4R8PA

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pA00
2F8NH 3W97C 3KUYB 2YFVB 3VH6A 3MNNC 3AZIB 3AV1B 5CPIA 5GT0D 1P3ID 4KGCB 2CV5B 1ULYA 3LZ1A 1AOID 4Z5TD 2BYMA 4H9PA 3AFAC 3LELB 4QLCC 5F99B 2RVQC 1ID3C 5B24D 3W97A 3MNNA 3WKJD 5AV8D 1KX4C 1HQ3D 4XZQC 3R45B 3X1UB 2HIOB 3AFAA 4QLCA 1ID3A 5BNXB 1N1JA 1M1AA 3X1TD 4YM6C 3W98B 4WU9D 5CPKB 1KX4A 2JSSA 3LJAC 4WNNA 5B32C 3AN2C 5B2JD 1P3GC 4XZQA 3X1SC 5B0ZD 4H9OB 5GSUC 5CP6C 1P3KB 5DNMC 4LD9D 4YM6A 2FJ7C 4DRAA 1A7WA 5AV5D 4R8PD 3KXBD 5CPIB 3LJAA 1KX3C 5B32A 1P3PD 3VH5T 3AN2A 5BO0A 1P3GA 3LZ1B 3AZJB 3AZND 4KHAB 1WWIA 5GSUA 5CP6A 2F8NG 5AVCB 5DNMA 5GT0C 1P3IC 2FJ7A 3W97B 3NQJB 3MNNB 1AOIC 4Z5TC 1KX3A 3WA9B 3AZEB 3W99D 4AWLC 3WKJC 5AV8C 5GT0A 1P3IA 5B1LB 1AOIA 1HQ3C 4Z5TA 5B2ID 1KX4B 3AYWD 4WNNB 1TZYD 3X1TC 3WKJA 5AV8A 5B2JC 3LJAB 5B0ZC 3B0DC 3AV2D 3AZKC 3X1TA 4LD9C 4H9NA 3X1SB 4KGCD 5AV5C 4R8PC 3KXBC 3UTAA 4H9RB 4UUZB 5DNMB 3REKD 1P3PC 2FJ7B 5B2JA 3W96B 5F99D 3TU4D 3AZNC 5B0ZA 5AV9D 4HGAB 3AZKA 4LD9A 5GT3C 5AV5A 4R8PA 3KXBA 4NE5A 1P3IB 1P3PA 1P3LB 1AOIB 3W99C 4Z5TB 3B6GB 3AZGB 3AZNA 5CPKD 5B24B 5GT3A 5B2IC 3WKJB 5AV8B 3AYWC 1TZYC 3W99A 1HQ3B 1P3KD 2AROD 3B0CW 3VH6T 3A6ND 4H9NB 4WU9B 4DRBA 5B2IA 3AZJD 5B0YD 3AYWA 3AV2C 1TZYA 5B2JB 3AZLB 4KGCC 5B0ZB 3B0DB 4EO5B 1F66D 3REKC 3WA9D 5F99C 4R8PB 3TU4C 4J8XD 3AV2A 5AV9C 1U35B 3MGQD 4H9QB 5CHLB 3MGRB 4KGCA 2CV5A 5B1LD 5B1MD 3REKA 5F99A 3TU4A 4H9SC 3C1CD 5CPKC 4ZBJB 4KUDD 3X1UA 1B6WA 5BNXA 1P3KC 2AROC 3W98A 4H9SA 3A6NC 3AZHB 5CPKA 1P3MB 3REJD 3W96D 3AZJC 1P3KA 2AROA 2HUEC 5AVCC 4X23D 3AV2B 1P3OD 2LY8A 1KX5D 1F66C 1ZLAD 3WA9C 1P3LD 3AZEC 3AZJA 3B6GD 4J8XC 3AZGD 3REKB 4KHAA 3MGQC 4WU8D 5AVCA 3TU4B 3NQJA 5B1LC 3C1BD 5AV9B 5B1MC 1WWSA 1F66A 3WA9A 5BT1D 3AZEA 2YFWA 4J8XA 3MGQA 3C1CC 4G92B 1P3FD 1S32B 5B32G 5B1LA 5B1MA 4KUDC 5E5AD 3O62D 5KDMB 3AZLD 1H3OA 3C1CA 2AROB 2F8ND 3A6NB 3W96C 4KUDA 5B31G 1U35D 4HGAC 1P3BB 4J8UD 3X1SA 3NQUB 5B0YB 4E45A 3MGRD 4X23C 1P3OC 4H9RA 4UUZA 2HUEB 4Z2MH 1KX5C 1P3LC 3W96A 5BNVA 5AY8B 3B6GC 3AZGC 1F66B 4WU8C 2YFWB 5B24C 4J8XB 4X23A 1TAFA 3C1BC 3MGQB 1KX5A 3KWQD 1P3LA 5BT1C 3B6GA 5B1MB 3AZGA 3KSYA 5B40B 3AZHD 4WU8A 1P3FC 5B24A 4CAYA 1P3MD 3C1BA 4WU9C 1H3OB 3C1CB 5E5AC 4J8WD 1HQ3A 3O62C 4KUDB 3AZLC 3REIB 1P3FA 4EO5C 4WU9A 1JFIA 2NZDD 2IO5B 5E5AA 4ZUXB 5CPJB 1U35C 3REJB 3O62A 4J8UC 5BNVB 3REHD 3AZLA 3MGRC 3B0CT 4X23B 1TAFB 4YS3D 1P3OB 1M19D 1KX5B 1ZLAB 5B33D 1U35A 4J8UA 4H9QA 1S32D 3MGRA 4ZBJC 4WU8B 3KWQC 4CAYB 3C1BB 5C3IC 3AZHC 1P3MC 1P3FB 2F8NK 4M6BA 1P3BD 5JA4B 1JFIB 3AZMD 5E5AB 1B67A 3AZHA 3O62B 1P3MA 4NE3A 5AY8D 1BH8A 2F8NB 5DNNB 3REHC 3MGPD 4J8UB 5GXQB 3LZ0D 4YS3C 1M19C 3UT9D 5B33C 5B40D 1Q9CA 4G92C 3REHA 1S32C 5AV9A 4E44A 4YS3A 1M19A 3B6FD 3KWQB 5B33A 3REID 1F1EA 1S32A 5C3IB 1R4VA 3AZFB 4ZUXD 5CPJD 1P3BC 1ID3D 4QLCD 3AZMC 5KDMA 5B0YC 4J8WB 1M1AD 1BH8B 2PYOD 1BFMA 3WAAD 3A6NA 3UTBB 5AY8C 1P3BA 2NZDB 3NQUA 3AZMA 5AV6D 5B0YA 3MGPC 4YM6D 5G49A 3REHB 3LZ0C 5AY8A 3AN2D 1P3GD 3UT9C 5B40C 4YS3B 5GSUD 1M19B 3MGPA 5B33B 4G91C 3B6FC 3UT9A 3REIC 5B40A 5B31D 4JJND 5JRGB 1HTAA 4XUJB 2IO5C 4ZUXC 3MGSD 5CPJC 3REJC 5DNND 3B6FA 1M1AC 3REIA 2PYOC 1P3AD 1P34B 3WAAC 3AZMB 5GXQD 4ZUXA 5G49B 1ZLAC 3RELB 5CPJA 3REJA 5AV6C 2PYOA 2BYKA 3UTAD 3WAAA 3MGPB 1P3OA 1ZLAA 3LZ0B 3V9RA 5AV6A 3AZKD 3UT9B 1EQZD 5AVBD 3AZFD 4G91B 5B31C 4JJNC 2BYMB 4H9PB 3B6FB 5GT3D 3X1VD 3UTBD 3MGSC 5DNNC 1BH9A 5JA4A 4Z66D 5B31A 4JJNA 1P3AC 3AFAB 1ID3B 4QLCB 1N1JB 1M1AB 2PYOB 5GXQC 3MVDD 3WTPD 3B0BA 2BYKB 4WV4B 3MGSA 3WAAB 3VH5W 2F8NA 5DNNA 4Z2MG 2NQBD 4XZQB 1P3AA 3V9RB 4J8VD 3UTAC 1M18D 5AV6B 1KU5A 5GXQA 4YM6B 5BS7C 3KUYD 3AZID 5B32B 3AV1D 5JRGD 3AN2B 5BO0B 1P3GB 1EQZC 4XUJD 5AVBC 2CV5D 3AZFC 5GSUB 5CP6B 3LELD 3KWQA 5BS7A 4J8WC 1KX3B 1BH9B 1P34D 1EQZA 4NFTA 5AVBA 2CWEA 5B31B 3X1VC 3WTPE 4JJNB 3UTBC 3AZFA 5GT0B 3RELD 3X1UD 2HIOD 2NZDC 3VH5A 4Z66C 3MGSB 4J8WA 3W98D 4AWLB 4CSRA 3MVDC 3WTPC 3UTBA 3X1VA 1P3AB 2NZDA 4Z66A 2L5AA 2NQBC 4J8VC 1M18C 5FUGA 5CPID 3X1TB 3MVDA 3WTPA 3LZ1D 4WZSB 3UTAB 3KUYC 3AZIC 3AV1C 5JRGC 4NE6A 2NQBA 5AVCD 4XUJC 3W97D 2CV5C 3MNND 4J8VA 1M18A 3AZKB 4LD9B 1EQZB 5AVBB 3LELC 5AV5B 3AZED 3KXBB 3KUYA 2YFVA 3AZIA 3AV1A 1P3PB 5JRGA 3AFAD 1P34C 3VH6W 2RVQD 4XUJA 3AZNB 3RELC 1KX4D 4CSRB 3X1UC 2HIOC 5GT3B 3LELA 3X1VB 4XZQD 3W98C 1P34A 4Z66B 3W99B 5FUGB 3R45A 3RELA 3LJAD 2HIOA 3MVDB 3WTPB 5B32D 5B2IB 3X1SD 3AYWB 1TZYB 5CPIC 5CP6D 2NQBB 5DNMD 2FJ7D 4J8VB 3LZ1C 1M18B 1KX3D 3LZ0A 4H9OA
chains in the Genus database with same CATH superfamily
2F8NH 3W97C 3KUYB 2YFVB 3VH6A 3MNNC 3AZIB 3AV1B 5CPIA 5GT0D 1P3ID 4KGCB 2CV5B 1ULYA 3LZ1A 1AOID 4Z5TD 2BYMA 4H9PA 3AFAC 3LELB 4QLCC 5F99B 2RVQC 1ID3C 5B24D 2ZY2A 3W97A 3MNNA 3WKJD 5AV8D 1KX4C 1HQ3D 4XZQC 3R45B 3X1UB 2HIOB 3AFAA 4QLCA 1ID3A 5BNXB 1N1JA 1M1AA 3X1TD 4DQYB 4YM6C 3W98B 4WU9D 5CPKB 1KX4A 2JSSA 3LJAC 4WNNA 5B32C 3AN2C 5B2JD 1P3GC 4XZQA 3X1SC 5B0ZD 4H9OB 5GSUC 5CP6C 1P3KB 1W2EA 2DF4C 5DNMC 4YM6A 2FJ7C 4LD9D 4DRAA 1A7WA 5AV5D 4R8PD 3KXBD 5CPIB 3LJAA 1KX3C 5B32A 1P3PD 3VH5T 3AN2A 5BO0A 1P3GA 3LZ1B 3AZJB 3AZND 4KHAB 1WWIA 5GSUA 5CP6A 2F8NG 5AVCB 5DNMA 5GT0C 1P3IC 2FJ7A 3W97B 3NQJB 2Y2GA 3MNNB 1AOIC 4Z5TC 1KX3A 3WA9B 3AZEB 3W99D 4AWLC 2Y2LA 3WKJC 5AV8C 5GT0A 1P3IA 5B1LB 1AOIA 1HQ3C 4Z5TA 5B2ID 1KX4B 3AYWD 4WNNB 1TZYD 3X1TC 3WKJA 5AV8A 3EG5B 5B2JC 3LJAB 5B0ZC 3B0DC 3AV2D 3AZKC 3X1TA 4LD9C 4H9NA 3X1SB 4KGCD 5AV5C 4R8PC 3KXBC 3UTAA 4H9RB 4UUZB 5DNMB 3REKD 1P3PC 2FJ7B 5B2JA 3W96B 5F99D 3TU4D 3AZNC 5B0ZA 5AV9D 4HGAB 3AZKA 4LD9A 2JCHA 3A1KA 5GT3C 3EPHA 5AV5A 4R8PA 3KXBA 4NE5A 1P3IB 2Y2OA 1P3PA 1P3LB 1AOIB 3W99C 4Z5TB 3B6GB 3AZGB 3AZNA 3KFUG 5CPKD 2RIQA 5B24B 5GT3A 5B2IC 3WKJB 5AV8B 3AYWC 1TZYC 3F6TA 3W99A 1HQ3B 1P3KD 2AROD 3B0CW 3VH6T 3A6ND 4H9NB 4WU9B 4DRBA 5B2IA 3AZJD 1Z2CB 5B0YD 3AYWA 3AV2C 1TZYA 5B2JB 3AZLB 4KGCC 5B0ZB 3B0DB 2JE5A 4EO5B 1F66D 3REKC 3WA9D 5F99C 4R8PB 3TU4C 4J8XD 3AV2A 5AV9C 1U35B 3MGQD 4H9QB 5CHLB 3MGRB 4KGCA 2CV5A 5B1LD 5B1MD 3REKA 5F99A 3TU4A 2ZY4A 3EPJA 4H9SC 3C1CD 5CPKC 4ZBJB 4KUDD 3IP4C 3X1UA 1B6WA 5BNXA 1P3KC 2AROC 3W98A 4H9SA 3A6NC 3AZHB 3EPKA 5CPKA 1P3MB 3REJD 3W96D 3AZJC 1P3KA 2AROA 2HUEC 5AVCC 4X23D 2ZY3A 3AV2B 1P3OD 2LY8A 1KX5D 1F66C 1ZLAD 3WA9C 2Y2MA 1P3LD 4UPKA 3AZEC 3AZJA 3B6GD 4J8XC 3AZGD 3REKB 4KHAA 3MGQC 2FFFB 4WU8D 5AVCA 3TU4B 3NQJA 5B1LC 3C1BD 5AV9B 5B1MC 1WWSA 2ZY5A 1F66A 2Y2HA 3WA9A 5BT1D 3AZEA 2YFWA 4J8XA 3MGQA 3C1CC 4G92B 1P3FD 1S32B 5B32G 5B1LA 5B1MA 4KUDC 5E5AD 3O62D 5KDMB 3AZLD 1H3OA 3C1CA 2AROB 2F8ND 3A6NB 3W96C 4KUDA 5B31G 1U35D 4HGAC 2F2AC 1P3BB 4J8UD 3X1SA 3NQUB 5B0YB 4E45A 3MGRD 4X23C 2Y2IA 4H9RA 4UUZA 2HUEB 4Z2MH 1P3OC 1KX5C 1P3LC 3W96A 5BNVA 5AY8B 3B6GC 3AZGC 1F66B 4WU8C 2Y2NA 2YFWB 5B24C 4J8XB 4X23A 1TAFA 3C1BC 3MGQB 1KX5A 3P5JB 3KWQD 1P3LA 5BT1C 3B6GA 5B1MB 3AZGA 3KSYA 2G5IC 5B40B 4WU8A 3AZHD 1P3FC 5B24A 4CAYA 1P3MD 3C1BA 4WU9C 1H3OB 3C1CB 5E5AC 4J8WD 1HQ3A 3O62C 4KUDB 3AZLC 3REIB 1P3FA 4EO5C 4WU9A 1JFIA 2NZDD 4ZUXB 2IO5B 5E5AA 5CPJB 1U35C 3REJB 3O62A 2BG1A 4J8UC 5BNVB 3REHD 3AZLA 3MGRC 3B0CT 4X23B 1TAFB 4YS3D 1P3OB 1M19D 1KX5B 1ZLAB 5B33D 1U35A 4J8UA 4H9QA 1S32D 3MGRA 4ZBJC 4WJ3C 4WU8B 3KWQC 4CAYB 3C1BB 5C3IC 3H0LC 3AZHC 1P3MC 1P3FB 2VQRA 2F8NK 4M6BA 1P3BD 5JA4B 1JFIB 3AZMD 5E5AB 1B67A 3AZHA 3O62B 1P3MA 4NE3A 5AY8D 1BH8A 2F8NB 5DNNB 3REHC 3MGPD 4J8UB 5GXQB 3LZ0D 4YS3C 1M19C 3UT9D 5B33C 5B40D 1Q9CA 4G92C 3REHA 1S32C 5AV9A 4E44A 4YS3A 1M19A 3B6FD 3KWQB 5B33A 3REID 1F1EA 1S32A 5C3IB 1R4VA 3AZFB 4ZUXD 5CPJD 2J8PA 1P3BC 4QLCD 1ID3D 3AZMC 5KDMA 5B0YC 4J8WB 1M1AD 1BH8B 2PYOD 3H0MC 1BFMA 3WAAD 3A6NA 3UTBB 5AY8C 1P3BA 2NZDB 3NQUA 3AZMA 5AV6D 5B0YA 3MGPC 4YM6D 5G49A 3REHB 3LZ0C 5AY8A 3AN2D 1P3GD 3UT9C 5B40C 4YS3B 5GSUD 1M19B 3MGPA 5B33B 4G91C 2XD5A 3B6FC 3UT9A 3REIC 5B40A 5B31D 4JJND 5JRGB 1HTAA 4XUJB 2IO5C 4ZUXC 3MGSD 5CPJC 3REJC 5DNND 3B6FA 1M1AC 3REIA 2PYOC 1P3AD 1P34B 3WAAC 3AZMB 5GXQD 4ZUXA 5G49B 1ZLAC 3RELB 5CPJA 3REJA 3A1IA 5AV6C 2PYOA 2BYKA 3UTAD 3WAAA 3MGPB 1P3OA 1ZLAA 3LZ0B 3V9RA 5AV6A 3AZKD 3UT9B 1EQZD 5AVBD 3AZFD 4G91B 1T3UA 5B31C 4JJNC 2BYMB 4H9PB 3B6FB 5GT3D 3X1VD 3UTBD 3MGSC 5DNNC 1BH9A 5JA4A 4Z66D 3H0RC 5B31A 4JJNA 1P3AC 3AFAB 1ID3B 4QLCB 2UWXA 1N1JB 1M1AB 2PYOB 5GXQC 3MVDD 3WTPD 3B0BA 2BYKB 4WV4B 3MGSA 3WAAB 3VH5W 2F8NA 5DNNA 4Z2MG 2NQBD 4XZQB 1P3AA 3V9RB 4J8VD 3UTAC 2ZM5A 1M18D 5AV6B 1KU5A 5GXQA 4YM6B 5BS7C 3KUYD 3AZID 5B32B 3AV1D 5JRGD 3AN2B 5BO0B 1P3GB 2XD1A 4XUJD 5AVBC 1EQZC 2CV5D 3AZFC 5GSUB 5CP6B 3LELD 3KWQA 5BS7A 4J8WC 1KX3B 2Y2KA 1BH9B 1P34D 1EQZA 4NFTA 5AVBA 2CWEA 5B31B 3X1VC 3WTPE 4JJNB 3UTBC 3AZFA 5GT0B 3RELD 3X1UD 2HIOD 2NZDC 3VH5A 4Z66C 3MGSB 4J8WA 2W8SA 3W98D 4AWLB 4CSRA 1PZRA 3MVDC 3WTPC 3UTBA 3X1VA 1P3AB 2NZDA 4Z66A 2L5AA 2NQBC 2Y2QA 4J8VC 1M18C 5FUGA 5CPID 3X1TB 3MVDA 2Y2PA 3WTPA 3LZ1D 4WZSB 3UTAB 3KUYC 3AZIC 3AV1C 5JRGC 4NE6A 2NQBA 5AVCD 4XUJC 3W97D 2CV5C 3MNND 4J8VA 1M18A 3AZKB 4LD9B 1EQZB 5AVBB 2G5HC 3LELC 5AV5B 3AZED 3KXBB 3KUYA 2YFVA 3AZIA 3AV1A 1P3PB 5JRGA 3AFAD 1P34C 3VH6W 2RVQD 4XUJA 3AZNB 3RELC 1KX4D 3EPLA 4CSRB 3X1UC 2HIOC 5GT3B 3LELA 3X1VB 2Y2JA 4XZQD 3W98C 1P34A 4Z66B 3W99B 5FUGB 3R45A 3RELA 3LJAD 2HIOA 3FDDA 3WTPB 5B32D 2DQNC 3MVDB 3AL0C 5B2IB 3X1SD 3AYWB 1TZYB 5CPIC 5CP6D 2NQBB 5DNMD 2FJ7D 4J8VB 3LZ1C 1M18B 1KX3D 3LZ0A 4H9OA
chains in the Genus database with same CATH topology
2F8NH 3W97C 3KUYB 2YFVB 3VH6A 3MNNC 3AZIB 3AV1B 5CPIA 5GT0D 1P3ID 4KGCB 2CV5B 1ULYA 3LZ1A 1AOID 4Z5TD 2BYMA 4H9PA 3AFAC 3LELB 4QLCC 5F99B 2RVQC 1ID3C 5B24D 2ZY2A 3W97A 3MNNA 3WKJD 5AV8D 1KX4C 1HQ3D 4XZQC 3R45B 3X1UB 2HIOB 3AFAA 4QLCA 1ID3A 5BNXB 1N1JA 1M1AA 3X1TD 4DQYB 4YM6C 3W98B 4WU9D 5CPKB 1KX4A 2JSSA 3LJAC 4WNNA 5B32C 3AN2C 5B2JD 1P3GC 4XZQA 3X1SC 5B0ZD 4H9OB 5GSUC 5CP6C 1P3KB 1W2EA 2DF4C 5DNMC 4YM6A 2FJ7C 4LD9D 4DRAA 1A7WA 5AV5D 4R8PD 3KXBD 5CPIB 3LJAA 1KX3C 5B32A 1P3PD 3VH5T 3AN2A 5BO0A 1P3GA 3LZ1B 3AZJB 3AZND 4KHAB 1WWIA 5GSUA 5CP6A 2F8NG 5AVCB 5DNMA 5GT0C 1P3IC 2FJ7A 3W97B 3NQJB 2Y2GA 3MNNB 1AOIC 4Z5TC 1KX3A 3WA9B 3AZEB 3W99D 4AWLC 2Y2LA 3WKJC 5AV8C 5GT0A 1P3IA 5B1LB 1AOIA 1HQ3C 4Z5TA 5B2ID 1KX4B 3AYWD 4WNNB 1TZYD 3X1TC 3WKJA 5AV8A 3EG5B 5B2JC 3LJAB 5B0ZC 3B0DC 3AV2D 3AZKC 3X1TA 4LD9C 4H9NA 3X1SB 4KGCD 5AV5C 4R8PC 3KXBC 3UTAA 4H9RB 4UUZB 5DNMB 3REKD 1P3PC 2FJ7B 5B2JA 3W96B 5F99D 3TU4D 3AZNC 5B0ZA 5AV9D 4HGAB 3AZKA 4LD9A 2JCHA 3A1KA 5GT3C 3EPHA 5AV5A 4R8PA 3KXBA 4NE5A 1P3IB 2Y2OA 1P3PA 1P3LB 1AOIB 3W99C 4Z5TB 3B6GB 3AZGB 3AZNA 3KFUG 5CPKD 2RIQA 5B24B 5GT3A 5B2IC 3WKJB 5AV8B 3AYWC 1TZYC 3F6TA 3W99A 1HQ3B 1P3KD 2AROD 3B0CW 3VH6T 3A6ND 4H9NB 4WU9B 4DRBA 5B2IA 3AZJD 1Z2CB 5B0YD 3AYWA 3AV2C 1TZYA 5B2JB 3AZLB 4KGCC 5B0ZB 3B0DB 2JE5A 4EO5B 1F66D 3REKC 3WA9D 5F99C 4R8PB 3TU4C 4J8XD 3AV2A 5AV9C 1U35B 3MGQD 4H9QB 5CHLB 3MGRB 4KGCA 2CV5A 5B1LD 5B1MD 3REKA 5F99A 3TU4A 2ZY4A 3EPJA 4H9SC 3C1CD 5CPKC 4ZBJB 4KUDD 3IP4C 3X1UA 1B6WA 5BNXA 1P3KC 2AROC 3W98A 4H9SA 3A6NC 3AZHB 3EPKA 5CPKA 1P3MB 3REJD 3W96D 3AZJC 1P3KA 2AROA 2HUEC 5AVCC 4X23D 2ZY3A 3AV2B 1P3OD 2LY8A 1KX5D 1F66C 1ZLAD 3WA9C 2Y2MA 1P3LD 4UPKA 3AZEC 3AZJA 3B6GD 4J8XC 3AZGD 3REKB 4KHAA 3MGQC 2FFFB 4WU8D 5AVCA 3TU4B 3NQJA 5B1LC 3C1BD 5AV9B 5B1MC 1WWSA 2ZY5A 1F66A 2Y2HA 3WA9A 5BT1D 3AZEA 2YFWA 4J8XA 3MGQA 3C1CC 4G92B 1P3FD 1S32B 5B32G 5B1LA 5B1MA 4KUDC 5E5AD 3O62D 5KDMB 3AZLD 1H3OA 3C1CA 2AROB 2F8ND 3A6NB 3W96C 4KUDA 5B31G 1U35D 4HGAC 2F2AC 1P3BB 4J8UD 3X1SA 3NQUB 5B0YB 4E45A 3MGRD 4X23C 2Y2IA 4H9RA 4UUZA 2HUEB 4Z2MH 1P3OC 1KX5C 1P3LC 3W96A 5BNVA 5AY8B 3B6GC 3AZGC 1F66B 4WU8C 2Y2NA 2YFWB 5B24C 4J8XB 4X23A 1TAFA 3C1BC 3MGQB 1KX5A 3P5JB 3KWQD 1P3LA 5BT1C 3B6GA 5B1MB 3AZGA 3KSYA 2G5IC 5B40B 4WU8A 3AZHD 1P3FC 5B24A 4CAYA 1P3MD 3C1BA 4WU9C 1H3OB 3C1CB 5E5AC 4J8WD 1HQ3A 3O62C 4KUDB 3AZLC 3REIB 1P3FA 4EO5C 4WU9A 1JFIA 2NZDD 4ZUXB 2IO5B 5E5AA 5CPJB 1U35C 3REJB 3O62A 2BG1A 4J8UC 5BNVB 3REHD 3AZLA 3MGRC 3B0CT 4X23B 1TAFB 4YS3D 1P3OB 1M19D 1KX5B 1ZLAB 5B33D 1U35A 4J8UA 4H9QA 1S32D 3MGRA 4ZBJC 4WJ3C 4WU8B 3KWQC 4CAYB 3C1BB 5C3IC 3H0LC 3AZHC 1P3MC 1P3FB 2VQRA 2F8NK 4M6BA 1P3BD 5JA4B 1JFIB 3AZMD 5E5AB 1B67A 3AZHA 3O62B 1P3MA 4NE3A 5AY8D 1BH8A 2F8NB 5DNNB 3REHC 3MGPD 4J8UB 5GXQB 3LZ0D 4YS3C 1M19C 3UT9D 5B33C 5B40D 1Q9CA 4G92C 3REHA 1S32C 5AV9A 4E44A 4YS3A 1M19A 3B6FD 3KWQB 5B33A 3REID 1F1EA 1S32A 5C3IB 1R4VA 3AZFB 4ZUXD 5CPJD 2J8PA 1P3BC 4QLCD 1ID3D 3AZMC 5KDMA 5B0YC 4J8WB 1M1AD 1BH8B 2PYOD 3H0MC 1BFMA 3WAAD 3A6NA 3UTBB 5AY8C 1P3BA 2NZDB 3NQUA 3AZMA 5AV6D 5B0YA 3MGPC 4YM6D 5G49A 3REHB 3LZ0C 5AY8A 3AN2D 1P3GD 3UT9C 5B40C 4YS3B 5GSUD 1M19B 3MGPA 5B33B 4G91C 2XD5A 3B6FC 3UT9A 3REIC 5B40A 5B31D 4JJND 5JRGB 1HTAA 4XUJB 2IO5C 4ZUXC 3MGSD 5CPJC 3REJC 5DNND 3B6FA 1M1AC 3REIA 2PYOC 1P3AD 1P34B 3WAAC 3AZMB 5GXQD 4ZUXA 5G49B 1ZLAC 3RELB 5CPJA 3REJA 3A1IA 5AV6C 2PYOA 2BYKA 3UTAD 3WAAA 3MGPB 1P3OA 1ZLAA 3LZ0B 3V9RA 5AV6A 3AZKD 3UT9B 1EQZD 5AVBD 3AZFD 4G91B 1T3UA 5B31C 4JJNC 2BYMB 4H9PB 3B6FB 5GT3D 3X1VD 3UTBD 3MGSC 5DNNC 1BH9A 5JA4A 4Z66D 3H0RC 5B31A 4JJNA 1P3AC 3AFAB 1ID3B 4QLCB 2UWXA 1N1JB 1M1AB 2PYOB 5GXQC 3MVDD 3WTPD 3B0BA 2BYKB 4WV4B 3MGSA 3WAAB 3VH5W 2F8NA 5DNNA 4Z2MG 2NQBD 4XZQB 1P3AA 3V9RB 4J8VD 3UTAC 2ZM5A 1M18D 5AV6B 1KU5A 5GXQA 4YM6B 5BS7C 3KUYD 3AZID 5B32B 3AV1D 5JRGD 3AN2B 5BO0B 1P3GB 2XD1A 4XUJD 5AVBC 1EQZC 2CV5D 3AZFC 5GSUB 5CP6B 3LELD 3KWQA 5BS7A 4J8WC 1KX3B 2Y2KA 1BH9B 1P34D 1EQZA 4NFTA 5AVBA 2CWEA 5B31B 3X1VC 3WTPE 4JJNB 3UTBC 3AZFA 5GT0B 3RELD 3X1UD 2HIOD 2NZDC 3VH5A 4Z66C 3MGSB 4J8WA 2W8SA 3W98D 4AWLB 4CSRA 1PZRA 3MVDC 3WTPC 3UTBA 3X1VA 1P3AB 2NZDA 4Z66A 2L5AA 2NQBC 2Y2QA 4J8VC 1M18C 5FUGA 5CPID 3X1TB 3MVDA 2Y2PA 3WTPA 3LZ1D 4WZSB 3UTAB 3KUYC 3AZIC 3AV1C 5JRGC 4NE6A 2NQBA 5AVCD 4XUJC 3W97D 2CV5C 3MNND 4J8VA 1M18A 3AZKB 4LD9B 1EQZB 5AVBB 2G5HC 3LELC 5AV5B 3AZED 3KXBB 3KUYA 2YFVA 3AZIA 3AV1A 1P3PB 5JRGA 3AFAD 1P34C 3VH6W 2RVQD 4XUJA 3AZNB 3RELC 1KX4D 3EPLA 4CSRB 3X1UC 2HIOC 5GT3B 3LELA 3X1VB 2Y2JA 4XZQD 3W98C 1P34A 4Z66B 3W99B 5FUGB 3R45A 3RELA 3LJAD 2HIOA 3FDDA 3WTPB 5B32D 2DQNC 3MVDB 3AL0C 5B2IB 3X1SD 3AYWB 1TZYB 5CPIC 5CP6D 2NQBB 5DNMD 2FJ7D 4J8VB 3LZ1C 1M18B 1KX3D 3LZ0A 4H9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N H;  3W97 C;  3KUY B;  2YFV B;  3VH6 A;  3MNN C;  3AZI B;  3AV1 B;  5CPI A;  5GT0 D;  1P3I D;  4KGC B;  2CV5 B;  1ULY A;  3LZ1 A;  1AOI D;  4Z5T D;  2BYM A;  4H9P A;  3AFA C;  3LEL B;  4QLC C;  5F99 B;  2RVQ C;  1ID3 C;  5B24 D;  3W97 A;  3MNN A;  3WKJ D;  5AV8 D;  1KX4 C;  1HQ3 D;  4XZQ C;  3R45 B;  3X1U B;  2HIO B;  3AFA A;  4QLC A;  1ID3 A;  5BNX B;  1N1J A;  1M1A A;  3X1T D;  4YM6 C;  3W98 B;  4WU9 D;  5CPK B;  1KX4 A;  2JSS A;  3LJA C;  4WNN A;  5B32 C;  3AN2 C;  5B2J D;  1P3G C;  4XZQ A;  3X1S C;  5B0Z D;  4H9O B;  5GSU C;  5CP6 C;  1P3K B;  5DNM C;  4LD9 D;  4YM6 A;  2FJ7 C;  4DRA A;  1A7W A;  5AV5 D;  4R8P D;  3KXB D;  5CPI B;  3LJA A;  1KX3 C;  5B32 A;  1P3P D;  3VH5 T;  3AN2 A;  5BO0 A;  1P3G A;  3LZ1 B;  3AZJ B;  3AZN D;  4KHA B;  1WWI A;  5GSU A;  5CP6 A;  2F8N G;  5AVC B;  5DNM A;  5GT0 C;  1P3I C;  2FJ7 A;  3W97 B;  3NQJ B;  3MNN B;  1AOI C;  4Z5T C;  1KX3 A;  3WA9 B;  3AZE B;  3W99 D;  4AWL C;  3WKJ C;  5AV8 C;  5GT0 A;  1P3I A;  5B1L B;  1AOI A;  1HQ3 C;  4Z5T A;  5B2I D;  1KX4 B;  3AYW D;  4WNN B;  1TZY D;  3X1T C;  3WKJ A;  5AV8 A;  5B2J C;  3LJA B;  5B0Z C;  3B0D C;  3AV2 D;  3AZK C;  3X1T A;  4LD9 C;  4H9N A;  3X1S B;  4KGC D;  5AV5 C;  4R8P C;  3KXB C;  3UTA A;  4H9R B;  4UUZ B;  5DNM B;  3REK D;  1P3P C;  2FJ7 B;  5B2J A;  3W96 B;  5F99 D;  3TU4 D;  3AZN C;  5B0Z A;  5AV9 D;  4HGA B;  3AZK A;  4LD9 A;  5GT3 C;  5AV5 A;  4R8P A;  3KXB A;  4NE5 A;  1P3I B;  1P3P A;  1P3L B;  1AOI B;  3W99 C;  4Z5T B;  3B6G B;  3AZG B;  3AZN A;  5CPK D;  5B24 B;  5GT3 A;  5B2I C;  3WKJ B;  5AV8 B;  3AYW C;  1TZY C;  3W99 A;  1HQ3 B;  1P3K D;  2ARO D;  3B0C W;  3VH6 T;  3A6N D;  4H9N B;  4WU9 B;  4DRB A;  5B2I A;  3AZJ D;  5B0Y D;  3AYW A;  3AV2 C;  1TZY A;  5B2J B;  3AZL B;  4KGC C;  5B0Z B;  3B0D B;  4EO5 B;  1F66 D;  3REK C;  3WA9 D;  5F99 C;  4R8P B;  3TU4 C;  4J8X D;  3AV2 A;  5AV9 C;  1U35 B;  3MGQ D;  4H9Q B;  5CHL B;  3MGR B;  4KGC A;  2CV5 A;  5B1L D;  5B1M D;  3REK A;  5F99 A;  3TU4 A;  4H9S C;  3C1C D;  5CPK C;  4ZBJ B;  4KUD D;  3X1U A;  1B6W A;  5BNX A;  1P3K C;  2ARO C;  3W98 A;  4H9S A;  3A6N C;  3AZH B;  5CPK A;  1P3M B;  3REJ D;  3W96 D;  3AZJ C;  1P3K A;  2ARO A;  2HUE C;  5AVC C;  4X23 D;  3AV2 B;  1P3O D;  2LY8 A;  1KX5 D;  1F66 C;  1ZLA D;  3WA9 C;  1P3L D;  3AZE C;  3AZJ A;  3B6G D;  4J8X C;  3AZG D;  3REK B;  4KHA A;  3MGQ C;  4WU8 D;  5AVC A;  3TU4 B;  3NQJ A;  5B1L C;  3C1B D;  5AV9 B;  5B1M C;  1WWS A;  1F66 A;  3WA9 A;  5BT1 D;  3AZE A;  2YFW A;  4J8X A;  3MGQ A;  3C1C C;  4G92 B;  1P3F D;  1S32 B;  5B32 G;  5B1L A;  5B1M A;  4KUD C;  5E5A D;  3O62 D;  5KDM B;  3AZL D;  1H3O A;  3C1C A;  2ARO B;  2F8N D;  3A6N B;  3W96 C;  4KUD A;  5B31 G;  1U35 D;  4HGA C;  1P3B B;  4J8U D;  3X1S A;  3NQU B;  5B0Y B;  4E45 A;  3MGR D;  4X23 C;  1P3O C;  4H9R A;  4UUZ A;  2HUE B;  4Z2M H;  1KX5 C;  1P3L C;  3W96 A;  5BNV A;  5AY8 B;  3B6G C;  3AZG C;  1F66 B;  4WU8 C;  2YFW B;  5B24 C;  4J8X B;  4X23 A;  1TAF A;  3C1B C;  3MGQ B;  1KX5 A;  3KWQ D;  1P3L A;  5BT1 C;  3B6G A;  5B1M B;  3AZG A;  3KSY A;  5B40 B;  3AZH D;  4WU8 A;  1P3F C;  5B24 A;  4CAY A;  1P3M D;  3C1B A;  4WU9 C;  1H3O B;  3C1C B;  5E5A C;  4J8W D;  1HQ3 A;  3O62 C;  4KUD B;  3AZL C;  3REI B;  1P3F A;  4EO5 C;  4WU9 A;  1JFI A;  2NZD D;  2IO5 B;  5E5A A;  4ZUX B;  5CPJ B;  1U35 C;  3REJ B;  3O62 A;  4J8U C;  5BNV B;  3REH D;  3AZL A;  3MGR C;  3B0C T;  4X23 B;  1TAF B;  4YS3 D;  1P3O B;  1M19 D;  1KX5 B;  1ZLA B;  5B33 D;  1U35 A;  4J8U A;  4H9Q A;  1S32 D;  3MGR A;  4ZBJ C;  4WU8 B;  3KWQ C;  4CAY B;  3C1B B;  5C3I C;  3AZH C;  1P3M C;  1P3F B;  2F8N K;  4M6B A;  1P3B D;  5JA4 B;  1JFI B;  3AZM D;  5E5A B;  1B67 A;  3AZH A;  3O62 B;  1P3M A;  4NE3 A;  5AY8 D;  1BH8 A;  2F8N B;  5DNN B;  3REH C;  3MGP D;  4J8U B;  5GXQ B;  3LZ0 D;  4YS3 C;  1M19 C;  3UT9 D;  5B33 C;  5B40 D;  1Q9C A;  4G92 C;  3REH A;  1S32 C;  5AV9 A;  4E44 A;  4YS3 A;  1M19 A;  3B6F D;  3KWQ B;  5B33 A;  3REI D;  1F1E A;  1S32 A;  5C3I B;  1R4V A;  3AZF B;  4ZUX D;  5CPJ D;  1P3B C;  1ID3 D;  4QLC D;  3AZM C;  5KDM A;  5B0Y C;  4J8W B;  1M1A D;  1BH8 B;  2PYO D;  1BFM A;  3WAA D;  3A6N A;  3UTB B;  5AY8 C;  1P3B A;  2NZD B;  3NQU A;  3AZM A;  5AV6 D;  5B0Y A;  3MGP C;  4YM6 D;  5G49 A;  3REH B;  3LZ0 C;  5AY8 A;  3AN2 D;  1P3G D;  3UT9 C;  5B40 C;  4YS3 B;  5GSU D;  1M19 B;  3MGP A;  5B33 B;  4G91 C;  3B6F C;  3UT9 A;  3REI C;  5B40 A;  5B31 D;  4JJN D;  5JRG B;  1HTA A;  4XUJ B;  2IO5 C;  4ZUX C;  3MGS D;  5CPJ C;  3REJ C;  5DNN D;  3B6F A;  1M1A C;  3REI A;  2PYO C;  1P3A D;  1P34 B;  3WAA C;  3AZM B;  5GXQ D;  4ZUX A;  5G49 B;  1ZLA C;  3REL B;  5CPJ A;  3REJ A;  5AV6 C;  2PYO A;  2BYK A;  3UTA D;  3WAA A;  3MGP B;  1P3O A;  1ZLA A;  3LZ0 B;  3V9R A;  5AV6 A;  3AZK D;  3UT9 B;  1EQZ D;  5AVB D;  3AZF D;  4G91 B;  5B31 C;  4JJN C;  2BYM B;  4H9P B;  3B6F B;  5GT3 D;  3X1V D;  3UTB D;  3MGS C;  5DNN C;  1BH9 A;  5JA4 A;  4Z66 D;  5B31 A;  4JJN A;  1P3A C;  3AFA B;  1ID3 B;  4QLC B;  1N1J B;  1M1A B;  2PYO B;  5GXQ C;  3MVD D;  3WTP D;  3B0B A;  2BYK B;  4WV4 B;  3MGS A;  3WAA B;  3VH5 W;  2F8N A;  5DNN A;  4Z2M G;  2NQB D;  4XZQ B;  1P3A A;  3V9R B;  4J8V D;  3UTA C;  1M18 D;  5AV6 B;  1KU5 A;  5GXQ A;  4YM6 B;  5BS7 C;  3KUY D;  3AZI D;  5B32 B;  3AV1 D;  5JRG D;  3AN2 B;  5BO0 B;  1P3G B;  1EQZ C;  4XUJ D;  5AVB C;  2CV5 D;  3AZF C;  5GSU B;  5CP6 B;  3LEL D;  3KWQ A;  5BS7 A;  4J8W C;  1KX3 B;  1BH9 B;  1P34 D;  1EQZ A;  4NFT A;  5AVB A;  2CWE A;  5B31 B;  3X1V C;  3WTP E;  4JJN B;  3UTB C;  3AZF A;  5GT0 B;  3REL D;  3X1U D;  2HIO D;  2NZD C;  3VH5 A;  4Z66 C;  3MGS B;  4J8W A;  3W98 D;  4AWL B;  4CSR A;  3MVD C;  3WTP C;  3UTB A;  3X1V A;  1P3A B;  2NZD A;  4Z66 A;  2L5A A;  2NQB C;  4J8V C;  1M18 C;  5FUG A;  5CPI D;  3X1T B;  3MVD A;  3WTP A;  3LZ1 D;  4WZS B;  3UTA B;  3KUY C;  3AZI C;  3AV1 C;  5JRG C;  4NE6 A;  2NQB A;  5AVC D;  4XUJ C;  3W97 D;  2CV5 C;  3MNN D;  4J8V A;  1M18 A;  3AZK B;  4LD9 B;  1EQZ B;  5AVB B;  3LEL C;  5AV5 B;  3AZE D;  3KXB B;  3KUY A;  2YFV A;  3AZI A;  3AV1 A;  1P3P B;  5JRG A;  3AFA D;  1P34 C;  3VH6 W;  2RVQ D;  4XUJ A;  3AZN B;  3REL C;  1KX4 D;  4CSR B;  3X1U C;  2HIO C;  5GT3 B;  3LEL A;  3X1V B;  4XZQ D;  3W98 C;  1P34 A;  4Z66 B;  3W99 B;  5FUG B;  3R45 A;  3REL A;  3LJA D;  2HIO A;  3MVD B;  3WTP B;  5B32 D;  5B2I B;  3X1S D;  3AYW B;  1TZY B;  5CPI C;  5CP6 D;  2NQB B;  5DNM D;  2FJ7 D;  4J8V B;  3LZ1 C;  1M18 B;  1KX3 D;  3LZ0 A;  4H9O A; 
#chains in the Genus database with same CATH topology
 2F8N H;  3W97 C;  3KUY B;  2YFV B;  3VH6 A;  3MNN C;  3AZI B;  3AV1 B;  5CPI A;  5GT0 D;  1P3I D;  4KGC B;  2CV5 B;  1ULY A;  3LZ1 A;  1AOI D;  4Z5T D;  2BYM A;  4H9P A;  3AFA C;  3LEL B;  4QLC C;  5F99 B;  2RVQ C;  1ID3 C;  5B24 D;  2ZY2 A;  3W97 A;  3MNN A;  3WKJ D;  5AV8 D;  1KX4 C;  1HQ3 D;  4XZQ C;  3R45 B;  3X1U B;  2HIO B;  3AFA A;  4QLC A;  1ID3 A;  5BNX B;  1N1J A;  1M1A A;  3X1T D;  4DQY B;  4YM6 C;  3W98 B;  4WU9 D;  5CPK B;  1KX4 A;  2JSS A;  3LJA C;  4WNN A;  5B32 C;  3AN2 C;  5B2J D;  1P3G C;  4XZQ A;  3X1S C;  5B0Z D;  4H9O B;  5GSU C;  5CP6 C;  1P3K B;  1W2E A;  2DF4 C;  5DNM C;  4YM6 A;  2FJ7 C;  4LD9 D;  4DRA A;  1A7W A;  5AV5 D;  4R8P D;  3KXB D;  5CPI B;  3LJA A;  1KX3 C;  5B32 A;  1P3P D;  3VH5 T;  3AN2 A;  5BO0 A;  1P3G A;  3LZ1 B;  3AZJ B;  3AZN D;  4KHA B;  1WWI A;  5GSU A;  5CP6 A;  2F8N G;  5AVC B;  5DNM A;  5GT0 C;  1P3I C;  2FJ7 A;  3W97 B;  3NQJ B;  2Y2G A;  3MNN B;  1AOI C;  4Z5T C;  1KX3 A;  3WA9 B;  3AZE B;  3W99 D;  4AWL C;  2Y2L A;  3WKJ C;  5AV8 C;  5GT0 A;  1P3I A;  5B1L B;  1AOI A;  1HQ3 C;  4Z5T A;  5B2I D;  1KX4 B;  3AYW D;  4WNN B;  1TZY D;  3X1T C;  3WKJ A;  5AV8 A;  3EG5 B;  5B2J C;  3LJA B;  5B0Z C;  3B0D C;  3AV2 D;  3AZK C;  3X1T A;  4LD9 C;  4H9N A;  3X1S B;  4KGC D;  5AV5 C;  4R8P C;  3KXB C;  3UTA A;  4H9R B;  4UUZ B;  5DNM B;  3REK D;  1P3P C;  2FJ7 B;  5B2J A;  3W96 B;  5F99 D;  3TU4 D;  3AZN C;  5B0Z A;  5AV9 D;  4HGA B;  3AZK A;  4LD9 A;  2JCH A;  3A1K A;  5GT3 C;  3EPH A;  5AV5 A;  4R8P A;  3KXB A;  4NE5 A;  1P3I B;  2Y2O A;  1P3P A;  1P3L B;  1AOI B;  3W99 C;  4Z5T B;  3B6G B;  3AZG B;  3AZN A;  3KFU G;  5CPK D;  2RIQ A;  5B24 B;  5GT3 A;  5B2I C;  3WKJ B;  5AV8 B;  3AYW C;  1TZY C;  3F6T A;  3W99 A;  1HQ3 B;  1P3K D;  2ARO D;  3B0C W;  3VH6 T;  3A6N D;  4H9N B;  4WU9 B;  4DRB A;  5B2I A;  3AZJ D;  1Z2C B;  5B0Y D;  3AYW A;  3AV2 C;  1TZY A;  5B2J B;  3AZL B;  4KGC C;  5B0Z B;  3B0D B;  2JE5 A;  4EO5 B;  1F66 D;  3REK C;  3WA9 D;  5F99 C;  4R8P B;  3TU4 C;  4J8X D;  3AV2 A;  5AV9 C;  1U35 B;  3MGQ D;  4H9Q B;  5CHL B;  3MGR B;  4KGC A;  2CV5 A;  5B1L D;  5B1M D;  3REK A;  5F99 A;  3TU4 A;  2ZY4 A;  3EPJ A;  4H9S C;  3C1C D;  5CPK C;  4ZBJ B;  4KUD D;  3IP4 C;  3X1U A;  1B6W A;  5BNX A;  1P3K C;  2ARO C;  3W98 A;  4H9S A;  3A6N C;  3AZH B;  3EPK A;  5CPK A;  1P3M B;  3REJ D;  3W96 D;  3AZJ C;  1P3K A;  2ARO A;  2HUE C;  5AVC C;  4X23 D;  2ZY3 A;  3AV2 B;  1P3O D;  2LY8 A;  1KX5 D;  1F66 C;  1ZLA D;  3WA9 C;  2Y2M A;  1P3L D;  4UPK A;  3AZE C;  3AZJ A;  3B6G D;  4J8X C;  3AZG D;  3REK B;  4KHA A;  3MGQ C;  2FFF B;  4WU8 D;  5AVC A;  3TU4 B;  3NQJ A;  5B1L C;  3C1B D;  5AV9 B;  5B1M C;  1WWS A;  2ZY5 A;  1F66 A;  2Y2H A;  3WA9 A;  5BT1 D;  3AZE A;  2YFW A;  4J8X A;  3MGQ A;  3C1C C;  4G92 B;  1P3F D;  1S32 B;  5B32 G;  5B1L A;  5B1M A;  4KUD C;  5E5A D;  3O62 D;  5KDM B;  3AZL D;  1H3O A;  3C1C A;  2ARO B;  2F8N D;  3A6N B;  3W96 C;  4KUD A;  5B31 G;  1U35 D;  4HGA C;  2F2A C;  1P3B B;  4J8U D;  3X1S A;  3NQU B;  5B0Y B;  4E45 A;  3MGR D;  4X23 C;  2Y2I A;  4H9R A;  4UUZ A;  2HUE B;  4Z2M H;  1P3O C;  1KX5 C;  1P3L C;  3W96 A;  5BNV A;  5AY8 B;  3B6G C;  3AZG C;  1F66 B;  4WU8 C;  2Y2N A;  2YFW B;  5B24 C;  4J8X B;  4X23 A;  1TAF A;  3C1B C;  3MGQ B;  1KX5 A;  3P5J B;  3KWQ D;  1P3L A;  5BT1 C;  3B6G A;  5B1M B;  3AZG A;  3KSY A;  2G5I C;  5B40 B;  4WU8 A;  3AZH D;  1P3F C;  5B24 A;  4CAY A;  1P3M D;  3C1B A;  4WU9 C;  1H3O B;  3C1C B;  5E5A C;  4J8W D;  1HQ3 A;  3O62 C;  4KUD B;  3AZL C;  3REI B;  1P3F A;  4EO5 C;  4WU9 A;  1JFI A;  2NZD D;  4ZUX B;  2IO5 B;  5E5A A;  5CPJ B;  1U35 C;  3REJ B;  3O62 A;  2BG1 A;  4J8U C;  5BNV B;  3REH D;  3AZL A;  3MGR C;  3B0C T;  4X23 B;  1TAF B;  4YS3 D;  1P3O B;  1M19 D;  1KX5 B;  1ZLA B;  5B33 D;  1U35 A;  4J8U A;  4H9Q A;  1S32 D;  3MGR A;  4ZBJ C;  4WJ3 C;  4WU8 B;  3KWQ C;  4CAY B;  3C1B B;  5C3I C;  3H0L C;  3AZH C;  1P3M C;  1P3F B;  2VQR A;  2F8N K;  4M6B A;  1P3B D;  5JA4 B;  1JFI B;  3AZM D;  5E5A B;  1B67 A;  3AZH A;  3O62 B;  1P3M A;  4NE3 A;  5AY8 D;  1BH8 A;  2F8N B;  5DNN B;  3REH C;  3MGP D;  4J8U B;  5GXQ B;  3LZ0 D;  4YS3 C;  1M19 C;  3UT9 D;  5B33 C;  5B40 D;  1Q9C A;  4G92 C;  3REH A;  1S32 C;  5AV9 A;  4E44 A;  4YS3 A;  1M19 A;  3B6F D;  3KWQ B;  5B33 A;  3REI D;  1F1E A;  1S32 A;  5C3I B;  1R4V A;  3AZF B;  4ZUX D;  5CPJ D;  2J8P A;  1P3B C;  4QLC D;  1ID3 D;  3AZM C;  5KDM A;  5B0Y C;  4J8W B;  1M1A D;  1BH8 B;  2PYO D;  3H0M C;  1BFM A;  3WAA D;  3A6N A;  3UTB B;  5AY8 C;  1P3B A;  2NZD B;  3NQU A;  3AZM A;  5AV6 D;  5B0Y A;  3MGP C;  4YM6 D;  5G49 A;  3REH B;  3LZ0 C;  5AY8 A;  3AN2 D;  1P3G D;  3UT9 C;  5B40 C;  4YS3 B;  5GSU D;  1M19 B;  3MGP A;  5B33 B;  4G91 C;  2XD5 A;  3B6F C;  3UT9 A;  3REI C;  5B40 A;  5B31 D;  4JJN D;  5JRG B;  1HTA A;  4XUJ B;  2IO5 C;  4ZUX C;  3MGS D;  5CPJ C;  3REJ C;  5DNN D;  3B6F A;  1M1A C;  3REI A;  2PYO C;  1P3A D;  1P34 B;  3WAA C;  3AZM B;  5GXQ D;  4ZUX A;  5G49 B;  1ZLA C;  3REL B;  5CPJ A;  3REJ A;  3A1I A;  5AV6 C;  2PYO A;  2BYK A;  3UTA D;  3WAA A;  3MGP B;  1P3O A;  1ZLA A;  3LZ0 B;  3V9R A;  5AV6 A;  3AZK D;  3UT9 B;  1EQZ D;  5AVB D;  3AZF D;  4G91 B;  1T3U A;  5B31 C;  4JJN C;  2BYM B;  4H9P B;  3B6F B;  5GT3 D;  3X1V D;  3UTB D;  3MGS C;  5DNN C;  1BH9 A;  5JA4 A;  4Z66 D;  3H0R C;  5B31 A;  4JJN A;  1P3A C;  3AFA B;  1ID3 B;  4QLC B;  2UWX A;  1N1J B;  1M1A B;  2PYO B;  5GXQ C;  3MVD D;  3WTP D;  3B0B A;  2BYK B;  4WV4 B;  3MGS A;  3WAA B;  3VH5 W;  2F8N A;  5DNN A;  4Z2M G;  2NQB D;  4XZQ B;  1P3A A;  3V9R B;  4J8V D;  3UTA C;  2ZM5 A;  1M18 D;  5AV6 B;  1KU5 A;  5GXQ A;  4YM6 B;  5BS7 C;  3KUY D;  3AZI D;  5B32 B;  3AV1 D;  5JRG D;  3AN2 B;  5BO0 B;  1P3G B;  2XD1 A;  4XUJ D;  5AVB C;  1EQZ C;  2CV5 D;  3AZF C;  5GSU B;  5CP6 B;  3LEL D;  3KWQ A;  5BS7 A;  4J8W C;  1KX3 B;  2Y2K A;  1BH9 B;  1P34 D;  1EQZ A;  4NFT A;  5AVB A;  2CWE A;  5B31 B;  3X1V C;  3WTP E;  4JJN B;  3UTB C;  3AZF A;  5GT0 B;  3REL D;  3X1U D;  2HIO D;  2NZD C;  3VH5 A;  4Z66 C;  3MGS B;  4J8W A;  2W8S A;  3W98 D;  4AWL B;  4CSR A;  1PZR A;  3MVD C;  3WTP C;  3UTB A;  3X1V A;  1P3A B;  2NZD A;  4Z66 A;  2L5A A;  2NQB C;  2Y2Q A;  4J8V C;  1M18 C;  5FUG A;  5CPI D;  3X1T B;  3MVD A;  2Y2P A;  3WTP A;  3LZ1 D;  4WZS B;  3UTA B;  3KUY C;  3AZI C;  3AV1 C;  5JRG C;  4NE6 A;  2NQB A;  5AVC D;  4XUJ C;  3W97 D;  2CV5 C;  3MNN D;  4J8V A;  1M18 A;  3AZK B;  4LD9 B;  1EQZ B;  5AVB B;  2G5H C;  3LEL C;  5AV5 B;  3AZE D;  3KXB B;  3KUY A;  2YFV A;  3AZI A;  3AV1 A;  1P3P B;  5JRG A;  3AFA D;  1P34 C;  3VH6 W;  2RVQ D;  4XUJ A;  3AZN B;  3REL C;  1KX4 D;  3EPL A;  4CSR B;  3X1U C;  2HIO C;  5GT3 B;  3LEL A;  3X1V B;  2Y2J A;  4XZQ D;  3W98 C;  1P34 A;  4Z66 B;  3W99 B;  5FUG B;  3R45 A;  3REL A;  3LJA D;  2HIO A;  3FDD A;  3WTP B;  5B32 D;  2DQN C;  3MVD B;  3AL0 C;  5B2I B;  3X1S D;  3AYW B;  1TZY B;  5CPI C;  5CP6 D;  2NQB B;  5DNM D;  2FJ7 D;  4J8V B;  3LZ1 C;  1M18 B;  1KX3 D;  3LZ0 A;  4H9O A; 
#chains in the Genus database with same CATH homology
 2F8N H;  3W97 C;  3KUY B;  2YFV B;  3VH6 A;  3MNN C;  3AZI B;  3AV1 B;  5CPI A;  5GT0 D;  1P3I D;  4KGC B;  2CV5 B;  1ULY A;  3LZ1 A;  1AOI D;  4Z5T D;  2BYM A;  4H9P A;  3AFA C;  3LEL B;  4QLC C;  5F99 B;  2RVQ C;  1ID3 C;  5B24 D;  2ZY2 A;  3W97 A;  3MNN A;  3WKJ D;  5AV8 D;  1KX4 C;  1HQ3 D;  4XZQ C;  3R45 B;  3X1U B;  2HIO B;  3AFA A;  4QLC A;  1ID3 A;  5BNX B;  1N1J A;  1M1A A;  3X1T D;  4DQY B;  4YM6 C;  3W98 B;  4WU9 D;  5CPK B;  1KX4 A;  2JSS A;  3LJA C;  4WNN A;  5B32 C;  3AN2 C;  5B2J D;  1P3G C;  4XZQ A;  3X1S C;  5B0Z D;  4H9O B;  5GSU C;  5CP6 C;  1P3K B;  1W2E A;  2DF4 C;  5DNM C;  4YM6 A;  2FJ7 C;  4LD9 D;  4DRA A;  1A7W A;  5AV5 D;  4R8P D;  3KXB D;  5CPI B;  3LJA A;  1KX3 C;  5B32 A;  1P3P D;  3VH5 T;  3AN2 A;  5BO0 A;  1P3G A;  3LZ1 B;  3AZJ B;  3AZN D;  4KHA B;  1WWI A;  5GSU A;  5CP6 A;  2F8N G;  5AVC B;  5DNM A;  5GT0 C;  1P3I C;  2FJ7 A;  3W97 B;  3NQJ B;  2Y2G A;  3MNN B;  1AOI C;  4Z5T C;  1KX3 A;  3WA9 B;  3AZE B;  3W99 D;  4AWL C;  2Y2L A;  3WKJ C;  5AV8 C;  5GT0 A;  1P3I A;  5B1L B;  1AOI A;  1HQ3 C;  4Z5T A;  5B2I D;  1KX4 B;  3AYW D;  4WNN B;  1TZY D;  3X1T C;  3WKJ A;  5AV8 A;  3EG5 B;  5B2J C;  3LJA B;  5B0Z C;  3B0D C;  3AV2 D;  3AZK C;  3X1T A;  4LD9 C;  4H9N A;  3X1S B;  4KGC D;  5AV5 C;  4R8P C;  3KXB C;  3UTA A;  4H9R B;  4UUZ B;  5DNM B;  3REK D;  1P3P C;  2FJ7 B;  5B2J A;  3W96 B;  5F99 D;  3TU4 D;  3AZN C;  5B0Z A;  5AV9 D;  4HGA B;  3AZK A;  4LD9 A;  2JCH A;  3A1K A;  5GT3 C;  3EPH A;  5AV5 A;  4R8P A;  3KXB A;  4NE5 A;  1P3I B;  2Y2O A;  1P3P A;  1P3L B;  1AOI B;  3W99 C;  4Z5T B;  3B6G B;  3AZG B;  3AZN A;  3KFU G;  5CPK D;  2RIQ A;  5B24 B;  5GT3 A;  5B2I C;  3WKJ B;  5AV8 B;  3AYW C;  1TZY C;  3F6T A;  3W99 A;  1HQ3 B;  1P3K D;  2ARO D;  3B0C W;  3VH6 T;  3A6N D;  4H9N B;  4WU9 B;  4DRB A;  5B2I A;  3AZJ D;  1Z2C B;  5B0Y D;  3AYW A;  3AV2 C;  1TZY A;  5B2J B;  3AZL B;  4KGC C;  5B0Z B;  3B0D B;  2JE5 A;  4EO5 B;  1F66 D;  3REK C;  3WA9 D;  5F99 C;  4R8P B;  3TU4 C;  4J8X D;  3AV2 A;  5AV9 C;  1U35 B;  3MGQ D;  4H9Q B;  5CHL B;  3MGR B;  4KGC A;  2CV5 A;  5B1L D;  5B1M D;  3REK A;  5F99 A;  3TU4 A;  2ZY4 A;  3EPJ A;  4H9S C;  3C1C D;  5CPK C;  4ZBJ B;  4KUD D;  3IP4 C;  3X1U A;  1B6W A;  5BNX A;  1P3K C;  2ARO C;  3W98 A;  4H9S A;  3A6N C;  3AZH B;  3EPK A;  5CPK A;  1P3M B;  3REJ D;  3W96 D;  3AZJ C;  1P3K A;  2ARO A;  2HUE C;  5AVC C;  4X23 D;  2ZY3 A;  3AV2 B;  1P3O D;  2LY8 A;  1KX5 D;  1F66 C;  1ZLA D;  3WA9 C;  2Y2M A;  1P3L D;  4UPK A;  3AZE C;  3AZJ A;  3B6G D;  4J8X C;  3AZG D;  3REK B;  4KHA A;  3MGQ C;  2FFF B;  4WU8 D;  5AVC A;  3TU4 B;  3NQJ A;  5B1L C;  3C1B D;  5AV9 B;  5B1M C;  1WWS A;  2ZY5 A;  1F66 A;  2Y2H A;  3WA9 A;  5BT1 D;  3AZE A;  2YFW A;  4J8X A;  3MGQ A;  3C1C C;  4G92 B;  1P3F D;  1S32 B;  5B32 G;  5B1L A;  5B1M A;  4KUD C;  5E5A D;  3O62 D;  5KDM B;  3AZL D;  1H3O A;  3C1C A;  2ARO B;  2F8N D;  3A6N B;  3W96 C;  4KUD A;  5B31 G;  1U35 D;  4HGA C;  2F2A C;  1P3B B;  4J8U D;  3X1S A;  3NQU B;  5B0Y B;  4E45 A;  3MGR D;  4X23 C;  2Y2I A;  4H9R A;  4UUZ A;  2HUE B;  4Z2M H;  1P3O C;  1KX5 C;  1P3L C;  3W96 A;  5BNV A;  5AY8 B;  3B6G C;  3AZG C;  1F66 B;  4WU8 C;  2Y2N A;  2YFW B;  5B24 C;  4J8X B;  4X23 A;  1TAF A;  3C1B C;  3MGQ B;  1KX5 A;  3P5J B;  3KWQ D;  1P3L A;  5BT1 C;  3B6G A;  5B1M B;  3AZG A;  3KSY A;  2G5I C;  5B40 B;  4WU8 A;  3AZH D;  1P3F C;  5B24 A;  4CAY A;  1P3M D;  3C1B A;  4WU9 C;  1H3O B;  3C1C B;  5E5A C;  4J8W D;  1HQ3 A;  3O62 C;  4KUD B;  3AZL C;  3REI B;  1P3F A;  4EO5 C;  4WU9 A;  1JFI A;  2NZD D;  4ZUX B;  2IO5 B;  5E5A A;  5CPJ B;  1U35 C;  3REJ B;  3O62 A;  2BG1 A;  4J8U C;  5BNV B;  3REH D;  3AZL A;  3MGR C;  3B0C T;  4X23 B;  1TAF B;  4YS3 D;  1P3O B;  1M19 D;  1KX5 B;  1ZLA B;  5B33 D;  1U35 A;  4J8U A;  4H9Q A;  1S32 D;  3MGR A;  4ZBJ C;  4WJ3 C;  4WU8 B;  3KWQ C;  4CAY B;  3C1B B;  5C3I C;  3H0L C;  3AZH C;  1P3M C;  1P3F B;  2VQR A;  2F8N K;  4M6B A;  1P3B D;  5JA4 B;  1JFI B;  3AZM D;  5E5A B;  1B67 A;  3AZH A;  3O62 B;  1P3M A;  4NE3 A;  5AY8 D;  1BH8 A;  2F8N B;  5DNN B;  3REH C;  3MGP D;  4J8U B;  5GXQ B;  3LZ0 D;  4YS3 C;  1M19 C;  3UT9 D;  5B33 C;  5B40 D;  1Q9C A;  4G92 C;  3REH A;  1S32 C;  5AV9 A;  4E44 A;  4YS3 A;  1M19 A;  3B6F D;  3KWQ B;  5B33 A;  3REI D;  1F1E A;  1S32 A;  5C3I B;  1R4V A;  3AZF B;  4ZUX D;  5CPJ D;  2J8P A;  1P3B C;  4QLC D;  1ID3 D;  3AZM C;  5KDM A;  5B0Y C;  4J8W B;  1M1A D;  1BH8 B;  2PYO D;  3H0M C;  1BFM A;  3WAA D;  3A6N A;  3UTB B;  5AY8 C;  1P3B A;  2NZD B;  3NQU A;  3AZM A;  5AV6 D;  5B0Y A;  3MGP C;  4YM6 D;  5G49 A;  3REH B;  3LZ0 C;  5AY8 A;  3AN2 D;  1P3G D;  3UT9 C;  5B40 C;  4YS3 B;  5GSU D;  1M19 B;  3MGP A;  5B33 B;  4G91 C;  2XD5 A;  3B6F C;  3UT9 A;  3REI C;  5B40 A;  5B31 D;  4JJN D;  5JRG B;  1HTA A;  4XUJ B;  2IO5 C;  4ZUX C;  3MGS D;  5CPJ C;  3REJ C;  5DNN D;  3B6F A;  1M1A C;  3REI A;  2PYO C;  1P3A D;  1P34 B;  3WAA C;  3AZM B;  5GXQ D;  4ZUX A;  5G49 B;  1ZLA C;  3REL B;  5CPJ A;  3REJ A;  3A1I A;  5AV6 C;  2PYO A;  2BYK A;  3UTA D;  3WAA A;  3MGP B;  1P3O A;  1ZLA A;  3LZ0 B;  3V9R A;  5AV6 A;  3AZK D;  3UT9 B;  1EQZ D;  5AVB D;  3AZF D;  4G91 B;  1T3U A;  5B31 C;  4JJN C;  2BYM B;  4H9P B;  3B6F B;  5GT3 D;  3X1V D;  3UTB D;  3MGS C;  5DNN C;  1BH9 A;  5JA4 A;  4Z66 D;  3H0R C;  5B31 A;  4JJN A;  1P3A C;  3AFA B;  1ID3 B;  4QLC B;  2UWX A;  1N1J B;  1M1A B;  2PYO B;  5GXQ C;  3MVD D;  3WTP D;  3B0B A;  2BYK B;  4WV4 B;  3MGS A;  3WAA B;  3VH5 W;  2F8N A;  5DNN A;  4Z2M G;  2NQB D;  4XZQ B;  1P3A A;  3V9R B;  4J8V D;  3UTA C;  2ZM5 A;  1M18 D;  5AV6 B;  1KU5 A;  5GXQ A;  4YM6 B;  5BS7 C;  3KUY D;  3AZI D;  5B32 B;  3AV1 D;  5JRG D;  3AN2 B;  5BO0 B;  1P3G B;  2XD1 A;  4XUJ D;  5AVB C;  1EQZ C;  2CV5 D;  3AZF C;  5GSU B;  5CP6 B;  3LEL D;  3KWQ A;  5BS7 A;  4J8W C;  1KX3 B;  2Y2K A;  1BH9 B;  1P34 D;  1EQZ A;  4NFT A;  5AVB A;  2CWE A;  5B31 B;  3X1V C;  3WTP E;  4JJN B;  3UTB C;  3AZF A;  5GT0 B;  3REL D;  3X1U D;  2HIO D;  2NZD C;  3VH5 A;  4Z66 C;  3MGS B;  4J8W A;  2W8S A;  3W98 D;  4AWL B;  4CSR A;  1PZR A;  3MVD C;  3WTP C;  3UTB A;  3X1V A;  1P3A B;  2NZD A;  4Z66 A;  2L5A A;  2NQB C;  2Y2Q A;  4J8V C;  1M18 C;  5FUG A;  5CPI D;  3X1T B;  3MVD A;  2Y2P A;  3WTP A;  3LZ1 D;  4WZS B;  3UTA B;  3KUY C;  3AZI C;  3AV1 C;  5JRG C;  4NE6 A;  2NQB A;  5AVC D;  4XUJ C;  3W97 D;  2CV5 C;  3MNN D;  4J8V A;  1M18 A;  3AZK B;  4LD9 B;  1EQZ B;  5AVB B;  2G5H C;  3LEL C;  5AV5 B;  3AZE D;  3KXB B;  3KUY A;  2YFV A;  3AZI A;  3AV1 A;  1P3P B;  5JRG A;  3AFA D;  1P34 C;  3VH6 W;  2RVQ D;  4XUJ A;  3AZN B;  3REL C;  1KX4 D;  3EPL A;  4CSR B;  3X1U C;  2HIO C;  5GT3 B;  3LEL A;  3X1V B;  2Y2J A;  4XZQ D;  3W98 C;  1P34 A;  4Z66 B;  3W99 B;  5FUG B;  3R45 A;  3REL A;  3LJA D;  2HIO A;  3FDD A;  3WTP B;  5B32 D;  2DQN C;  3MVD B;  3AL0 C;  5B2I B;  3X1S D;  3AYW B;  1TZY B;  5CPI C;  5CP6 D;  2NQB B;  5DNM D;  2FJ7 D;  4J8V B;  3LZ1 C;  1M18 B;  1KX3 D;  3LZ0 A;  4H9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...