQU A;  1P3O C;  2BG1 A;  1P3I B;  1HQ3 D;  2JE5 A;  4KUD B;  3AZG B;  3AZN C;  3R45 B;  4XUJ D;  4KUD D;  4G91 B;  4ZUX C;  3X1V B;  1U35 C;  3MGS C;  5CPI B;  3REL C;  5B33 C;  3AZH C;  1N1J A;  2J8P A;  4Z2M G;  4DRA A;  5AV5 C;  1P3A B;  3AZL B;  4NE3 A;  5B31 A;  2ZY4 A;  4YM6 B;  3LJA C;  3AZI D;  3X1U C;  3AV2 C;  3MNN A;  4YM6 D;  5E5A A;  1P3G B;  3AZE D;  5B24 C;  2Y2M A;  3REJ C;  3EG5 B;  3AV1 B;  5B2I B;  1S32 C;  4XZQ C;  3AV1 D;  3LZ1 B;  1KX3 B;  4ZBJ B;  1M18 C;  1BH9 A;  3NQU B;  1B67 A;  2F2A C;  2IO5 C;  3LZ1 D;  1HQ3 C;  1P3P C;  3AN2 C;  1KX3 D;  4WU9 D;  4KHA A;  1P3I C;  4UPK A;  4NE6 A;  5DNM A;  5B32 D;  3X1T D;  3AZM A;  5AVC C;  3AZK A;  3AZG C;  1P3M D;  3WTP D;  4CSR A;  2PYO A;  3AYW A;  4G91 C;  3X1V C;  1KU5 A;  1N1J B;  2Y2P A;  5CPI C;  2NZD C;  5B31 B;  3W96 A;  1EQZ A;  1P3A C;  3AZL C;  3MNN B;  3KUY C;  4LD9 D;  5AY8 C;  5E5A B;  3F6T A;  3MNN D;  1P3G C;  5E5A D;  2F8N A;  1F66 A;  5B0Y A;  3AZJ D;  3KXB D;  3AV1 C;  5B2I C;  5AVB A;  1P3B C;  5BT1 D;  1BH9 B;  2VQR A;  5B1L A;  1KX4 A;  2CV5 A;  4ZBJ C;  4J8U C;  2UWX A;  3AL0 C;  4KHA B;  5BS7 A;  3REI D;  3REH C;  5B1M C;  5C3I B;  2Y2L A;  3AZM B;  3AZK B;  1P3K A;  3AZF A;  2HIO A;  1BH8 A;  3O62 C;  3AYW B;  2PYO B;  4EO5 B;  2Y2H A;  1P34 D;  3AYW D;  3W96 B;  3V9R A;  1EQZ B;  4WJ3 C;  3MGR D;  5B31 C;  1EQZ D;  5CPK D;  4Z5T C;  2XD5 A;  3MNN C;  3VH5 T;  5E5A C;  3AFA D;  2F8N B;  4XUJ A;  3MGP A;  3WAA D;  4KUD A;  5GXQ C;  4R8P A;  5B32 G;  5B0Y B;  2F8N D;  5B0Y D;  2Y2Q A;  4X23 A;  3UT9 A;  5AVB B;  3AZI A;  1M1A A;  1Z2C B;  5B1L B;  1KX4 B;  3VH5 W;  3LEL D;  3AZE A;  2CV5 B;  5GT3 C;  5FUG A;  5B1L D;  4WV4 B;  5CHL B;  1P3L D;  1P3K B;  4YS3 D;  3AZF B;  2HIO B;  5DNM C;  1BH8 B;  4HGA B;  5C3I C;  3AZM C;  3B0D C;  3AZK C;  1P3K D;  2HIO D;  3AYW C;  2PYO C;  3B6G A;  3V9R B;  3WA9 A;  3W96 C;  1TAF A;  5B0Z D;  4WU9 A;  4AWL C;  3X1T A;  2LY8 A;  5B32 A;  4XUJ B;  3MGP B;  1P3M A;  4J8W D;  4R8P B;  3WTP A;  5DNM B;  3LZ0 A;  3B0B A;  3MGP D;  1F66 C;  4R8P D;  5B0Y C;  4X23 B;  2Y2K A;  3UT9 B;  3AZI B;  3EPJ A;  4JJN D;  5B2J D;  1M1A B;  5AV8 D;  4X23 D;  5AVB C;  5DNN C;  3UT9 D;  4LD9 A;  2Y2N A;  1M1A D;  3UTB A;  3AZE B;  5FUG B;  1KX5 D;  1KX4 C;  2CV5 C;  4QLC D;  3C1B D;  3H0L C;  3AZJ A;  2F8N G;  3KSY A;  3KXB A;  5AV9 D;  3AZF C;  2HIO C;  4HGA C;  2DQN C;  3B6G B;  4WNN A;  1P3F A;  2FJ7 A;  3B6G D;  3WKJ C;  3B6F C;  3WA9 B;  1TAF B;  5JRG A;  4WU9 B;  2G5H C;  3REI A;  1R4V A;  3WA9 D;  3X1T B;  4H9S A;  5B32 B;  1P3M B;  1Q9C A;  5CP6 D;  3WTP B;  4G92 B;  4H9O B;  2L5A A;  3LZ0 B;  4XUJ C;  4KUD C;  5GT0 D;  1P34 A;  3LZ0 D;  4J8V A;  1ZLA A;  5CPJ A;  2NQB D;  1PZR A;  5F99 B;  1JFI A;  3MGR A;  3UT9 C;  4LD9 B;  3AZI C;  1M1A C;  3UTB B;  3TU4 D;  2ARO A;  5F99 D;  2HUE B;  5CPK A;  5BNX A;  4YM6 C;  3AFA A;  3AZE C;  3UTB D;  3A6N D;  3WAA A;  3REK A;  1HTA A;  3AZJ B;  4H9R A;  5B40 D;  3KXB B;  4Z66 D;  5GSU D;  4WNN B;  1AOI A;  1ID3 A;  1P3F B;  3B6G C;  2FJ7 B;  3LEL A;  4H9P B;  3KFU G;  3A1K A;  5JRG B;  4H9Q A;  4WU8 D;  3LZ1 C;  1P3F D;  3X1S D;  3KWQ B;  2FJ7 D;  1KX3 C;  3REI B;  3B0C W;  3UTA D;  4WU9 C;  2XD1 A;  5JRG D;  1P3L A;  3W99 D;  3KWQ D;  3WTP E;  1M19 A;  2F8N K;  4YS3 A;  3X1T C;  5B32 C;  3VH5 A;  1P3M C;  1WWS A;  3WTP C;  3NQJ A;  4G92 C;  1P34 B;  2RVQ D;  3LZ0 C;  4J8V B;  1ZLA B;  5AV6 A;  2CWE A;  5CPJ B;  1U35 A;  2RIQ A;  3REL A;  1JFI B;  3MGR B;  4J8V D;  3C1C D;  1ZLA D;  5CPJ D;  2ARO B;  5B0Z A;  3W97 B;  5CPK B;  5BNX B;  4LD9 C;  3AFA B;  4KGC D;  2ARO D;  3W97 D;  2HUE C;  3X1U A;  3WAA B;  3H0M C;  4J8W A;  3REK B;  4H9R B;  3REK D;  3W98 D;  3EPL A;  3AZJ C;  1WWI A;  4JJN A;  5B2J A;  4E44 A;  3KXB C;  3REJ A;  1AOI B;  5AV8 A;  4WZS B;  1ID3 B;  4J8X D;  1S32 A;  5BT1 C;  3LEL B;  1AOI D;  4XZQ A;  2JSS A;  4H9Q B;  1KX5 A;  1ID3 D;  2BYM A;  3MVD D;  1M18 A;  5JRG C;  4QLC A;  3C1B A;  1P3L B;  1P3P A;  3REI C;  1M19 B;  4YS3 B;  1P3O D;  5AV9 A;  3NQJ B;  1M19 D;  5AV6 B;  5AVC A;  1U35 B;  3MGS B;  3AZN D;  1P34 C;  3REL B;  4EO5 C;  5AV6 D;  1U35 D;  3MGS D;  5B0Z B;  3REL D;  2NZD A;  5B33 D;  3MGR C;  3AZH D;  5JA4 A;  1BFM A;  1EQZ C;  4UUZ A;  3FDD A;  2ARO C;  5AV5 D;  5CPK C;  3X1U B;  5CP6 A;  3AFA C;  5AY8 A;  3KUY A;  4Z2M H;  4J8W B;  3WAA C;  3X1U D;  3AV2 D;  5GT0 A;  4H9O A;  4JJN B;  5B24 B;  5B2J B;  3REJ B;  2NQB A;  5AV8 B;  1S32 B;  5B24 D;  3TU4 A;  3REJ D;  5F99 A;  1AOI C;  4XZQ B;  1ID3 C;  5BO0 A;  1KX5 B;  1P3B A;  2BYM B;  3LEL C;  1S32 D;  1M18 B;  3A6N A;  4XZQ D;  1A7W A;  4QLC B;  5B1L C;  3C1B B;  1P3P B;  2ZY2 A;  4J8U A;  2G5I C;  1M18 D;  4DQY B;  2Y2G A;  1P3L C;  5B40 A;  1P3P D;  3AN2 D;  5BS7 C;  1M19 C;  5AV9 B;  3P5J B;  4YS3 C;  5G49 A;  4Z66 A;  5B1M A;  5GSU A;  3REH A;  2YFV A;  1P3K C;  1P3I D;  5AVC B;  2JCH A;  5BNV A;  3O62 A;  4H9N A;  5AV6 C;  5AVC D;  3AZG D;  3IP4 C;  3VH6 T;  4WU8 A;  2NZD B;  3X1S A;  4H9P A;  4CAY A;  5JA4 B;  3X1V D;  5CPI D;  4UUZ B;  5B0Z C;  3UTA A;  2NZD D;  1T3U A;  3W99 A;  3KWQ A;  5CP6 B;  3KUY B;  5AY8 B;  1P3A D;  3H0R C;  4Z5T A;  3AZL D;  4J8W C;  3KUY D;  5AY8 D;  5GT0 B;  3MGP C;  4R8P C;  5GXQ A;  1P3G D;  2NQB B;  3VH6 W;  3MGQ A;  3C1C A;  4JJN C;  1TZY A;  5B2J C;  3TU4 B;  5AV8 C;  4X23 C;  5BO0 B;  1P3B B;  4KGC A;  3W97 A;  3A6N B;  5KDM A;  1KX5 C;  5B2I D;  1P3B D;  4M6B A;  4J8U B;  3A1I A;  5GT3 A;  4QLC C;  3C1B C;  5B40 B;  2ZY3 A;  4J8U D;  3W98 A;  3B0C T;  4Z66 B;  5G49 B;  3REH B;  5B1M B;  5GSU B;  2YFV B;  2YFW A;  5AV9 C;  5BNV B;  3REH D;  5B1M D;  3O62 B;  4J8X A;  4H9N B;  2ZY5 A;  1H3O A;  4WU8 B;  3O62 D;  3X1S B;  3MVD A;  4CAY B;  3UTA B;  3W99 B;  3WA9 C;  1P3O A;  4NFT A;  4Z5T B;  5B31 D;  5CP6 C;  1F1E A;  4Z5T D;  5GXQ B;  5GT0 C;  3AZN A;  3MGQ B;  3C1C B;  4ZUX A;  2NQB C;  1TZY B;  5GXQ D;  3MGS A;  5B33 A;  3MGQ D;  3AZH A;  3TU4 C;  1TZY D;  4KGC B;  5F99 C;  5AV5 A;  5KDM B;  5DNN A;  3LJA A;  3UTB C;  5GT3 B;  3A6N C;  3AV2 A;  2BYK A;  3W98 B;  5GT3 D;  3EPK A;  5B40 C;  2YFW B;  4Z66 C;  5GSU C;  4DRB A;  4J8X B;  3B0D B; 
#chains in the Genus database with same CATH homology
 5B24 A;  1H3O B;  4CSR B;  5DNM D;  2ZM5 A;  3AZM D;  3AZK D;  3MVD B;  4WU8 C;  2PYO D;  1P3F C;  3X1S C;  1W2E A;  2FJ7 C;  3WKJ A;  3B6F A;  1B6W A;  3UTA C;  1P3O B;  3W99 C;  1ULY A;  1HQ3 A;  3KWQ C;  4AWL B;  3AN2 A;  3W96 D;  4H9S C;  1P3I A;  4NE5 A;  3AZN B;  2RVQ C;  1F66 B;  4ZUX B;  4E45 A;  3AZG A;  3MGQ C;  2Y2I A;  5B33 B;  3R45 A;  4J8V C;  3C1C C;  3AZH B;  1F66 D;  1ZLA C;  3X1V A;  1TZY C;  4ZUX D;  5CPI A;  5CPJ C;  5AV5 B;  5DNN B;  2FFF B;  4KGC C;  3LJA B;  1P3A A;  3W97 C;  3AV2 B;  2DF4 C;  5DNN D;  5AVB D;  4YM6 A;  3AZL A;  3EPH A;  3LJA D;  2BYK B;  2Y2J A;  5B31 G;  3REK C;  1KX4 D;  1P3G A;  2CV5 D;  3W98 C;  2W8S A;  2Y2O A;  4J8X C;  3AZF D;  3AV1 A;  5B2I A;  2F8N H;  3MVD C;  3B6F B;  3VH6 A;  3WKJ B;  3LZ1 A;  2IO5 B;  1HQ3 B;  3AN2 B;  1KX3 A;  3B6F D;  3WKJ D;  3NQU A;  1P3O C;  2BG1 A;  1P3I B;  1HQ3 D;  2JE5 A;  4KUD B;  3AZG B;  3AZN C;  3R45 B;  4XUJ D;  4KUD D;  4G91 B;  4ZUX C;  3X1V B;  1U35 C;  3MGS C;  5CPI B;  3REL C;  5B33 C;  3AZH C;  1N1J A;  2J8P A;  4Z2M G;  4DRA A;  5AV5 C;  1P3A B;  3AZL B;  4NE3 A;  5B31 A;  2ZY4 A;  4YM6 B;  3LJA C;  3AZI D;  3X1U C;  3AV2 C;  3MNN A;  4YM6 D;  5E5A A;  1P3G B;  3AZE D;  5B24 C;  2Y2M A;  3REJ C;  3EG5 B;  3AV1 B;  5B2I B;  1S32 C;  4XZQ C;  3AV1 D;  3LZ1 B;  1KX3 B;  4ZBJ B;  1M18 C;  1BH9 A;  3NQU B;  1B67 A;  2F2A C;  2IO5 C;  3LZ1 D;  1HQ3 C;  1P3P C;  3AN2 C;  1KX3 D;  4WU9 D;  4KHA A;  1P3I C;  4UPK A;  4NE6 A;  5DNM A;  5B32 D;  3X1T D;  3AZM A;  5AVC C;  3AZK A;  3AZG C;  1P3M D;  3WTP D;  4CSR A;  2PYO A;  3AYW A;  4G91 C;  3X1V C;  1KU5 A;  1N1J B;  2Y2P A;  5CPI C;  2NZD C;  5B31 B;  3W96 A;  1EQZ A;  1P3A C;  3AZL C;  3MNN B;  3KUY C;  4LD9 D;  5AY8 C;  5E5A B;  3F6T A;  3MNN D;  1P3G C;  5E5A D;  2F8N A;  1F66 A;  5B0Y A;  3AZJ D;  3KXB D;  3AV1 C;  5B2I C;  5AVB A;  1P3B C;  5BT1 D;  1BH9 B;  2VQR A;  5B1L A;  1KX4 A;  2CV5 A;  4ZBJ C;  4J8U C;  2UWX A;  3AL0 C;  4KHA B;  5BS7 A;  3REI D;  3REH C;  5B1M C;  5C3I B;  2Y2L A;  3AZM B;  3AZK B;  1P3K A;  3AZF A;  2HIO A;  1BH8 A;  3O62 C;  3AYW B;  2PYO B;  4EO5 B;  2Y2H A;  1P34 D;  3AYW D;  3W96 B;  3V9R A;  1EQZ B;  4WJ3 C;  3MGR D;  5B31 C;  1EQZ D;  5CPK D;  4Z5T C;  2XD5 A;  3MNN C;  3VH5 T;  5E5A C;  3AFA D;  2F8N B;  4XUJ A;  3MGP A;  3WAA D;  4KUD A;  5GXQ C;  4R8P A;  5B32 G;  5B0Y B;  2F8N D;  5B0Y D;  2Y2Q A;  4X23 A;  3UT9 A;  5AVB B;  3AZI A;  1M1A A;  1Z2C B;  5B1L B;  1KX4 B;  3VH5 W;  3LEL D;  3AZE A;  2CV5 B;  5GT3 C;  5FUG A;  5B1L D;  4WV4 B;  5CHL B;  1P3L D;  1P3K B;  4YS3 D;  3AZF B;  2HIO B;  5DNM C;  1BH8 B;  4HGA B;  5C3I C;  3AZM C;  3B0D C;  3AZK C;  1P3K D;  2HIO D;  3AYW C;  2PYO C;  3B6G A;  3V9R B;  3WA9 A;  3W96 C;  1TAF A;  5B0Z D;  4WU9 A;  4AWL C;  3X1T A;  2LY8 A;  5B32 A;  4XUJ B;  3MGP B;  1P3M A;  4J8W D;  4R8P B;  3WTP A;  5DNM B;  3LZ0 A;  3B0B A;  3MGP D;  1F66 C;  4R8P D;  5B0Y C;  4X23 B;  2Y2K A;  3UT9 B;  3AZI B;  3EPJ A;  4JJN D;  5B2J D;  1M1A B;  5AV8 D;  4X23 D;  5AVB C;  5DNN C;  3UT9 D;  4LD9 A;  2Y2N A;  1M1A D;  3UTB A;  3AZE B;  5FUG B;  1KX5 D;  1KX4 C;  2CV5 C;  4QLC D;  3C1B D;  3H0L C;  3AZJ A;  2F8N G;  3KSY A;  3KXB A;  5AV9 D;  3AZF C;  2HIO C;  4HGA C;  2DQN C;  3B6G B;  4WNN A;  1P3F A;  2FJ7 A;  3B6G D;  3WKJ C;  3B6F C;  3WA9 B;  1TAF B;  5JRG A;  4WU9 B;  2G5H C;  3REI A;  1R4V A;  3WA9 D;  3X1T B;  4H9S A;  5B32 B;  1P3M B;  1Q9C A;  5CP6 D;  3WTP B;  4G92 B;  4H9O B;  2L5A A;  3LZ0 B;  4XUJ C;  4KUD C;  5GT0 D;  1P34 A;  3LZ0 D;  4J8V A;  1ZLA A;  5CPJ A;  2NQB D;  1PZR A;  5F99 B;  1JFI A;  3MGR A;  3UT9 C;  4LD9 B;  3AZI C;  1M1A C;  3UTB B;  3TU4 D;  2ARO A;  5F99 D;  2HUE B;  5CPK A;  5BNX A;  4YM6 C;  3AFA A;  3AZE C;  3UTB D;  3A6N D;  3WAA A;  3REK A;  1HTA A;  3AZJ B;  4H9R A;  5B40 D;  3KXB B;  4Z66 D;  5GSU D;  4WNN B;  1AOI A;  1ID3 A;  1P3F B;  3B6G C;  2FJ7 B;  3LEL A;  4H9P B;  3KFU G;  3A1K A;  5JRG B;  4H9Q A;  4WU8 D;  3LZ1 C;  1P3F D;  3X1S D;  3KWQ B;  2FJ7 D;  1KX3 C;  3REI B;  3B0C W;  3UTA D;  4WU9 C;  2XD1 A;  5JRG D;  1P3L A;  3W99 D;  3KWQ D;  3WTP E;  1M19 A;  2F8N K;  4YS3 A;  3X1T C;  5B32 C;  3VH5 A;  1P3M C;  1WWS A;  3WTP C;  3NQJ A;  4G92 C;  1P34 B;  2RVQ D;  3LZ0 C;  4J8V B;  1ZLA B;  5AV6 A;  2CWE A;  5CPJ B;  1U35 A;  2RIQ A;  3REL A;  1JFI B;  3MGR B;  4J8V D;  3C1C D;  1ZLA D;  5CPJ D;  2ARO B;  5B0Z A;  3W97 B;  5CPK B;  5BNX B;  4LD9 C;  3AFA B;  4KGC D;  2ARO D;  3W97 D;  2HUE C;  3X1U A;  3WAA B;  3H0M C;  4J8W A;  3REK B;  4H9R B;  3REK D;  3W98 D;  3EPL A;  3AZJ C;  1WWI A;  4JJN A;  5B2J A;  4E44 A;  3KXB C;  3REJ A;  1AOI B;  5AV8 A;  4WZS B;  1ID3 B;  4J8X D;  1S32 A;  5BT1 C;  3LEL B;  1AOI D;  4XZQ A;  2JSS A;  4H9Q B;  1KX5 A;  1ID3 D;  2BYM A;  3MVD D;  1M18 A;  5JRG C;  4QLC A;  3C1B A;  1P3L B;  1P3P A;  3REI C;  1M19 B;  4YS3 B;  1P3O D;  5AV9 A;  3NQJ B;  1M19 D;  5AV6 B;  5AVC A;  1U35 B;  3MGS B;  3AZN D;  1P34 C;  3REL B;  4EO5 C;  5AV6 D;  1U35 D;  3MGS D;  5B0Z B;  3REL D;  2NZD A;  5B33 D;  3MGR C;  3AZH D;  5JA4 A;  1BFM A;  1EQZ C;  4UUZ A;  3FDD A;  2ARO C;  5AV5 D;  5CPK C;  3X1U B;  5CP6 A;  3AFA C;  5AY8 A;  3KUY A;  4Z2M H;  4J8W B;  3WAA C;  3X1U D;  3AV2 D;  5GT0 A;  4H9O A;  4JJN B;  5B24 B;  5B2J B;  3REJ B;  2NQB A;  5AV8 B;  1S32 B;  5B24 D;  3TU4 A;  3REJ D;  5F99 A;  1AOI C;  4XZQ B;  1ID3 C;  5BO0 A;  1KX5 B;  1P3B A;  2BYM B;  3LEL C;  1S32 D;  1M18 B;  3A6N A;  4XZQ D;  1A7W A;  4QLC B;  5B1L C;  3C1B B;  1P3P B;  2ZY2 A;  4J8U A;  2G5I C;  1M18 D;  4DQY B;  2Y2G A;  1P3L C;  5B40 A;  1P3P D;  3AN2 D;  5BS7 C;  1M19 C;  5AV9 B;  3P5J B;  4YS3 C;  5G49 A;  4Z66 A;  5B1M A;  5GSU A;  3REH A;  2YFV A;  1P3K C;  1P3I D;  5AVC B;  2JCH A;  5BNV A;  3O62 A;  4H9N A;  5AV6 C;  5AVC D;  3AZG D;  3IP4 C;  3VH6 T;  4WU8 A;  2NZD B;  3X1S A;  4H9P A;  4CAY A;  5JA4 B;  3X1V D;  5CPI D;  4UUZ B;  5B0Z C;  3UTA A;  2NZD D;  1T3U A;  3W99 A;  3KWQ A;  5CP6 B;  3KUY B;  5AY8 B;  1P3A D;  3H0R C;  4Z5T A;  3AZL D;  4J8W C;  3KUY D;  5AY8 D;  5GT0 B;  3MGP C;  4R8P C;  5GXQ A;  1P3G D;  2NQB B;  3VH6 W;  3MGQ A;  3C1C A;  4JJN C;  1TZY A;  5B2J C;  3TU4 B;  5AV8 C;  4X23 C;  5BO0 B;  1P3B B;  4KGC A;  3W97 A;  3A6N B;  5KDM A;  1KX5 C;  5B2I D;  1P3B D;  4M6B A;  4J8U B;  3A1I A;  5GT3 A;  4QLC C;  3C1B C;  5B40 B;  2ZY3 A;  4J8U D;  3W98 A;  3B0C T;  4Z66 B;  5G49 B;  3REH B;  5B1M B;  5GSU B;  2YFV B;  2YFW A;  5AV9 C;  5BNV B;  3REH D;  5B1M D;  3O62 B;  4J8X A;  4H9N B;  2ZY5 A;  1H3O A;  4WU8 B;  3O62 D;  3X1S B;  3MVD A;  4CAY B;  3UTA B;  3W99 B;  3WA9 C;  1P3O A;  4NFT A;  4Z5T B;  5B31 D;  5CP6 C;  1F1E A;  4Z5T D;  5GXQ B;  5GT0 C;  3AZN A;  3MGQ B;  3C1C B;  4ZUX A;  2NQB C;  1TZY B;  5GXQ D;  3MGS A;  5B33 A;  3MGQ D;  3AZH A;  3TU4 C;  1TZY D;  4KGC B;  5F99 C;  5AV5 A;  5KDM B;  5DNN A;  3LJA A;  3UTB C;  5GT3 B;  3A6N C;  3AV2 A;  2BYK A;  3W98 B;  5GT3 D;  3EPK A;  5B40 C;  2YFW B;  4Z66 C;  5GSU C;  4DRB A;  4J8X B;  3B0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...