3REJB

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejB00
5G49B 4Z5TC 4CAYB 3REJC 4HGAB 1P3OB 3O62A 4J8WB 4YS3A 3W97D 3C1CD 1BH8A 5GSUB 3AFAC 3TU4A 4Z66C 3AZEC 3AN2C 3KSYA 1H3OB 3MGRC 3REKB 3WTPE 3W99D 3C1BC 3NQUB 5JRGC 5BNXA 1P3MA 3AZHD 5B2IA 1KX5C 3MGQD 2NZDB 1P3GC 3W96A 2HIOA 2RVQD 3KXBD 5E5AA 2IO5C 1P3LC 3WKJC 1P3AB 1U35C 4WU9C 3WAAC 5BS7A 3KUYA 3X1SC 3W98B 5AV8A 3R45B 2PYOB 1ID3A 3AZIA 3AZLA 4DRAA 1P3IA 1B67A 5B0YC 4NE3A 4QLCD 1P3KD 1TZYA 5AV6D 5B0ZD 3REIC 5B2JB 3B6FC 3LELB 5B33C 4J8VA 3UTBC 3X1UD 5CPJD 2NQBB 5B24A 4R8PD 1HQ3D 5GT3C 4KGCC 3AZGC 3MVDD 1M1AC 5GT0B 3V9RA 4J8UD 3AZMC 5CP6A 1P3BC 3LZ0A 3AZNB 4XZQD 1F66C 4KUDD 3X1VA 1F1EA 5JA4A 1M18D 1BH9A 5B1LC 3A6NB 3WTPA 4LD9B 4WU8C 3WA9D 4H9SA 5AV5D 5B32G 3KWQA 4DRBA 3MNND 1AOIA 5AVBA 3O62B 5AY8D 4YS3B 1BH8B 3VH5W 3TU4B 5B1MB 5GXQB 1M19A 1ZLAA 4J8WA 5BNXB 4NE5A 5B2IB 4XUJD 5AVCA 3REKA 3W96B 2HIOB 4M6BA 3AZKA 3NQUA 5E5AB 1KX4A 4JJNA 3KUYB 2CV5D 1P3AA 5AV8B 3REJA 1ID3B 3AZLB 1P3IB 3W97C 3C1CC 4H9RB 5B31A 4EO5C 4E45A 3AFAA 3AN2A 3R45A 3B0DB 4Z66A 2PYOA 3X1TD 3W99C 5B31G 3C1BA 1KX3D 3AZHC 3MGQC 2FJ7D 4WNNA 2RVQC 3KXBC 4J8VB 4YM6B 2YFVB 1P3GA 1S32D 3LELA 1P3PD 5BT1D 3WKJA 5FUGB 3MGPD 1U35A 3X1SA 4KHAB 3V9RB 3AZJD 5AV9D 2AROB 5CP6B 1P34A 3LZ0B 3X1VB 3O62D 5JA4B 1P3FC 4QLCC 1P3KC 5AV6C 5B0ZC 1BH9B 3REIA 3B6GD 4X23A 4ZBJB 3KWQB 1P3MD 3X1UC 3UT9A 5CPJC 4G91C 3RELD 4R8PC 1HQ3C 1KU5A 5AVBB 1AOIB 5E5AD 4AWLC 5DNMD 3MVDC 5DNND 4J8UC 3KUYD 1M19B 1ZLAB 3LJAB 3AZMA 4XZQC 4J8XD 5AV8D 5CPKD 1P3BA 4KUDC 4WZSB 3AZID 5B1MA 1M18C 1P3ID 5GXQA 5AVCB 1N1JB 3AZKB 2F8NA 3WA9C 5B1LA 1KX4B 3AV2D 5AV5C 1TZYD 4WU8A 3AZFB 4JJNB 4Z5TB 2F8NG 3UTAD 3VH6A 3MNNC 3REJB 3REHA 5AY8C 3LZ1D 5B24D 5B31B 3AV1D 3AFAB 3AN2B 4Z66B 3MGRB 4CSRA 4H9RA 4ZUXD 3VH6T 3C1BB 1WWIA 1TAFA 5JRGB 4XUJC 3LZ0D 1EQZA 4WNNB 5F99D 1KX5B 5B32D 1P3GB 5CPID 1P3LB 3WKJB 1U35B 3WTPD 4WU9B 3WAAB 4YM6A 2YFVA 2CV5C 3X1SB 3MGSD 5FUGA 5B40D 1P34B 3C1CA 4KHAA 5B0YB 3X1TC 2AROA 3REIB 1P3OD 1KX3C 1ZLAD 4X23B 3B6FB 3B0BA 2FJ7C 4J8WD 5B33B 3AZHA 5GSUD 3UT9B 3KXBA 3B0CT 1S32C 3UTBB 1P3PC 3REKD 5BT1C 3MGPC 1JFIA 1KX4D 4KGCB 3AZGB 2L5AA 2NZDD 3AZJC 4H9QA 1M1AB 5AV9C 5CHLB 1Q9CA 3AZMB 1P3AD 1P3BB 1F66B 1P3FA 5B31D 3LJAA 4QLCA 3W98D 5AV6A 5B0ZA 5C3IC 2F8NB 3B6GC 5B1LB 2PYOD 4WU8B 2HUEC 4H9OA 1N1JA 1P3MC 3RELC 2YFWB 5CPJA 1R4VA 5B2JD 3REHB 3AZFA 3AYWA 5DNMC 3LELD 5DNNC 4Z5TA 3MVDA 1A7WA 5BS7C 3KUYC 2JSSA 2F8NK 4H9NA 4J8UA 4CSRB 2NQBD 4J8XC 5CPKC 5AV8C 1B6WA 4XZQA 3AZIC 4NFTA 1TAFB 1P34D 4H9PA 3AZEA 1EQZB 4KUDA 1M18A 3MGRA 5GT0D 3AV2C 1TZYC 5JRGA 5AV5A 3AZND 1KX5A 4X23D 3UTAC 1P3LA 3A6ND 3MNNA 3UT9D 4LD9D 5BO0A 3LZ1C 5AY8A 4WU9A 5B24C 3WAAA 3W97B 4G92C 3C1CB 3AV1C 4EO5B 4E44A 4ZUXC 3W99B 4YS3D 5F99C 3AZHB 5B0YA 4Z2MG 4XUJA 4WV4B 5B32C 3TU4D 5B1MD 5CPIC 3KXBB 5GXQD 3B6FA 5BNVA 5B33A 2F8ND 3WTPC 1JFIB 5B2ID 3UTBA 3MGSC 2CV5A 3W96D 2HIOD 4H9QB 5B40C 5GT3A 4KGCA 3AZGA 3VH5A 3REHD 1BFMA 2BYMA 1M1AA 1P3FB 4QLCB 1P3KB 4HGAC 5AV6B 5B0ZB 3X1TA 1P3OC 1ID3D 1ZLAC 1F66A 4J8WC 3AZLD 1KX3A 4H9OB 2FJ7A 3VH5T 5GSUC 1EQZD 3REKC 1HTAA 5CPJB 4G91B 1S32A 4R8PB 3MGPA 3AYWB 1KX4C 2NZDC 4AWLB 3MVDB 2YFWA 4J8VD 4YM6D 4H9NB 3AZJA 4J8UB 5AV9A 1P3AC 4XZQB 4KUDB 4H9PB 3AZEB 5B31C 1M18B 3W98C 2PYOC 3WA9B 3B6GA 2AROD 5CP6D 5AV5B 3X1VD 3RELA 2IO5B 5B2JC 1ULYA 3MNNB 5BO0B 3LELC 5AY8B 5DNMA 5DNNA 3KWQD 2NQBC 3W97A 4J8XA 5AVBD 5CPKA 1AOID 1P34C 2CWEA 4XUJB 5GT0C 3W99A 4UUZA 1P3FD 1M19D 3LJAD 3AV2A 5BNVB 3AZNC 3MGQA 4X23C 2LY8A 5AVCD 3UTAA 2CV5B 3A6NC 3UT9C 3AZKD 4LD9C 5GT3B 3LZ1A 5KDMA 3AZFD 3AYWD 4JJND 3AV1A 2BYMB 4Z5TD 3X1TB 3REJD 3O62C 4ZUXA 4YS3C 1KX3B 2FJ7B 3TU4C 5F99A 1P3KA 5B1MC 3AFAD 5B32A 3AZED 5GXQC 4Z66D 3AN2D 5CPIA 3NQJB 1S32B 3MGRD 1P3PB 3MGPB 3C1BD 5JRGD 5B2IC 2BYKB 3X1UA 3W96C 1KX5D 2HIOC 3MGSA 4R8PA 1P3GD 3AZJB 5E5AC 1HQ3A 5B40A 5AV9B 1P3LD 3WKJD 3REHC 1U35D 4WU9D 3WAAD 5G49A 4CAYA 3X1SD 1ID3C 5C3IB 1P3OA 3B6GB 3AZLC 1P3IC 2HUEB 5GSUA 3B0DC 1P3MB 1EQZC 5B0YD 3RELB 1H3OA 3WA9A 3REID 4Z2MH 3B6FD 5DNMB 5B33D 2NZDA 5DNNB 4J8VC 1WWSA 4YM6C 3UTBD 4J8XB 5CPKB 3VH6W 5GT3D 4KGCD 3AZGD 3AZIB 3W98A 1M1AD 4UUZB 2AROC 5CP6C 3AV2B 3LZ0C 1TZYB 3AZMD 3MGQB 1P3BD 3X1VC 1F66D 3UTAB 5B2JA 5B1LD 4H9SC 4ZBJC 4WU8D 3LZ1B 5KDMB 5B24B 4G92B 3KWQC 3AV1B 2NQBA 1AOIC 5AVBC 2F8NH 4ZUXB 5F99B 5B32B 5GT0A 1M19C 5CPIB 3LJAC 3B0CW 4NE6A 3AZNA 3WTPB 5AVCC 3X1UB 3NQJA 3MGSB 3AZKC 1P3PA 1HQ3B 5B40B 3A6NA 4LD9A 2BYKA 3AZFC 3AYWC 4JJNC
chains in the Genus database with same CATH superfamily
5G49B 4Z5TC 4CAYB 3REJC 4HGAB 1P3OB 3O62A 4J8WB 4YS3A 3W97D 2DF4C 3C1CD 1BH8A 5GSUB 3AFAC 3TU4A 4Z66C 3AZEC 3AN2C 3KSYA 1H3OB 3MGRC 3REKB 3WTPE 3W99D 3C1BC 3NQUB 5JRGC 5BNXA 1P3MA 3AZHD 5B2IA 1KX5C 3MGQD 2NZDB 1P3GC 3W96A 2HIOA 2RVQD 3KXBD 1PZRA 5E5AA 2IO5C 1P3LC 3WKJC 1P3AB 1U35C 2Y2MA 4WU9C 3WAAC 5BS7A 3KUYA 3X1SC 3W98B 2ZY2A 5AV8A 3R45B 2PYOB 1ID3A 3AZIA 3AZLA 4DRAA 1P3IA 1B67A 5B0YC 4NE3A 4QLCD 1P3KD 1TZYA 5AV6D 5B0ZD 3REIC 5B2JB 3B6FC 3LELB 5B33C 4J8VA 3UTBC 3X1UD 5CPJD 2NQBB 5B24A 4R8PD 1HQ3D 5GT3C 4KGCC 3AZGC 3MVDD 1M1AC 5GT0B 3V9RA 4J8UD 3AZMC 5CP6A 1P3BC 3LZ0A 3AZNB 4XZQD 1F66C 3P5JB 4KUDD 3X1VA 1F1EA 5JA4A 1M18D 1BH9A 5B1LC 2J8PA 3A6NB 3WTPA 2JE5A 4WU8C 3WA9D 4LD9B 4H9SA 5AV5D 5B32G 3KWQA 3EPHA 4DRBA 3MNND 1AOIA 5AVBA 3O62B 5AY8D 2Y2NA 4YS3B 1BH8B 3VH5W 3TU4B 3KFUG 5B1MB 5GXQB 2FFFB 1M19A 1ZLAA 4J8WA 3A1KA 4DQYB 5BNXB 4NE5A 5B2IB 4XUJD 2Y2GA 5AVCA 3REKA 3W96B 2HIOB 4M6BA 3AZKA 3NQUA 5E5AB 1KX4A 3H0RC 4JJNA 3KUYB 2CV5D 1P3AA 5AV8B 3REJA 1ID3B 3AZLB 2W8SA 1P3IB 3W97C 3C1CC 4H9RB 5B31A 4EO5C 4E45A 3AFAA 3AN2A 3B0DB 3R45A 4Z66A 2PYOA 3X1TD 3W99C 3H0LC 5B31G 3C1BA 3AZHC 1KX3D 3MGQC 2FJ7D 4WNNA 2RVQC 3KXBC 4J8VB 4YM6B 2YFVB 1P3GA 1S32D 3LELA 1P3PD 5BT1D 3WKJA 5FUGB 3MGPD 2Y2JA 1U35A 3X1SA 4KHAB 3V9RB 3AZJD 5AV9D 2AROB 5CP6B 1P34A 3LZ0B 3X1VB 3O62D 5JA4B 1P3FC 4QLCC 1P3KC 5AV6C 5B0ZC 1BH9B 1T3UA 3REIA 3B6GD 4X23A 4ZBJB 3EG5B 3KWQB 1P3MD 3X1UC 3UT9A 5CPJC 4G91C 3RELD 4R8PC 1HQ3C 1KU5A 5AVBB 1AOIB 2ZY3A 5E5AD 4AWLC 5DNMD 3MVDC 5DNND 4J8UC 3KUYD 1M19B 1ZLAB 3LJAB 3AZMA 4XZQC 4J8XD 5AV8D 2Y2HA 5CPKD 1P3BA 4KUDC 4WZSB 3AZID 5B1MA 1M18C 1P3ID 5GXQA 5AVCB 1N1JB 3AZKB 2F8NA 3WA9C 5B1LA 3EPLA 3AV2D 5AV5C 1KX4B 1TZYD 4WU8A 3AZFB 4JJNB 4Z5TB 2F8NG 3UTAD 2XD1A 3VH6A 3MNNC 3REJB 3REHA 5AY8C 3LZ1D 5B24D 5B31B 3AV1D 3AFAB 3AN2B 4Z66B 3MGRB 4CSRA 4H9RA 4ZUXD 3VH6T 3C1BB 1WWIA 1TAFA 5JRGB 4XUJC 3LZ0D 1EQZA 4WNNB 5F99D 1KX5B 5B32D 1P3GB 5CPID 1P3LB 3WKJB 1U35B 3WTPD 4WU9B 3WAAB 4YM6A 2YFVA 2CV5C 3X1SB 3F6TA 3MGSD 5FUGA 5B40D 1P34B 3C1CA 2Y2IA 4KHAA 5B0YB 3X1TC 2AROA 3REIB 1P3OD 1KX3C 1ZLAD 4X23B 3B6FB 3B0BA 2FJ7C 4J8WD 5B33B 2BG1A 3AZHA 5GSUD 3UT9B 3KXBA 3B0CT 1S32C 3UTBB 1P3PC 3REKD 5BT1C 3MGPC 1JFIA 2DQNC 1KX4D 4KGCB 3AZGB 2L5AA 2NZDD 3AZJC 4H9QA 1M1AB 5AV9C 5CHLB 1Q9CA 3AZMB 1P3AD 1P3BB 1F66B 2F2AC 1P3FA 5B31D 2Y2LA 4QLCA 3LJAA 3W98D 5AV6A 5B0ZA 5C3IC 3A1IA 2F8NB 3B6GC 5B1LB 2PYOD 4WU8B 2HUEC 4H9OA 1N1JA 2G5IC 1P3MC 3RELC 2YFWB 5CPJA 1R4VA 5B2JD 3REHB 3AZFA 3AYWA 5DNMC 3LELD 5DNNC 4Z5TA 3MVDA 1A7WA 5BS7C 3KUYC 2JSSA 2F8NK 4H9NA 4J8UA 4CSRB 2NQBD 4J8XC 5CPKC 5AV8C 1B6WA 4XZQA 2ZY4A 4NFTA 1TAFB 3AZIC 4H9PA 3AZEA 1P34D 1EQZB 4KUDA 1M18A 3MGRA 5GT0D 3AV2C 1TZYC 5JRGA 5AV5A 2RIQA 2Y2OA 3AZND 1KX5A 4X23D 3UTAC 3EPJA 1P3LA 3A6ND 2Y2KA 3MNNA 3UT9D 4LD9D 5BO0A 3LZ1C 5AY8A 4WU9A 5B24C 3WAAA 3W97B 4G92C 3C1CB 3AV1C 4EO5B 4E44A 4ZUXC 3W99B 4YS3D 5F99C 3AZHB 5B0YA 4Z2MG 4XUJA 4WV4B 5B32C 3TU4D 5B1MD 5CPIC 3KXBB 5GXQD 3B6FA 5BNVA 5B33A 2F8ND 3WTPC 1JFIB 2JCHA 5B2ID 3UTBA 3MGSC 2CV5A 3W96D 2HIOD 4H9QB 5B40C 5GT3A 4KGCA 3AZGA 3VH5A 3REHD 1BFMA 2BYMA 1M1AA 1P3FB 4QLCB 1P3KB 4HGAC 5AV6B 5B0ZB 2ZM5A 3X1TA 1P3OC 1ID3D 1ZLAC 1F66A 4J8WC 3AZLD 1KX3A 4H9OB 2FJ7A 3VH5T 5GSUC 1EQZD 3REKC 1HTAA 5CPJB 4G91B 1S32A 4R8PB 3MGPA 3AYWB 1KX4C 2NZDC 4AWLB 3MVDB 4WJ3C 2YFWA 3EPKA 4J8VD 4YM6D 4H9NB 3AZJA 4J8UB 5AV9A 1P3AC 4XZQB 4KUDB 4H9PB 3AZEB 5B31C 1M18B 3W98C 2PYOC 3WA9B 3B6GA 2AROD 5CP6D 5AV5B 2ZY5A 3X1VD 3RELA 2IO5B 5B2JC 1ULYA 3MNNB 5BO0B 3LELC 5AY8B 5DNMA 5DNNA 3IP4C 3KWQD 2NQBC 3W97A 4J8XA 5AVBD 5CPKA 1AOID 1P34C 2CWEA 4XUJB 5GT0C 3W99A 4UUZA 1P3FD 1M19D 3LJAD 3AV2A 2XD5A 5BNVB 3AZNC 3MGQA 4X23C 2LY8A 5AVCD 3UTAA 2CV5B 3A6NC 3UT9C 3AZKD 4LD9C 5GT3B 3H0MC 5KDMA 3LZ1A 3AZFD 3AYWD 4JJND 3AV1A 2BYMB 4Z5TD 3X1TB 3REJD 3O62C 4ZUXA 3AL0C 4YS3C 1KX3B 2FJ7B 3TU4C 5F99A 1P3KA 5B1MC 3AFAD 5B32A 3AZED 5GXQC 4Z66D 3AN2D 5CPIA 3NQJB 1S32B 3MGRD 1Z2CB 1P3PB 3MGPB 3C1BD 5JRGD 5B2IC 2BYKB 3X1UA 3W96C 1KX5D 2HIOC 3MGSA 4R8PA 1P3GD 3AZJB 5E5AC 1HQ3A 5B40A 5AV9B 1P3LD 3WKJD 3REHC 2Y2PA 1U35D 2Y2QA 4WU9D 3WAAD 5G49A 4CAYA 3FDDA 3X1SD 1ID3C 5C3IB 1P3OA 3B6GB 3AZLC 1P3IC 2HUEB 5GSUA 3B0DC 1P3MB 1EQZC 5B0YD 3RELB 1H3OA 3WA9A 2UWXA 3REID 4Z2MH 3B6FD 5DNMB 5B33D 2NZDA 5DNNB 4J8VC 1WWSA 4YM6C 4UPKA 3UTBD 4J8XB 5CPKB 3VH6W 5GT3D 4KGCD 3AZGD 3AZIB 3W98A 1M1AD 4UUZB 2AROC 5CP6C 3AV2B 3LZ0C 1TZYB 3AZMD 3MGQB 1P3BD 3X1VC 1F66D 2G5HC 3UTAB 5B2JA 5B1LD 4H9SC 4ZBJC 4WU8D 3LZ1B 5KDMB 5B24B 4G92B 3KWQC 3AV1B 2NQBA 1AOIC 2VQRA 5AVBC 2F8NH 4ZUXB 1W2EA 5F99B 5B32B 5GT0A 1M19C 5CPIB 3LJAC 3B0CW 4NE6A 3AZNA 3WTPB 5AVCC 3X1UB 3NQJA 3MGSB 3AZKC 1P3PA 1HQ3B 5B40B 3A6NA 4LD9A 2BYKA 3AZFC 3AYWC 4JJNC
chains in the Genus database with same CATH topology
5G49B 4Z5TC 4CAYB 3REJC 4HGAB 1P3OB 3O62A 4J8WB 4YS3A 3W97D 2DF4C 3C1CD 1BH8A 5GSUB 3AFAC 3TU4A 4Z66C 3AZEC 3AN2C 3KSYA 1H3OB 3MGRC 3REKB 3WTPE 3W99D 3C1BC 3NQUB 5JRGC 5BNXA 1P3MA 3AZHD 5B2IA 1KX5C 3MGQD 2NZDB 1P3GC 3W96A 2HIOA 2RVQD 3KXBD 1PZRA 5E5AA 2IO5C 1P3LC 3WKJC 1P3AB 1U35C 2Y2MA 4WU9C 3WAAC 5BS7A 3KUYA 3X1SC 3W98B 2ZY2A 5AV8A 3R45B 2PYOB 1ID3A 3AZIA 3AZLA 4DRAA 1P3IA 1B67A 5B0YC 4NE3A 4QLCD 1P3KD 1TZYA 5AV6D 5B0ZD 3REIC 5B2JB 3B6FC 3LELB 5B33C 4J8VA 3UTBC 3X1UD 5CPJD 2NQBB 5B24A 4R8PD 1HQ3D 5GT3C 4KGCC 3AZGC 3MVDD 1M1AC 5GT0B 3V9RA 4J8UD 3AZMC 5CP6A 1P3BC 3LZ0A 3AZNB 4XZQD 1F66C 3P5JB 4KUDD 3X1VA 1F1EA 5JA4A 1M18D 1BH9A 5B1LC 2J8PA 3A6NB 3WTPA 2JE5A 4WU8C 3WA9D 4LD9B 4H9SA 5AV5D 5B32G 3KWQA 3EPHA 4DRBA 3MNND 1AOIA 5AVBA 3O62B 5AY8D 2Y2NA 4YS3B 1BH8B 3VH5W 3TU4B 3KFUG 5B1MB 5GXQB 2FFFB 1M19A 1ZLAA 4J8WA 3A1KA 4DQYB 5BNXB 4NE5A 5B2IB 4XUJD 2Y2GA 5AVCA 3REKA 3W96B 2HIOB 4M6BA 3AZKA 3NQUA 5E5AB 1KX4A 3H0RC 4JJNA 3KUYB 2CV5D 1P3AA 5AV8B 3REJA 1ID3B 3AZLB 2W8SA 1P3IB 3W97C 3C1CC 4H9RB 5B31A 4EO5C 4E45A 3AFAA 3AN2A 3B0DB 3R45A 4Z66A 2PYOA 3X1TD 3W99C 3H0LC 5B31G 3C1BA 3AZHC 1KX3D 3MGQC 2FJ7D 4WNNA 2RVQC 3KXBC 4J8VB 4YM6B 2YFVB 1P3GA 1S32D 3LELA 1P3PD 5BT1D 3WKJA 5FUGB 3MGPD 2Y2JA 1U35A 3X1SA 4KHAB 3V9RB 3AZJD 5AV9D 2AROB 5CP6B 1P34A 3LZ0B 3X1VB 3O62D 5JA4B 1P3FC 4QLCC 1P3KC 5AV6C 5B0ZC 1BH9B 1T3UA 3REIA 3B6GD 4X23A 4ZBJB 3EG5B 3KWQB 1P3MD 3X1UC 3UT9A 5CPJC 4G91C 3RELD 4R8PC 1HQ3C 1KU5A 5AVBB 1AOIB 2ZY3A 5E5AD 4AWLC 5DNMD 3MVDC 5DNND 4J8UC 3KUYD 1M19B 1ZLAB 3LJAB 3AZMA 4XZQC 4J8XD 5AV8D 2Y2HA 5CPKD 1P3BA 4KUDC 4WZSB 3AZID 5B1MA 1M18C 1P3ID 5GXQA 5AVCB 1N1JB 3AZKB 2F8NA 3WA9C 5B1LA 3EPLA 3AV2D 5AV5C 1KX4B 1TZYD 4WU8A 3AZFB 4JJNB 4Z5TB 2F8NG 3UTAD 2XD1A 3VH6A 3MNNC 3REJB 3REHA 5AY8C 3LZ1D 5B24D 5B31B 3AV1D 3AFAB 3AN2B 4Z66B 3MGRB 4CSRA 4H9RA 4ZUXD 3VH6T 3C1BB 1WWIA 1TAFA 5JRGB 4XUJC 3LZ0D 1EQZA 4WNNB 5F99D 1KX5B 5B32D 1P3GB 5CPID 1P3LB 3WKJB 1U35B 3WTPD 4WU9B 3WAAB 4YM6A 2YFVA 2CV5C 3X1SB 3F6TA 3MGSD 5FUGA 5B40D 1P34B 3C1CA 2Y2IA 4KHAA 5B0YB 3X1TC 2AROA 3REIB 1P3OD 1KX3C 1ZLAD 4X23B 3B6FB 3B0BA 2FJ7C 4J8WD 5B33B 2BG1A 3AZHA 5GSUD 3UT9B 3KXBA 3B0CT 1S32C 3UTBB 1P3PC 3REKD 5BT1C 3MGPC 1JFIA 2DQNC 1KX4D 4KGCB 3AZGB 2L5AA 2NZDD 3AZJC 4H9QA 1M1AB 5AV9C 5CHLB 1Q9CA 3AZMB 1P3AD 1P3BB 1F66B 2F2AC 1P3FA 5B31D 2Y2LA 4QLCA 3LJAA 3W98D 5AV6A 5B0ZA 5C3IC 3A1IA 2F8NB 3B6GC 5B1LB 2PYOD 4WU8B 2HUEC 4H9OA 1N1JA 2G5IC 1P3MC 3RELC 2YFWB 5CPJA 1R4VA 5B2JD 3REHB 3AZFA 3AYWA 5DNMC 3LELD 5DNNC 4Z5TA 3MVDA 1A7WA 5BS7C 3KUYC 2JSSA 2F8NK 4H9NA 4J8UA 4CSRB 2NQBD 4J8XC 5CPKC 5AV8C 1B6WA 4XZQA 2ZY4A 4NFTA 1TAFB 3AZIC 4H9PA 3AZEA 1P34D 1EQZB 4KUDA 1M18A 3MGRA 5GT0D 3AV2C 1TZYC 5JRGA 5AV5A 2RIQA 2Y2OA 3AZND 1KX5A 4X23D 3UTAC 3EPJA 1P3LA 3A6ND 2Y2KA 3MNNA 3UT9D 4LD9D 5BO0A 3LZ1C 5AY8A 4WU9A 5B24C 3WAAA 3W97B 4G92C 3C1CB 3AV1C 4EO5B 4E44A 4ZUXC 3W99B 4YS3D 5F99C 3AZHB 5B0YA 4Z2MG 4XUJA 4WV4B 5B32C 3TU4D 5B1MD 5CPIC 3KXBB 5GXQD 3B6FA 5BNVA 5B33A 2F8ND 3WTPC 1JFIB 2JCHA 5B2ID 3UTBA 3MGSC 2CV5A 3W96D 2HIOD 4H9QB 5B40C 5GT3A 4KGCA 3AZGA 3VH5A 3REHD 1BFMA 2BYMA 1M1AA 1P3FB 4QLCB 1P3KB 4HGAC 5AV6B 5B0ZB 2ZM5A 3X1TA 1P3OC 1ID3D 1ZLAC 1F66A 4J8WC 3AZLD 1KX3A 4H9OB 2FJ7A 3VH5T 5GSUC 1EQZD 3REKC 1HTAA 5CPJB 4G91B 1S32A 4R8PB 3MGPA 3AYWB 1KX4C 2NZDC 4AWLB 3MVDB 4WJ3C 2YFWA 3EPKA 4J8VD 4YM6D 4H9NB 3AZJA 4J8UB 5AV9A 1P3AC 4XZQB 4KUDB 4H9PB 3AZEB 5B31C 1M18B 3W98C 2PYOC 3WA9B 3B6GA 2AROD 5CP6D 5AV5B 2ZY5A 3X1VD 3RELA 2IO5B 5B2JC 1ULYA 3MNNB 5BO0B 3LELC 5AY8B 5DNMA 5DNNA 3IP4C 3KWQD 2NQBC 3W97A 4J8XA 5AVBD 5CPKA 1AOID 1P34C 2CWEA 4XUJB 5GT0C 3W99A 4UUZA 1P3FD 1M19D 3LJAD 3AV2A 2XD5A 5BNVB 3AZNC 3MGQA 4X23C 2LY8A 5AVCD 3UTAA 2CV5B 3A6NC 3UT9C 3AZKD 4LD9C 5GT3B 3H0MC 5KDMA 3LZ1A 3AZFD 3AYWD 4JJND 3AV1A 2BYMB 4Z5TD 3X1TB 3REJD 3O62C 4ZUXA 3AL0C 4YS3C 1KX3B 2FJ7B 3TU4C 5F99A 1P3KA 5B1MC 3AFAD 5B32A 3AZED 5GXQC 4Z66D 3AN2D 5CPIA 3NQJB 1S32B 3MGRD 1Z2CB 1P3PB 3MGPB 3C1BD 5JRGD 5B2IC 2BYKB 3X1UA 3W96C 1KX5D 2HIOC 3MGSA 4R8PA 1P3GD 3AZJB 5E5AC 1HQ3A 5B40A 5AV9B 1P3LD 3WKJD 3REHC 2Y2PA 1U35D 2Y2QA 4WU9D 3WAAD 5G49A 4CAYA 3FDDA 3X1SD 1ID3C 5C3IB 1P3OA 3B6GB 3AZLC 1P3IC 2HUEB 5GSUA 3B0DC 1P3MB 1EQZC 5B0YD 3RELB 1H3OA 3WA9A 2UWXA 3REID 4Z2MH 3B6FD 5DNMB 5B33D 2NZDA 5DNNB 4J8VC 1WWSA 4YM6C 4UPKA 3UTBD 4J8XB 5CPKB 3VH6W 5GT3D 4KGCD 3AZGD 3AZIB 3W98A 1M1AD 4UUZB 2AROC 5CP6C 3AV2B 3LZ0C 1TZYB 3AZMD 3MGQB 1P3BD 3X1VC 1F66D 2G5HC 3UTAB 5B2JA 5B1LD 4H9SC 4ZBJC 4WU8D 3LZ1B 5KDMB 5B24B 4G92B 3KWQC 3AV1B 2NQBA 1AOIC 2VQRA 5AVBC 2F8NH 4ZUXB 1W2EA 5F99B 5B32B 5GT0A 1M19C 5CPIB 3LJAC 3B0CW 4NE6A 3AZNA 3WTPB 5AVCC 3X1UB 3NQJA 3MGSB 3AZKC 1P3PA 1HQ3B 5B40B 3A6NA 4LD9A 2BYKA 3AZFC 3AYWC 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G49 B;  4Z5T C;  4CAY B;  3REJ C;  4HGA B;  1P3O B;  3O62 A;  4J8W B;  4YS3 A;  3W97 D;  3C1C D;  1BH8 A;  5GSU B;  3AFA C;  3TU4 A;  4Z66 C;  3AZE C;  3AN2 C;  3KSY A;  1H3O B;  3MGR C;  3REK B;  3WTP E;  3W99 D;  3C1B C;  3NQU B;  5JRG C;  5BNX A;  1P3M A;  3AZH D;  5B2I A;  1KX5 C;  3MGQ D;  2NZD B;  1P3G C;  3W96 A;  2HIO A;  2RVQ D;  3KXB D;  5E5A A;  2IO5 C;  1P3L C;  3WKJ C;  1P3A B;  1U35 C;  4WU9 C;  3WAA C;  5BS7 A;  3KUY A;  3X1S C;  3W98 B;  5AV8 A;  3R45 B;  2PYO B;  1ID3 A;  3AZI A;  3AZL A;  4DRA A;  1P3I A;  1B67 A;  5B0Y C;  4NE3 A;  4QLC D;  1P3K D;  1TZY A;  5AV6 D;  5B0Z D;  3REI C;  5B2J B;  3B6F C;  3LEL B;  5B33 C;  4J8V A;  3UTB C;  3X1U D;  5CPJ D;  2NQB B;  5B24 A;  4R8P D;  1HQ3 D;  5GT3 C;  4KGC C;  3AZG C;  3MVD D;  1M1A C;  5GT0 B;  3V9R A;  4J8U D;  3AZM C;  5CP6 A;  1P3B C;  3LZ0 A;  3AZN B;  4XZQ D;  1F66 C;  4KUD D;  3X1V A;  1F1E A;  5JA4 A;  1M18 D;  1BH9 A;  5B1L C;  3A6N B;  3WTP A;  4LD9 B;  4WU8 C;  3WA9 D;  4H9S A;  5AV5 D;  5B32 G;  3KWQ A;  4DRB A;  3MNN D;  1AOI A;  5AVB A;  3O62 B;  5AY8 D;  4YS3 B;  1BH8 B;  3VH5 W;  3TU4 B;  5B1M B;  5GXQ B;  1M19 A;  1ZLA A;  4J8W A;  5BNX B;  4NE5 A;  5B2I B;  4XUJ D;  5AVC A;  3REK A;  3W96 B;  2HIO B;  4M6B A;  3AZK A;  3NQU A;  5E5A B;  1KX4 A;  4JJN A;  3KUY B;  2CV5 D;  1P3A A;  5AV8 B;  3REJ A;  1ID3 B;  3AZL B;  1P3I B;  3W97 C;  3C1C C;  4H9R B;  5B31 A;  4EO5 C;  4E45 A;  3AFA A;  3AN2 A;  3R45 A;  3B0D B;  4Z66 A;  2PYO A;  3X1T D;  3W99 C;  5B31 G;  3C1B A;  1KX3 D;  3AZH C;  3MGQ C;  2FJ7 D;  4WNN A;  2RVQ C;  3KXB C;  4J8V B;  4YM6 B;  2YFV B;  1P3G A;  1S32 D;  3LEL A;  1P3P D;  5BT1 D;  3WKJ A;  5FUG B;  3MGP D;  1U35 A;  3X1S A;  4KHA B;  3V9R B;  3AZJ D;  5AV9 D;  2ARO B;  5CP6 B;  1P34 A;  3LZ0 B;  3X1V B;  3O62 D;  5JA4 B;  1P3F C;  4QLC C;  1P3K C;  5AV6 C;  5B0Z C;  1BH9 B;  3REI A;  3B6G D;  4X23 A;  4ZBJ B;  3KWQ B;  1P3M D;  3X1U C;  3UT9 A;  5CPJ C;  4G91 C;  3REL D;  4R8P C;  1HQ3 C;  1KU5 A;  5AVB B;  1AOI B;  5E5A D;  4AWL C;  5DNM D;  3MVD C;  5DNN D;  4J8U C;  3KUY D;  1M19 B;  1ZLA B;  3LJA B;  3AZM A;  4XZQ C;  4J8X D;  5AV8 D;  5CPK D;  1P3B A;  4KUD C;  4WZS B;  3AZI D;  5B1M A;  1M18 C;  1P3I D;  5GXQ A;  5AVC B;  1N1J B;  3AZK B;  2F8N A;  3WA9 C;  5B1L A;  1KX4 B;  3AV2 D;  5AV5 C;  1TZY D;  4WU8 A;  3AZF B;  4JJN B;  4Z5T B;  2F8N G;  3UTA D;  3VH6 A;  3MNN C;  3REJ B;  3REH A;  5AY8 C;  3LZ1 D;  5B24 D;  5B31 B;  3AV1 D;  3AFA B;  3AN2 B;  4Z66 B;  3MGR B;  4CSR A;  4H9R A;  4ZUX D;  3VH6 T;  3C1B B;  1WWI A;  1TAF A;  5JRG B;  4XUJ C;  3LZ0 D;  1EQZ A;  4WNN B;  5F99 D;  1KX5 B;  5B32 D;  1P3G B;  5CPI D;  1P3L B;  3WKJ B;  1U35 B;  3WTP D;  4WU9 B;  3WAA B;  4YM6 A;  2YFV A;  2CV5 C;  3X1S B;  3MGS D;  5FUG A;  5B40 D;  1P34 B;  3C1C A;  4KHA A;  5B0Y B;  3X1T C;  2ARO A;  3REI B;  1P3O D;  1KX3 C;  1ZLA D;  4X23 B;  3B6F B;  3B0B A;  2FJ7 C;  4J8W D;  5B33 B;  3AZH A;  5GSU D;  3UT9 B;  3KXB A;  3B0C T;  1S32 C;  3UTB B;  1P3P C;  3REK D;  5BT1 C;  3MGP C;  1JFI A;  1KX4 D;  4KGC B;  3AZG B;  2L5A A;  2NZD D;  3AZJ C;  4H9Q A;  1M1A B;  5AV9 C;  5CHL B;  1Q9C A;  3AZM B;  1P3A D;  1P3B B;  1F66 B;  1P3F A;  5B31 D;  3LJA A;  4QLC A;  3W98 D;  5AV6 A;  5B0Z A;  5C3I C;  2F8N B;  3B6G C;  5B1L B;  2PYO D;  4WU8 B;  2HUE C;  4H9O A;  1N1J A;  1P3M C;  3REL C;  2YFW B;  5CPJ A;  1R4V A;  5B2J D;  3REH B;  3AZF A;  3AYW A;  5DNM C;  3LEL D;  5DNN C;  4Z5T A;  3MVD A;  1A7W A;  5BS7 C;  3KUY C;  2JSS A;  2F8N K;  4H9N A;  4J8U A;  4CSR B;  2NQB D;  4J8X C;  5CPK C;  5AV8 C;  1B6W A;  4XZQ A;  3AZI C;  4NFT A;  1TAF B;  1P34 D;  4H9P A;  3AZE A;  1EQZ B;  4KUD A;  1M18 A;  3MGR A;  5GT0 D;  3AV2 C;  1TZY C;  5JRG A;  5AV5 A;  3AZN D;  1KX5 A;  4X23 D;  3UTA C;  1P3L A;  3A6N D;  3MNN A;  3UT9 D;  4LD9 D;  5BO0 A;  3LZ1 C;  5AY8 A;  4WU9 A;  5B24 C;  3WAA A;  3W97 B;  4G92 C;  3C1C B;  3AV1 C;  4EO5 B;  4E44 A;  4ZUX C;  3W99 B;  4YS3 D;  5F99 C;  3AZH B;  5B0Y A;  4Z2M G;  4XUJ A;  4WV4 B;  5B32 C;  3TU4 D;  5B1M D;  5CPI C;  3KXB B;  5GXQ D;  3B6F A;  5BNV A;  5B33 A;  2F8N D;  3WTP C;  1JFI B;  5B2I D;  3UTB A;  3MGS C;  2CV5 A;  3W96 D;  2HIO D;  4H9Q B;  5B40 C;  5GT3 A;  4KGC A;  3AZG A;  3VH5 A;  3REH D;  1BFM A;  2BYM A;  1M1A A;  1P3F B;  4QLC B;  1P3K B;  4HGA C;  5AV6 B;  5B0Z B;  3X1T A;  1P3O C;  1ID3 D;  1ZLA C;  1F66 A;  4J8W C;  3AZL D;  1KX3 A;  4H9O B;  2FJ7 A;  3VH5 T;  5GSU C;  1EQZ D;  3REK C;  1HTA A;  5CPJ B;  4G91 B;  1S32 A;  4R8P B;  3MGP A;  3AYW B;  1KX4 C;  2NZD C;  4AWL B;  3MVD B;  2YFW A;  4J8V D;  4YM6 D;  4H9N B;  3AZJ A;  4J8U B;  5AV9 A;  1P3A C;  4XZQ B;  4KUD B;  4H9P B;  3AZE B;  5B31 C;  1M18 B;  3W98 C;  2PYO C;  3WA9 B;  3B6G A;  2ARO D;  5CP6 D;  5AV5 B;  3X1V D;  3REL A;  2IO5 B;  5B2J C;  1ULY A;  3MNN B;  5BO0 B;  3LEL C;  5AY8 B;  5DNM A;  5DNN A;  3KWQ D;  2NQB C;  3W97 A;  4J8X A;  5AVB D;  5CPK A;  1AOI D;  1P34 C;  2CWE A;  4XUJ B;  5GT0 C;  3W99 A;  4UUZ A;  1P3F D;  1M19 D;  3LJA D;  3AV2 A;  5BNV B;  3AZN C;  3MGQ A;  4X23 C;  2LY8 A;  5AVC D;  3UTA A;  2CV5 B;  3A6N C;  3UT9 C;  3AZK D;  4LD9 C;  5GT3 B;  3LZ1 A;  5KDM A;  3AZF D;  3AYW D;  4JJN D;  3AV1 A;  2BYM B;  4Z5T D;  3X1T B;  3REJ D;  3O62 C;  4ZUX A;  4YS3 C;  1KX3 B;  2FJ7 B;  3TU4 C;  5F99 A;  1P3K A;  5B1M C;  3AFA D;  5B32 A;  3AZE D;  5GXQ C;  4Z66 D;  3AN2 D;  5CPI A;  3NQJ B;  1S32 B;  3MGR D;  1P3P B;  3MGP B;  3C1B D;  5JRG D;  5B2I C;  2BYK B;  3X1U A;  3W96 C;  1KX5 D;  2HIO C;  3MGS A;  4R8P A;  1P3G D;  3AZJ B;  5E5A C;  1HQ3 A;  5B40 A;  5AV9 B;  1P3L D;  3WKJ D;  3REH C;  1U35 D;  4WU9 D;  3WAA D;  5G49 A;  4CAY A;  3X1S D;  1ID3 C;  5C3I B;  1P3O A;  3B6G B;  3AZL C;  1P3I C;  2HUE B;  5GSU A;  3B0D C;  1P3M B;  1EQZ C;  5B0Y D;  3REL B;  1H3O A;  3WA9 A;  3REI D;  4Z2M H;  3B6F D;  5DNM B;  5B33 D;  2NZD A;  5DNN B;  4J8V C;  1WWS A;  4YM6 C;  3UTB D;  4J8X B;  5CPK B;  3VH6 W;  5GT3 D;  4KGC D;  3AZG D;  3AZI B;  3W98 A;  1M1A D;  4UUZ B;  2ARO C;  5CP6 C;  3AV2 B;  3LZ0 C;  1TZY B;  3AZM D;  3MGQ B;  1P3B D;  3X1V C;  1F66 D;  3UTA B;  5B2J A;  5B1L D;  4H9S C;  4ZBJ C;  4WU8 D;  3LZ1 B;  5KDM B;  5B24 B;  4G92 B;  3KWQ C;  3AV1 B;  2NQB A;  1AOI C;  5AVB C;  2F8N H;  4ZUX B;  5F99 B;  5B32 B;  5GT0 A;  1M19 C;  5CPI B;  3LJA C;  3B0C W;  4NE6 A;  3AZN A;  3WTP B;  5AVC C;  3X1U B;  3NQJ A;  3MGS B;  3AZK C;  1P3P A;  1HQ3 B;  5B40 B;  3A6N A;  4LD9 A;  2BYK A;  3AZF C;  3AYW C;  4JJN C; 
#chains in the Genus database with same CATH topology
 5G49 B;  4Z5T C;  4CAY B;  3REJ C;  4HGA B;  1P3O B;  3O62 A;  4J8W B;  4YS3 A;  3W97 D;  2DF4 C;  3C1C D;  1BH8 A;  5GSU B;  3AFA C;  3TU4 A;  4Z66 C;  3AZE C;  3AN2 C;  3KSY A;  1H3O B;  3MGR C;  3REK B;  3WTP E;  3W99 D;  3C1B C;  3NQU B;  5JRG C;  5BNX A;  1P3M A;  3AZH D;  5B2I A;  1KX5 C;  3MGQ D;  2NZD B;  1P3G C;  3W96 A;  2HIO A;  2RVQ D;  3KXB D;  1PZR A;  5E5A A;  2IO5 C;  1P3L C;  3WKJ C;  1P3A B;  1U35 C;  2Y2M A;  4WU9 C;  3WAA C;  5BS7 A;  3KUY A;  3X1S C;  3W98 B;  2ZY2 A;  5AV8 A;  3R45 B;  2PYO B;  1ID3 A;  3AZI A;  3AZL A;  4DRA A;  1P3I A;  1B67 A;  5B0Y C;  4NE3 A;  4QLC D;  1P3K D;  1TZY A;  5AV6 D;  5B0Z D;  3REI C;  5B2J B;  3B6F C;  3LEL B;  5B33 C;  4J8V A;  3UTB C;  3X1U D;  5CPJ D;  2NQB B;  5B24 A;  4R8P D;  1HQ3 D;  5GT3 C;  4KGC C;  3AZG C;  3MVD D;  1M1A C;  5GT0 B;  3V9R A;  4J8U D;  3AZM C;  5CP6 A;  1P3B C;  3LZ0 A;  3AZN B;  4XZQ D;  1F66 C;  3P5J B;  4KUD D;  3X1V A;  1F1E A;  5JA4 A;  1M18 D;  1BH9 A;  5B1L C;  2J8P A;  3A6N B;  3WTP A;  2JE5 A;  4WU8 C;  3WA9 D;  4LD9 B;  4H9S A;  5AV5 D;  5B32 G;  3KWQ A;  3EPH A;  4DRB A;  3MNN D;  1AOI A;  5AVB A;  3O62 B;  5AY8 D;  2Y2N A;  4YS3 B;  1BH8 B;  3VH5 W;  3TU4 B;  3KFU G;  5B1M B;  5GXQ B;  2FFF B;  1M19 A;  1ZLA A;  4J8W A;  3A1K A;  4DQY B;  5BNX B;  4NE5 A;  5B2I B;  4XUJ D;  2Y2G A;  5AVC A;  3REK A;  3W96 B;  2HIO B;  4M6B A;  3AZK A;  3NQU A;  5E5A B;  1KX4 A;  3H0R C;  4JJN A;  3KUY B;  2CV5 D;  1P3A A;  5AV8 B;  3REJ A;  1ID3 B;  3AZL B;  2W8S A;  1P3I B;  3W97 C;  3C1C C;  4H9R B;  5B31 A;  4EO5 C;  4E45 A;  3AFA A;  3AN2 A;  3B0D B;  3R45 A;  4Z66 A;  2PYO A;  3X1T D;  3W99 C;  3H0L C;  5B31 G;  3C1B A;  3AZH C;  1KX3 D;  3MGQ C;  2FJ7 D;  4WNN A;  2RVQ C;  3KXB C;  4J8V B;  4YM6 B;  2YFV B;  1P3G A;  1S32 D;  3LEL A;  1P3P D;  5BT1 D;  3WKJ A;  5FUG B;  3MGP D;  2Y2J A;  1U35 A;  3X1S A;  4KHA B;  3V9R B;  3AZJ D;  5AV9 D;  2ARO B;  5CP6 B;  1P34 A;  3LZ0 B;  3X1V B;  3O62 D;  5JA4 B;  1P3F C;  4QLC C;  1P3K C;  5AV6 C;  5B0Z C;  1BH9 B;  1T3U A;  3REI A;  3B6G D;  4X23 A;  4ZBJ B;  3EG5 B;  3KWQ B;  1P3M D;  3X1U C;  3UT9 A;  5CPJ C;  4G91 C;  3REL D;  4R8P C;  1HQ3 C;  1KU5 A;  5AVB B;  1AOI B;  2ZY3 A;  5E5A D;  4AWL C;  5DNM D;  3MVD C;  5DNN D;  4J8U C;  3KUY D;  1M19 B;  1ZLA B;  3LJA B;  3AZM A;  4XZQ C;  4J8X D;  5AV8 D;  2Y2H A;  5CPK D;  1P3B A;  4KUD C;  4WZS B;  3AZI D;  5B1M A;  1M18 C;  1P3I D;  5GXQ A;  5AVC B;  1N1J B;  3AZK B;  2F8N A;  3WA9 C;  5B1L A;  3EPL A;  3AV2 D;  5AV5 C;  1KX4 B;  1TZY D;  4WU8 A;  3AZF B;  4JJN B;  4Z5T B;  2F8N G;  3UTA D;  2XD1 A;  3VH6 A;  3MNN C;  3REJ B;  3REH A;  5AY8 C;  3LZ1 D;  5B24 D;  5B31 B;  3AV1 D;  3AFA B;  3AN2 B;  4Z66 B;  3MGR B;  4CSR A;  4H9R A;  4ZUX D;  3VH6 T;  3C1B B;  1WWI A;  1TAF A;  5JRG B;  4XUJ C;  3LZ0 D;  1EQZ A;  4WNN B;  5F99 D;  1KX5 B;  5B32 D;  1P3G B;  5CPI D;  1P3L B;  3WKJ B;  1U35 B;  3WTP D;  4WU9 B;  3WAA B;  4YM6 A;  2YFV A;  2CV5 C;  3X1S B;  3F6T A;  3MGS D;  5FUG A;  5B40 D;  1P34 B;  3C1C A;  2Y2I A;  4KHA A;  5B0Y B;  3X1T C;  2ARO A;  3REI B;  1P3O D;  1KX3 C;  1ZLA D;  4X23 B;  3B6F B;  3B0B A;  2FJ7 C;  4J8W D;  5B33 B;  2BG1 A;  3AZH A;  5GSU D;  3UT9 B;  3KXB A;  3B0C T;  1S32 C;  3UTB B;  1P3P C;  3REK D;  5BT1 C;  3MGP C;  1JFI A;  2DQN C;  1KX4 D;  4KGC B;  3AZG B;  2L5A A;  2NZD D;  3AZJ C;  4H9Q A;  1M1A B;  5AV9 C;  5CHL B;  1Q9C A;  3AZM B;  1P3A D;  1P3B B;  1F66 B;  2F2A C;  1P3F A;  5B31 D;  2Y2L A;  4QLC A;  3LJA A;  3W98 D;  5AV6 A;  5B0Z A;  5C3I C;  3A1I A;  2F8N B;  3B6G C;  5B1L B;  2PYO D;  4WU8 B;  2HUE C;  4H9O A;  1N1J A;  2G5I C;  1P3M C;  3REL C;  2YFW B;  5CPJ A;  1R4V A;  5B2J D;  3REH B;  3AZF A;  3AYW A;  5DNM C;  3LEL D;  5DNN C;  4Z5T A;  3MVD A;  1A7W A;  5BS7 C;  3KUY C;  2JSS A;  2F8N K;  4H9N A;  4J8U A;  4CSR B;  2NQB D;  4J8X C;  5CPK C;  5AV8 C;  1B6W A;  4XZQ A;  2ZY4 A;  4NFT A;  1TAF B;  3AZI C;  4H9P A;  3AZE A;  1P34 D;  1EQZ B;  4KUD A;  1M18 A;  3MGR A;  5GT0 D;  3AV2 C;  1TZY C;  5JRG A;  5AV5 A;  2RIQ A;  2Y2O A;  3AZN D;  1KX5 A;  4X23 D;  3UTA C;  3EPJ A;  1P3L A;  3A6N D;  2Y2K A;  3MNN A;  3UT9 D;  4LD9 D;  5BO0 A;  3LZ1 C;  5AY8 A;  4WU9 A;  5B24 C;  3WAA A;  3W97 B;  4G92 C;  3C1C B;  3AV1 C;  4EO5 B;  4E44 A;  4ZUX C;  3W99 B;  4YS3 D;  5F99 C;  3AZH B;  5B0Y A;  4Z2M G;  4XUJ A;  4WV4 B;  5B32 C;  3TU4 D;  5B1M D;  5CPI C;  3KXB B;  5GXQ D;  3B6F A;  5BNV A;  5B33 A;  2F8N D;  3WTP C;  1JFI B;  2JCH A;  5B2I D;  3UTB A;  3MGS C;  2CV5 A;  3W96 D;  2HIO D;  4H9Q B;  5B40 C;  5GT3 A;  4KGC A;  3AZG A;  3VH5 A;  3REH D;  1BFM A;  2BYM A;  1M1A A;  1P3F B;  4QLC B;  1P3K B;  4HGA C;  5AV6 B;  5B0Z B;  2ZM5 A;  3X1T A;  1P3O C;  1ID3 D;  1ZLA C;  1F66 A;  4J8W C;  3AZL D;  1KX3 A;  4H9O B;  2FJ7 A;  3VH5 T;  5GSU C;  1EQZ D;  3REK C;  1HTA A;  5CPJ B;  4G91 B;  1S32 A;  4R8P B;  3MGP A;  3AYW B;  1KX4 C;  2NZD C;  4AWL B;  3MVD B;  4WJ3 C;  2YFW A;  3EPK A;  4J8V D;  4YM6 D;  4H9N B;  3AZJ A;  4J8U B;  5AV9 A;  1P3A C;  4XZQ B;  4KUD B;  4H9P B;  3AZE B;  5B31 C;  1M18 B;  3W98 C;  2PYO C;  3WA9 B;  3B6G A;  2ARO D;  5CP6 D;  5AV5 B;  2ZY5 A;  3X1V D;  3REL A;  2IO5 B;  5B2J C;  1ULY A;  3MNN B;  5BO0 B;  3LEL C;  5AY8 B;  5DNM A;  5DNN A;  3IP4 C;  3KWQ D;  2NQB C;  3W97 A;  4J8X A;  5AVB D;  5CPK A;  1AOI D;  1P34 C;  2CWE A;  4XUJ B;  5GT0 C;  3W99 A;  4UUZ A;  1P3F D;  1M19 D;  3LJA D;  3AV2 A;  2XD5 A;  5BNV B;  3AZN C;  3MGQ A;  4X23 C;  2LY8 A;  5AVC D;  3UTA A;  2CV5 B;  3A6N C;  3UT9 C;  3AZK D;  4LD9 C;  5GT3 B;  3H0M C;  5KDM A;  3LZ1 A;  3AZF D;  3AYW D;  4JJN D;  3AV1 A;  2BYM B;  4Z5T D;  3X1T B;  3REJ D;  3O62 C;  4ZUX A;  3AL0 C;  4YS3 C;  1KX3 B;  2FJ7 B;  3TU4 C;  5F99 A;  1P3K A;  5B1M C;  3AFA D;  5B32 A;  3AZE D;  5GXQ C;  4Z66 D;  3AN2 D;  5CPI A;  3NQJ B;  1S32 B;  3MGR D;  1Z2C B;  1P3P B;  3MGP B;  3C1B D;  5JRG D;  5B2I C;  2BYK B;  3X1U A;  3W96 C;  1KX5 D;  2HIO C;  3MGS A;  4R8P A;  1P3G D;  3AZJ B;  5E5A C;  1HQ3 A;  5B40 A;  5AV9 B;  1P3L D;  3WKJ D;  3REH C;  2Y2P A;  1U35 D;  2Y2Q A;  4WU9 D;  3WAA D;  5G49 A;  4CAY A;  3FDD A;  3X1S D;  1ID3 C;  5C3I B;  1P3O A;  3B6G B;  3AZL C;  1P3I C;  2HUE B;  5GSU A;  3B0D C;  1P3M B;  1EQZ C;  5B0Y D;  3REL B;  1H3O A;  3WA9 A;  2UWX A;  3REI D;  4Z2M H;  3B6F D;  5DNM B;  5B33 D;  2NZD A;  5DNN B;  4J8V C;  1WWS A;  4YM6 C;  4UPK A;  3UTB D;  4J8X B;  5CPK B;  3VH6 W;  5GT3 D;  4KGC D;  3AZG D;  3AZI B;  3W98 A;  1M1A D;  4UUZ B;  2ARO C;  5CP6 C;  3AV2 B;  3LZ0 C;  1TZY B;  3AZM D;  3MGQ B;  1P3B D;  3X1V C;  1F66 D;  2G5H C;  3UTA B;  5B2J A;  5B1L D;  4H9S C;  4ZBJ C;  4WU8 D;  3LZ1 B;  5KDM B;  5B24 B;  4G92 B;  3KWQ C;  3AV1 B;  2NQB A;  1AOI C;  2VQR A;  5AVB C;  2F8N H;  4ZUX B;  1W2E A;  5F99 B;  5B32 B;  5GT0 A;  1M19 C;  5CPI B;  3LJA C;  3B0C W;  4NE6 A;  3AZN A;  3WTP B;  5AVC C;  3X1U B;  3NQJ A;  3MGS B;  3AZK C;  1P3P A;  1HQ3 B;  5B40 B;  3A6N A;  4LD9 A;  2BYK A;  3AZF C;  3AYW C;  4JJN C; 
#chains in the Genus database with same CATH homology
 5G49 B;  4Z5T C;  4CAY B;  3REJ C;  4HGA B;  1P3O B;  3O62 A;  4J8W B;  4YS3 A;  3W97 D;  2DF4 C;  3C1C D;  1BH8 A;  5GSU B;  3AFA C;  3TU4 A;  4Z66 C;  3AZE C;  3AN2 C;  3KSY A;  1H3O B;  3MGR C;  3REK B;  3WTP E;  3W99 D;  3C1B C;  3NQU B;  5JRG C;  5BNX A;  1P3M A;  3AZH D;  5B2I A;  1KX5 C;  3MGQ D;  2NZD B;  1P3G C;  3W96 A;  2HIO A;  2RVQ D;  3KXB D;  1PZR A;  5E5A A;  2IO5 C;  1P3L C;  3WKJ C;  1P3A B;  1U35 C;  2Y2M A;  4WU9 C;  3WAA C;  5BS7 A;  3KUY A;  3X1S C;  3W98 B;  2ZY2 A;  5AV8 A;  3R45 B;  2PYO B;  1ID3 A;  3AZI A;  3AZL A;  4DRA A;  1P3I A;  1B67 A;  5B0Y C;  4NE3 A;  4QLC D;  1P3K D;  1TZY A;  5AV6 D;  5B0Z D;  3REI C;  5B2J B;  3B6F C;  3LEL B;  5B33 C;  4J8V A;  3UTB C;  3X1U D;  5CPJ D;  2NQB B;  5B24 A;  4R8P D;  1HQ3 D;  5GT3 C;  4KGC C;  3AZG C;  3MVD D;  1M1A C;  5GT0 B;  3V9R A;  4J8U D;  3AZM C;  5CP6 A;  1P3B C;  3LZ0 A;  3AZN B;  4XZQ D;  1F66 C;  3P5J B;  4KUD D;  3X1V A;  1F1E A;  5JA4 A;  1M18 D;  1BH9 A;  5B1L C;  2J8P A;  3A6N B;  3WTP A;  2JE5 A;  4WU8 C;  3WA9 D;  4LD9 B;  4H9S A;  5AV5 D;  5B32 G;  3KWQ A;  3EPH A;  4DRB A;  3MNN D;  1AOI A;  5AVB A;  3O62 B;  5AY8 D;  2Y2N A;  4YS3 B;  1BH8 B;  3VH5 W;  3TU4 B;  3KFU G;  5B1M B;  5GXQ B;  2FFF B;  1M19 A;  1ZLA A;  4J8W A;  3A1K A;  4DQY B;  5BNX B;  4NE5 A;  5B2I B;  4XUJ D;  2Y2G A;  5AVC A;  3REK A;  3W96 B;  2HIO B;  4M6B A;  3AZK A;  3NQU A;  5E5A B;  1KX4 A;  3H0R C;  4JJN A;  3KUY B;  2CV5 D;  1P3A A;  5AV8 B;  3REJ A;  1ID3 B;  3AZL B;  2W8S A;  1P3I B;  3W97 C;  3C1C C;  4H9R B;  5B31 A;  4EO5 C;  4E45 A;  3AFA A;  3AN2 A;  3B0D B;  3R45 A;  4Z66 A;  2PYO A;  3X1T D;  3W99 C;  3H0L C;  5B31 G;  3C1B A;  3AZH C;  1KX3 D;  3MGQ C;  2FJ7 D;  4WNN A;  2RVQ C;  3KXB C;  4J8V B;  4YM6 B;  2YFV B;  1P3G A;  1S32 D;  3LEL A;  1P3P D;  5BT1 D;  3WKJ A;  5FUG B;  3MGP D;  2Y2J A;  1U35 A;  3X1S A;  4KHA B;  3V9R B;  3AZJ D;  5AV9 D;  2ARO B;  5CP6 B;  1P34 A;  3LZ0 B;  3X1V B;  3O62 D;  5JA4 B;  1P3F C;  4QLC C;  1P3K C;  5AV6 C;  5B0Z C;  1BH9 B;  1T3U A;  3REI A;  3B6G D;  4X23 A;  4ZBJ B;  3EG5 B;  3KWQ B;  1P3M D;  3X1U C;  3UT9 A;  5CPJ C;  4G91 C;  3REL D;  4R8P C;  1HQ3 C;  1KU5 A;  5AVB B;  1AOI B;  2ZY3 A;  5E5A D;  4AWL C;  5DNM D;  3MVD C;  5DNN D;  4J8U C;  3KUY D;  1M19 B;  1ZLA B;  3LJA B;  3AZM A;  4XZQ C;  4J8X D;  5AV8 D;  2Y2H A;  5CPK D;  1P3B A;  4KUD C;  4WZS B;  3AZI D;  5B1M A;  1M18 C;  1P3I D;  5GXQ A;  5AVC B;  1N1J B;  3AZK B;  2F8N A;  3WA9 C;  5B1L A;  3EPL A;  3AV2 D;  5AV5 C;  1KX4 B;  1TZY D;  4WU8 A;  3AZF B;  4JJN B;  4Z5T B;  2F8N G;  3UTA D;  2XD1 A;  3VH6 A;  3MNN C;  3REJ B;  3REH A;  5AY8 C;  3LZ1 D;  5B24 D;  5B31 B;  3AV1 D;  3AFA B;  3AN2 B;  4Z66 B;  3MGR B;  4CSR A;  4H9R A;  4ZUX D;  3VH6 T;  3C1B B;  1WWI A;  1TAF A;  5JRG B;  4XUJ C;  3LZ0 D;  1EQZ A;  4WNN B;  5F99 D;  1KX5 B;  5B32 D;  1P3G B;  5CPI D;  1P3L B;  3WKJ B;  1U35 B;  3WTP D;  4WU9 B;  3WAA B;  4YM6 A;  2YFV A;  2CV5 C;  3X1S B;  3F6T A;  3MGS D;  5FUG A;  5B40 D;  1P34 B;  3C1C A;  2Y2I A;  4KHA A;  5B0Y B;  3X1T C;  2ARO A;  3REI B;  1P3O D;  1KX3 C;  1ZLA D;  4X23 B;  3B6F B;  3B0B A;  2FJ7 C;  4J8W D;  5B33 B;  2BG1 A;  3AZH A;  5GSU D;  3UT9 B;  3KXB A;  3B0C T;  1S32 C;  3UTB B;  1P3P C;  3REK D;  5BT1 C;  3MGP C;  1JFI A;  2DQN C;  1KX4 D;  4KGC B;  3AZG B;  2L5A A;  2NZD D;  3AZJ C;  4H9Q A;  1M1A B;  5AV9 C;  5CHL B;  1Q9C A;  3AZM B;  1P3A D;  1P3B B;  1F66 B;  2F2A C;  1P3F A;  5B31 D;  2Y2L A;  4QLC A;  3LJA A;  3W98 D;  5AV6 A;  5B0Z A;  5C3I C;  3A1I A;  2F8N B;  3B6G C;  5B1L B;  2PYO D;  4WU8 B;  2HUE C;  4H9O A;  1N1J A;  2G5I C;  1P3M C;  3REL C;  2YFW B;  5CPJ A;  1R4V A;  5B2J D;  3REH B;  3AZF A;  3AYW A;  5DNM C;  3LEL D;  5DNN C;  4Z5T A;  3MVD A;  1A7W A;  5BS7 C;  3KUY C;  2JSS A;  2F8N K;  4H9N A;  4J8U A;  4CSR B;  2NQB D;  4J8X C;  5CPK C;  5AV8 C;  1B6W A;  4XZQ A;  2ZY4 A;  4NFT A;  1TAF B;  3AZI C;  4H9P A;  3AZE A;  1P34 D;  1EQZ B;  4KUD A;  1M18 A;  3MGR A;  5GT0 D;  3AV2 C;  1TZY C;  5JRG A;  5AV5 A;  2RIQ A;  2Y2O A;  3AZN D;  1KX5 A;  4X23 D;  3UTA C;  3EPJ A;  1P3L A;  3A6N D;  2Y2K A;  3MNN A;  3UT9 D;  4LD9 D;  5BO0 A;  3LZ1 C;  5AY8 A;  4WU9 A;  5B24 C;  3WAA A;  3W97 B;  4G92 C;  3C1C B;  3AV1 C;  4EO5 B;  4E44 A;  4ZUX C;  3W99 B;  4YS3 D;  5F99 C;  3AZH B;  5B0Y A;  4Z2M G;  4XUJ A;  4WV4 B;  5B32 C;  3TU4 D;  5B1M D;  5CPI C;  3KXB B;  5GXQ D;  3B6F A;  5BNV A;  5B33 A;  2F8N D;  3WTP C;  1JFI B;  2JCH A;  5B2I D;  3UTB A;  3MGS C;  2CV5 A;  3W96 D;  2HIO D;  4H9Q B;  5B40 C;  5GT3 A;  4KGC A;  3AZG A;  3VH5 A;  3REH D;  1BFM A;  2BYM A;  1M1A A;  1P3F B;  4QLC B;  1P3K B;  4HGA C;  5AV6 B;  5B0Z B;  2ZM5 A;  3X1T A;  1P3O C;  1ID3 D;  1ZLA C;  1F66 A;  4J8W C;  3AZL D;  1KX3 A;  4H9O B;  2FJ7 A;  3VH5 T;  5GSU C;  1EQZ D;  3REK C;  1HTA A;  5CPJ B;  4G91 B;  1S32 A;  4R8P B;  3MGP A;  3AYW B;  1KX4 C;  2NZD C;  4AWL B;  3MVD B;  4WJ3 C;  2YFW A;  3EPK A;  4J8V D;  4YM6 D;  4H9N B;  3AZJ A;  4J8U B;  5AV9 A;  1P3A C;  4XZQ B;  4KUD B;  4H9P B;  3AZE B;  5B31 C;  1M18 B;  3W98 C;  2PYO C;  3WA9 B;  3B6G A;  2ARO D;  5CP6 D;  5AV5 B;  2ZY5 A;  3X1V D;  3REL A;  2IO5 B;  5B2J C;  1ULY A;  3MNN B;  5BO0 B;  3LEL C;  5AY8 B;  5DNM A;  5DNN A;  3IP4 C;  3KWQ D;  2NQB C;  3W97 A;  4J8X A;  5AVB D;  5CPK A;  1AOI D;  1P34 C;  2CWE A;  4XUJ B;  5GT0 C;  3W99 A;  4UUZ A;  1P3F D;  1M19 D;  3LJA D;  3AV2 A;  2XD5 A;  5BNV B;  3AZN C;  3MGQ A;  4X23 C;  2LY8 A;  5AVC D;  3UTA A;  2CV5 B;  3A6N C;  3UT9 C;  3AZK D;  4LD9 C;  5GT3 B;  3H0M C;  5KDM A;  3LZ1 A;  3AZF D;  3AYW D;  4JJN D;  3AV1 A;  2BYM B;  4Z5T D;  3X1T B;  3REJ D;  3O62 C;  4ZUX A;  3AL0 C;  4YS3 C;  1KX3 B;  2FJ7 B;  3TU4 C;  5F99 A;  1P3K A;  5B1M C;  3AFA D;  5B32 A;  3AZE D;  5GXQ C;  4Z66 D;  3AN2 D;  5CPI A;  3NQJ B;  1S32 B;  3MGR D;  1Z2C B;  1P3P B;  3MGP B;  3C1B D;  5JRG D;  5B2I C;  2BYK B;  3X1U A;  3W96 C;  1KX5 D;  2HIO C;  3MGS A;  4R8P A;  1P3G D;  3AZJ B;  5E5A C;  1HQ3 A;  5B40 A;  5AV9 B;  1P3L D;  3WKJ D;  3REH C;  2Y2P A;  1U35 D;  2Y2Q A;  4WU9 D;  3WAA D;  5G49 A;  4CAY A;  3FDD A;  3X1S D;  1ID3 C;  5C3I B;  1P3O A;  3B6G B;  3AZL C;  1P3I C;  2HUE B;  5GSU A;  3B0D C;  1P3M B;  1EQZ C;  5B0Y D;  3REL B;  1H3O A;  3WA9 A;  2UWX A;  3REI D;  4Z2M H;  3B6F D;  5DNM B;  5B33 D;  2NZD A;  5DNN B;  4J8V C;  1WWS A;  4YM6 C;  4UPK A;  3UTB D;  4J8X B;  5CPK B;  3VH6 W;  5GT3 D;  4KGC D;  3AZG D;  3AZI B;  3W98 A;  1M1A D;  4UUZ B;  2ARO C;  5CP6 C;  3AV2 B;  3LZ0 C;  1TZY B;  3AZM D;  3MGQ B;  1P3B D;  3X1V C;  1F66 D;  2G5H C;  3UTA B;  5B2J A;  5B1L D;  4H9S C;  4ZBJ C;  4WU8 D;  3LZ1 B;  5KDM B;  5B24 B;  4G92 B;  3KWQ C;  3AV1 B;  2NQB A;  1AOI C;  2VQR A;  5AVB C;  2F8N H;  4ZUX B;  1W2E A;  5F99 B;  5B32 B;  5GT0 A;  1M19 C;  5CPI B;  3LJA C;  3B0C W;  4NE6 A;  3AZN A;  3WTP B;  5AVC C;  3X1U B;  3NQJ A;  3MGS B;  3AZK C;  1P3P A;  1HQ3 B;  5B40 B;  3A6N A;  4LD9 A;  2BYK A;  3AZF C;  3AYW C;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...