3REJB

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejB00
2L5AA 5B32D 3X1SC 3RELC 3AZFB 5AVCB 1P3BA 4J8XA 4NE3A 4YM6C 4G91B 3O62A 4AWLC 5B0YA 2CWEA 5B2IC 2YFVA 4J8XD 3REJA 1M19B 5GSUA 3KSYA 1HTAA 4CAYA 3O62D 4J8XB 1P3BB 4H9OB 5B0YD 3MGRC 3O62B 3REJD 5GSUD 5B0YB 5F99C 2YFVB 3REJB 1R4VA 1TZYA 5GSUB 3AV2A 5GT0C 1KX3C 4YS3C 4CAYB 4HGAB 5B0ZA 2AROC 1TZYD 3AV2D 2FJ7C 3KUYA 3B0DC 4J8VA 5JRGA 1TZYB 3AV2B 4R8PA 3LZ0C 3W97A 3RELD 3KUYD 3X1UA 3WKJC 5B0ZB 4J8VD 1BH8A 4YM6D 2HIOC 3KUYB 3B0BA 1EQZA 4J8VB 3W97D 5B2ID 4YM6B 3W97B 3MNNA 5B2IB 3X1UB 1EQZD 1BH8B 4NFTA 1U35A 3AZLA 1P3AA 1P34A 1EQZB 1P3MA 3NQUA 3AFAA 2F8NK 3MGQA 3LZ1A 3MNNB 4H9QB 4XUJC 2NQBA 1P3AD 5BT1C 3WTPA 3AFAD 1P3MD 4KGCC 3MGQD 1P3LA 3AZEA 4EO5B 1P3AB 1P3MB 3NQUB 3AFAB 5AV9C 3MGQB 1WWSA 3LELC 1ID3A 2NQBD 5CPJC 2RVQC 1S32A 2NZDC 3LZ1B 1P3LD 3UT9C 2NQBB 3AZED 3AYWC 5CPKC 1P3LB 3WKJD 3AZEB 5B40C 5DNMA 1S32D 4M6BA 4LD9A 2HIOD 4H9SC 3B6GA 1ID3B 2F8NA 1M1AA 1S32B 3W96A 3REHA 4Z66A 5CP6C 4H9NA 3X1TC 3VH6W 5DNMD 3B0CW 1KX4C 5B31A 5CHLB 3B6GD 4QLCA 5B24C 3AZIA 1M18A 4ZUXC 5DNMB 2HUEB 3AZGC 1M1AD 3W96D 4LD9B 3REHD 3B6GB 4Z66D 3A6NA 1M1AB 3C1BC 5B33A 3W96B 5B31D 3REHB 2PYOC 5AVBA 4Z66B 4H9NB 1M18D 4XUJD 5B31B 3MGPA 4WU9C 5CPIA 5BT1D 3A6ND 1P3FA 1N1JB 3AZHC 4WU8A 1M18B 3VH6T 5B33D 2NZDA 5B32A 3B0CT 5C3IC 3NQJA 3A6NB 4G92B 3AZJA 1P3PC 5B33B 2BYKA 3MGPD 5AVBB 5CPID 2RVQD 1P3FD 2NZDD 4WU8D 3AZKA 3MGPB 5CPIB 3AYWD 1P3FB 3AZJD 4WU8B 5CPKD 2NZDB 4H9OA 4Z5TC 5B32B 3NQJB 3AZJB 5CPKB 3TU4C 2BYKB 3AZKD 5E5AA 3KWQA 2F8NG 3AZKB 5JA4A 3KXBA 3MGSA 5BNXA 5AY8A 1KX4D 3WAAA 5E5AD 3KWQD 5AV5C 5GT3C 1P3IC 4H9PA 4Z2MH 5B1LC 3C1BD 3KXBD 3MGSD 5AY8D 5E5AB 3KWQB 1HQ3C 4J8UC 3AZMC 3WAAD 5JA4B 3C1BB 3KXBB 3W99C 5BNXB 5AY8B 3MGSB 1P3OA 3WAAB 5GXQA 3REKC 2CV5C 3X1SA 3RELA 4H9PB 4YM6A 3WA9C 1P3OD 5GXQD 3X1SD 5B2IA 3C1CC 1P3OB 5GXQB 5FUGA 3X1SB 3RELB 1P3KC 3UTBC 4UUZA 5AV8C 3TU4D 3UTAC 2LY8A 3MGRA 3MVDC 3AZNC 5DNNC 4AWLB 3TU4B 4H9QA 5F99A 4J8WC 3X1VC 5B2JC 2IO5C 5AV6C 5FUGB 5GT0A 1KX3A 3MGRD 4YS3A 4UUZB 4H9RA 5AV5D 3VH5A 1ZLAC 5F99D 3MGRB 2AROA 3REIC 2FJ7A 5B1MC 5GT0D 1KX3D 5F99B 1AOIC 3R45A 4YS3D 3W99D 4XZQC 5GT0B 1P3GC 1KX3B 4YS3B 3LZ0A 2AROD 2CV5D 4X23C 4H9RB 4JJNC 3AN2C 2FJ7D 3WKJA 3B6FC 2AROB 1KX5C 3AV1C 2FJ7B 3LJAC 2HIOA 4KUDC 3R45B 3B0DB 3LZ0D 1B6WA 4CSRA 1KU5A 1BH9B 3LZ0B 1F66C 3UTBD 3WKJB 3UTAD 2HIOB 3MVDD 2JSSA 4CSRB 3UTAB 4J8WD 3AZFC 5AVCC 3MVDB 3W98C 1N1JA 4XUJA 5BS7C 4J8WB 4KGCA 1ZLAD 4DRAA 3REID 1M19C 5AV9A 1ZLAB 3LELA 5CPJA 1P3BC 4J8XC 3REIB 4KGCD 4XZQD 3UT9A 4XUJB 4X23D 3O62C 3AYWA 3AN2D 5AV9D 5CPKA 4XZQB 4KGCB 5B0YC 3LELD 5CPJD 5B40A 1JFIA 3AV1D 3REJC 3AN2B 5AV9B 5GSUC 3UT9D 4KUDD 4H9SA 3LELB 5G49A 5CPJB 4WZSB 3AV1B 3UT9B 4HGAC 5CP6A 3X1TA 5B40D 4E45A 1F66D 3AYWB 1KX4A 5BNVA 5B24A 5B40B 4ZUXA 1JFIB 3AZGA 1TZYC 3AV2C 5G49B 5CP6D 3X1TD 3C1BA 5KDMA 1BFMA 2PYOA 2BYMA 5B24D 5CP6B 5B0ZC 3X1TB 3W98D 4ZUXD 5B31G 3AZGD 1KX4B 4WU9A 5BNVB 3KUYC 5B24B 3W98B 3AZHA 4ZUXB 4J8VC 3AZGB 5JRGC 2PYOD 4R8PC 1M19D 1P3PA 3W97C 5KDMB 4WU9D 2PYOB 3X1UC 2BYMB 1P3BD 3AZHD 4WU9B 1EQZC 3AZHB 1P3PD 5B32G 4Z5TA 5C3IB 1P3PB 3TU4A 3MNNC 1H3OA 4NE6A 3WTPE 4Z5TD 1A7WA 1U35C 4EO5C 3AZLC 1P3AC 1P34C 1P3MC 3AFAC 3MGQC 4Z5TB 1ULYA 1Q9CA 5AV5A 3LZ1C 5GT3A 1P3IA 2NQBC 5B1LA 1H3OB 3WTPC 1B67A 1HQ3A 1P3LC 4J8UA 3V9RA 3AZMA 5B0ZD 3AZEC 3W99A 1F1EA 4ZBJC 5GT3D 1P3ID 1ID3C 5B1LD 3REKA 2CV5A 1S32C 5JRGD 1HQ3D 3VH5W 5GT3B 5AV5B 4R8PD 4J8UD 3AZMD 1P3IB 5B1LB 5JRGB 1HQ3B 3X1UD 3V9RB 4R8PB 4J8UB 3AZMB 3WA9A 3REKD 1BH9A 5DNMC 3W99B 2HUEC 4LD9C 3C1CA 2F8NH 3B6GC 3REKB 4KHAA 2YFWA 2CV5B 1M1AC 3W96C 1P3KA 3REHC 3WA9D 3UTBA 4Z66C 5AV8A 3MNND 3UTAA 5B31C 3C1CD 3VH5T 3WA9B 4QLCC 3MVDA 3AZIC 3AZNA 5DNNA 1M18C 1P3KD 4J8WA 3C1CB 3AZLD 1U35D 3X1VA 1P34D 5AV8D 4KHAB 5B2JA 2YFWB 3A6NC 4G92C 5AV6A 5B33C 1TAFA 1P3KB 1U35B 5AVBC 3UTBB 3AZLB 1P34B 5AV8B 3AZND 5DNND 3LZ1D 1ZLAA 3MGPC 5CPIC 3X1VD 3WTPD 5B2JD 3AZNB 5DNNB 3REIA 5AV6D 4WU8C 1P3FC 4E44A 5B1MA 4Z2MG 5B32C 1AOIA 3X1VB 4WNNA 4G91C 3WTPB 5B2JB 2IO5B 3AZJC 5AV6B 4XZQA 1TAFB 1P3GA 4NE5A 1ID3D 4X23A 4ZBJB 4JJNA 3AN2A 5BO0A 5B1MD 1AOID 3AZKC 3B6FA 3VH6A 1KX5A 3AV1A 3LJAA 4KUDA 5B1MB 1P3GD 1AOIB 4WNNB 4WV4B 4JJND 4LD9D 1P3GB 2F8ND 3B6FD 1F66A 1KX5D 4X23B 4DRBA 4JJNB 5E5AC 3KWQC 3LJAD 5BO0B 2F8NB 3B6FB 1KX5B 3KXBC 3MGSC 5AY8C 3LJAB 4KUDB 4QLCD 3WAAC 3AZID 3AZFA 5AVCA 4QLCB 3AZIB 3W98A 1WWIA 1F66B 5BS7A 5AVBD 3AZFD 5AVCD 1P3OC 5GXQC 1M19A
chains in the Genus database with same CATH superfamily
2L5AA 5B32D 3X1SC 3RELC 3AZFB 5AVCB 2VQRA 1P3BA 4J8XA 2Y2LA 4NE3A 4YM6C 4G91B 3O62A 4AWLC 5B0YA 2CWEA 5B2IC 2YFVA 4J8XD 3REJA 1M19B 5GSUA 3KSYA 1HTAA 4CAYA 3O62D 4J8XB 1P3BB 4H9OB 5B0YD 3MGRC 3O62B 3REJD 5GSUD 5B0YB 1T3UA 5F99C 2YFVB 3REJB 1R4VA 1TZYA 5GSUB 3AV2A 5GT0C 1KX3C 4YS3C 4CAYB 4HGAB 5B0ZA 2AROC 1TZYD 3AV2D 2FJ7C 3KUYA 3B0DC 4J8VA 5JRGA 1TZYB 3H0MC 3AV2B 4R8PA 3LZ0C 3W97A 3RELD 2W8SA 3KUYD 2ZY5A 3X1UA 3WKJC 5B0ZB 1PZRA 4J8VD 3A1IA 1BH8A 4YM6D 2HIOC 3KUYB 2Y2OA 3B0BA 1EQZA 4J8VB 3W97D 5B2ID 4YM6B 3W97B 3MNNA 5B2IB 3X1UB 1EQZD 1BH8B 4NFTA 1U35A 3AZLA 1P3AA 1P34A 1EQZB 1P3MA 3NQUA 3AFAA 2F8NK 3MGQA 3LZ1A 3MNNB 4H9QB 4XUJC 2NQBA 1P3AD 5BT1C 3WTPA 3AFAD 1P3MD 4KGCC 3MGQD 1P3LA 3AZEA 4EO5B 1P3AB 1P3MB 3NQUB 3AFAB 5AV9C 3MGQB 1WWSA 2Y2KA 3LELC 1ID3A 2NQBD 5CPJC 2RVQC 1S32A 2NZDC 3LZ1B 1P3LD 3UT9C 2DQNC 2NQBB 3AZED 3AYWC 5CPKC 1P3LB 3WKJD 3AZEB 5B40C 5DNMA 1S32D 4M6BA 4LD9A 2HIOD 4H9SC 3B6GA 1ID3B 2F8NA 1M1AA 1S32B 3W96A 3REHA 2F2AC 4Z66A 5CP6C 4H9NA 3X1TC 3VH6W 5DNMD 3B0CW 1KX4C 5B31A 5CHLB 3B6GD 4QLCA 5B24C 3AZIA 1M18A 4ZUXC 5DNMB 2HUEB 3AZGC 1M1AD 3W96D 4LD9B 3REHD 3B6GB 4Z66D 3A6NA 1M1AB 3C1BC 5B33A 3W96B 2Y2QA 5B31D 3REHB 2PYOC 5AVBA 4Z66B 4H9NB 1M18D 3IP4C 2ZY2A 4XUJD 5B31B 3MGPA 2ZM5A 4WU9C 5BT1D 5CPIA 3A6ND 1P3FA 1N1JB 3AZHC 4WU8A 1M18B 3VH6T 2G5IC 5B33D 2NZDA 4WJ3C 5B32A 3B0CT 5C3IC 3NQJA 3A6NB 4G92B 3AZJA 1P3PC 5B33B 2BYKA 3MGPD 5AVBB 5CPID 2RVQD 1P3FD 2NZDD 4WU8D 3AZKA 3MGPB 5CPIB 2JE5A 3AYWD 1P3FB 3AZJD 4WU8B 5CPKD 2NZDB 4H9OA 4Z5TC 5B32B 3H0RC 3AL0C 3NQJB 3AZJB 5CPKB 3TU4C 2BYKB 3AZKD 5E5AA 3KWQA 2F8NG 1P3FC 2XD5A 3AZKB 3EPHA 5JA4A 3KXBA 3MGSA 5BNXA 5AY8A 1KX4D 3WAAA 2BG1A 4UPKA 5E5AD 3KWQD 5AV5C 5GT3C 1P3IC 4H9PA 4Z2MH 5B1LC 2Y2NA 3C1BD 3KXBD 3MGSD 5AY8D 5E5AB 3KWQB 1HQ3C 4J8UC 3AZMC 3WAAD 5JA4B 3C1BB 3KXBB 3W99C 5BNXB 5AY8B 3MGSB 1P3OA 3WAAB 5GXQA 3REKC 2CV5C 3X1SA 3RELA 4H9PB 2XD1A 4YM6A 3WA9C 1P3OD 5GXQD 3X1SD 5B2IA 3C1CC 1P3OB 5GXQB 5FUGA 3X1SB 3RELB 1P3KC 3UTBC 4UUZA 5AV8C 3TU4D 3UTAC 2LY8A 3MGRA 3MVDC 2UWXA 3AZNC 5DNNC 4AWLB 3TU4B 4H9QA 5F99A 4J8WC 3X1VC 5B2JC 2IO5C 5AV6C 5FUGB 5GT0A 1KX3A 3MGRD 4YS3A 4UUZB 2Y2GA 4H9RA 5AV5D 3VH5A 1ZLAC 5F99D 3FDDA 3MGRB 3EPLA 2AROA 3REIC 2FJ7A 5B1MC 5GT0D 1KX3D 5F99B 1AOIC 3R45A 4YS3D 3W99D 4XZQC 5GT0B 1P3GC 1KX3B 3P5JB 4YS3B 3LZ0A 2AROD 2CV5D 4X23C 4H9RB 4JJNC 3AN2C 2FJ7D 3WKJA 3A1KA 3B6FC 3EG5B 2AROB 1KX5C 3AV1C 2FJ7B 3LJAC 2HIOA 4KUDC 3R45B 3B0DB 3LZ0D 1B6WA 2Y2IA 4CSRA 1KU5A 1BH9B 3LZ0B 1F66C 3KFUG 3UTBD 3WKJB 3UTAD 2HIOB 3MVDD 2JSSA 4CSRB 3UTAB 4J8WD 3AZFC 2Y2HA 5AVCC 2RIQA 3MVDB 3W98C 1N1JA 1Z2CB 4XUJA 5BS7C 4J8WB 3EPJA 4KGCA 1ZLAD 4DRAA 3REID 1M19C 5AV9A 1ZLAB 2Y2JA 3LELA 5CPJA 1P3BC 4J8XC 3REIB 4KGCD 4XZQD 3UT9A 4XUJB 4X23D 3O62C 3AYWA 3AN2D 5AV9D 5CPKA 4XZQB 4KGCB 5B0YC 3LELD 5CPJD 5B40A 1JFIA 3AV1D 3REJC 3AN2B 5AV9B 5GSUC 3UT9D 4KUDD 4H9SA 3LELB 5G49A 5CPJB 4WZSB 4DQYB 3AV1B 2JCHA 3UT9B 4HGAC 5CP6A 3X1TA 5B40D 4E45A 1F66D 3AYWB 1KX4A 5BNVA 5B24A 5B40B 4ZUXA 1JFIB 3AZGA 1TZYC 3AV2C 5G49B 5CP6D 3X1TD 3C1BA 5KDMA 2FFFB 1BFMA 2PYOA 2BYMA 5B24D 5CP6B 5B0ZC 3X1TB 3W98D 4ZUXD 5B31G 3AZGD 1KX4B 4WU9A 5BNVB 3KUYC 5B24B 3W98B 3AZHA 4ZUXB 4J8VC 3AZGB 5JRGC 2PYOD 4R8PC 1M19D 1P3PA 3W97C 5KDMB 4WU9D 2PYOB 3X1UC 2BYMB 1P3BD 3AZHD 4WU9B 1EQZC 3AZHB 1P3PD 5B32G 4Z5TA 5C3IB 1P3PB 3TU4A 3MNNC 1H3OA 4NE6A 3WTPE 4Z5TD 2DF4C 1A7WA 1U35C 4EO5C 3AZLC 1P3AC 1P34C 1P3MC 3AFAC 3MGQC 4Z5TB 1ULYA 1Q9CA 5AV5A 3LZ1C 5GT3A 1P3IA 2NQBC 2G5HC 5B1LA 1H3OB 2Y2PA 3WTPC 1B67A 1HQ3A 1P3LC 4J8UA 3V9RA 3AZMA 5B0ZD 3AZEC 3W99A 1F1EA 4ZBJC 5GT3D 1P3ID 1ID3C 5B1LD 3REKA 2CV5A 1S32C 5JRGD 1HQ3D 3VH5W 5GT3B 5AV5B 4R8PD 4J8UD 3AZMD 1P3IB 5B1LB 5JRGB 2J8PA 1HQ3B 3X1UD 3V9RB 4R8PB 4J8UB 3AZMB 3WA9A 3REKD 1BH9A 5DNMC 3W99B 2HUEC 4LD9C 3C1CA 2F8NH 3F6TA 3B6GC 3REKB 4KHAA 2YFWA 2CV5B 1M1AC 3W96C 1P3KA 3REHC 3WA9D 3UTBA 4Z66C 5AV8A 3MNND 3UTAA 5B31C 3C1CD 3VH5T 3WA9B 4QLCC 3MVDA 3AZIC 3AZNA 5DNNA 1M18C 1P3KD 4J8WA 3C1CB 3AZLD 1U35D 3X1VA 1P34D 5AV8D 4KHAB 5B2JA 2YFWB 3A6NC 4G92C 5AV6A 5B33C 1TAFA 1P3KB 1U35B 5AVBC 3UTBB 3AZLB 1P34B 5AV8B 3AZND 5DNND 3LZ1D 1ZLAA 3MGPC 5CPIC 3X1VD 3EPKA 3WTPD 5B2JD 3AZNB 5DNNB 3REIA 5AV6D 1W2EA 4WU8C 4E44A 5B1MA 4Z2MG 5B32C 1AOIA 2ZY4A 3X1VB 4WNNA 4G91C 3WTPB 5B2JB 2IO5B 3AZJC 5AV6B 4XZQA 1TAFB 1P3GA 4NE5A 1ID3D 4X23A 4ZBJB 4JJNA 3AN2A 5BO0A 5B1MD 1AOID 3AZKC 3B6FA 3VH6A 1KX5A 3AV1A 3LJAA 4KUDA 5B1MB 1P3GD 1AOIB 4WNNB 4WV4B 4JJND 4LD9D 1P3GB 2F8ND 3B6FD 1F66A 1KX5D 4X23B 4DRBA 4JJNB 5E5AC 3KWQC 3LJAD 5BO0B 2F8NB 3B6FB 1KX5B 3KXBC 3MGSC 5AY8C 3LJAB 4KUDB 4QLCD 3WAAC 3AZID 2ZY3A 3AZFA 5AVCA 4QLCB 3AZIB 3W98A 1WWIA 1F66B 3H0LC 5BS7A 5AVBD 3AZFD 2Y2MA 5AVCD 1P3OC 5GXQC 1M19A
chains in the Genus database with same CATH topology
2L5AA 5B32D 3X1SC 3RELC 3AZFB 5AVCB 2VQRA 1P3BA 4J8XA 2Y2LA 4NE3A 4YM6C 4G91B 3O62A 4AWLC 5B0YA 2CWEA 5B2IC 2YFVA 4J8XD 3REJA 1M19B 5GSUA 3KSYA 1HTAA 4CAYA 3O62D 4J8XB 1P3BB 4H9OB 5B0YD 3MGRC 3O62B 3REJD 5GSUD 5B0YB 1T3UA 5F99C 2YFVB 3REJB 1R4VA 1TZYA 5GSUB 3AV2A 5GT0C 1KX3C 4YS3C 4CAYB 4HGAB 5B0ZA 2AROC 1TZYD 3AV2D 2FJ7C 3KUYA 3B0DC 4J8VA 5JRGA 1TZYB 3H0MC 3AV2B 4R8PA 3LZ0C 3W97A 3RELD 2W8SA 3KUYD 2ZY5A 3X1UA 3WKJC 5B0ZB 1PZRA 4J8VD 3A1IA 1BH8A 4YM6D 2HIOC 3KUYB 2Y2OA 3B0BA 1EQZA 4J8VB 3W97D 5B2ID 4YM6B 3W97B 3MNNA 5B2IB 3X1UB 1EQZD 1BH8B 4NFTA 1U35A 3AZLA 1P3AA 1P34A 1EQZB 1P3MA 3NQUA 3AFAA 2F8NK 3MGQA 3LZ1A 3MNNB 4H9QB 4XUJC 2NQBA 1P3AD 5BT1C 3WTPA 3AFAD 1P3MD 4KGCC 3MGQD 1P3LA 3AZEA 4EO5B 1P3AB 1P3MB 3NQUB 3AFAB 5AV9C 3MGQB 1WWSA 2Y2KA 3LELC 1ID3A 2NQBD 5CPJC 2RVQC 1S32A 2NZDC 3LZ1B 1P3LD 3UT9C 2DQNC 2NQBB 3AZED 3AYWC 5CPKC 1P3LB 3WKJD 3AZEB 5B40C 5DNMA 1S32D 4M6BA 4LD9A 2HIOD 4H9SC 3B6GA 1ID3B 2F8NA 1M1AA 1S32B 3W96A 3REHA 2F2AC 4Z66A 5CP6C 4H9NA 3X1TC 3VH6W 5DNMD 3B0CW 1KX4C 5B31A 5CHLB 3B6GD 4QLCA 5B24C 3AZIA 1M18A 4ZUXC 5DNMB 2HUEB 3AZGC 1M1AD 3W96D 4LD9B 3REHD 3B6GB 4Z66D 3A6NA 1M1AB 3C1BC 5B33A 3W96B 2Y2QA 5B31D 3REHB 2PYOC 5AVBA 4Z66B 4H9NB 1M18D 3IP4C 2ZY2A 4XUJD 5B31B 3MGPA 2ZM5A 4WU9C 5BT1D 5CPIA 3A6ND 1P3FA 1N1JB 3AZHC 4WU8A 1M18B 3VH6T 2G5IC 5B33D 2NZDA 4WJ3C 5B32A 3B0CT 5C3IC 3NQJA 3A6NB 4G92B 3AZJA 1P3PC 5B33B 2BYKA 3MGPD 5AVBB 5CPID 2RVQD 1P3FD 2NZDD 4WU8D 3AZKA 3MGPB 5CPIB 2JE5A 3AYWD 1P3FB 3AZJD 4WU8B 5CPKD 2NZDB 4H9OA 4Z5TC 5B32B 3H0RC 3AL0C 3NQJB 3AZJB 5CPKB 3TU4C 2BYKB 3AZKD 5E5AA 3KWQA 2F8NG 1P3FC 2XD5A 3AZKB 3EPHA 5JA4A 3KXBA 3MGSA 5BNXA 5AY8A 1KX4D 3WAAA 2BG1A 4UPKA 5E5AD 3KWQD 5AV5C 5GT3C 1P3IC 4H9PA 4Z2MH 5B1LC 2Y2NA 3C1BD 3KXBD 3MGSD 5AY8D 5E5AB 3KWQB 1HQ3C 4J8UC 3AZMC 3WAAD 5JA4B 3C1BB 3KXBB 3W99C 5BNXB 5AY8B 3MGSB 1P3OA 3WAAB 5GXQA 3REKC 2CV5C 3X1SA 3RELA 4H9PB 2XD1A 4YM6A 3WA9C 1P3OD 5GXQD 3X1SD 5B2IA 3C1CC 1P3OB 5GXQB 5FUGA 3X1SB 3RELB 1P3KC 3UTBC 4UUZA 5AV8C 3TU4D 3UTAC 2LY8A 3MGRA 3MVDC 2UWXA 3AZNC 5DNNC 4AWLB 3TU4B 4H9QA 5F99A 4J8WC 3X1VC 5B2JC 2IO5C 5AV6C 5FUGB 5GT0A 1KX3A 3MGRD 4YS3A 4UUZB 2Y2GA 4H9RA 5AV5D 3VH5A 1ZLAC 5F99D 3FDDA 3MGRB 3EPLA 2AROA 3REIC 2FJ7A 5B1MC 5GT0D 1KX3D 5F99B 1AOIC 3R45A 4YS3D 3W99D 4XZQC 5GT0B 1P3GC 1KX3B 3P5JB 4YS3B 3LZ0A 2AROD 2CV5D 4X23C 4H9RB 4JJNC 3AN2C 2FJ7D 3WKJA 3A1KA 3B6FC 3EG5B 2AROB 1KX5C 3AV1C 2FJ7B 3LJAC 2HIOA 4KUDC 3R45B 3B0DB 3LZ0D 1B6WA 2Y2IA 4CSRA 1KU5A 1BH9B 3LZ0B 1F66C 3KFUG 3UTBD 3WKJB 3UTAD 2HIOB 3MVDD 2JSSA 4CSRB 3UTAB 4J8WD 3AZFC 2Y2HA 5AVCC 2RIQA 3MVDB 3W98C 1N1JA 1Z2CB 4XUJA 5BS7C 4J8WB 3EPJA 4KGCA 1ZLAD 4DRAA 3REID 1M19C 5AV9A 1ZLAB 2Y2JA 3LELA 5CPJA 1P3BC 4J8XC 3REIB 4KGCD 4XZQD 3UT9A 4XUJB 4X23D 3O62C 3AYWA 3AN2D 5AV9D 5CPKA 4XZQB 4KGCB 5B0YC 3LELD 5CPJD 5B40A 1JFIA 3AV1D 3REJC 3AN2B 5AV9B 5GSUC 3UT9D 4KUDD 4H9SA 3LELB 5G49A 5CPJB 4WZSB 4DQYB 3AV1B 2JCHA 3UT9B 4HGAC 5CP6A 3X1TA 5B40D 4E45A 1F66D 3AYWB 1KX4A 5BNVA 5B24A 5B40B 4ZUXA 1JFIB 3AZGA 1TZYC 3AV2C 5G49B 5CP6D 3X1TD 3C1BA 5KDMA 2FFFB 1BFMA 2PYOA 2BYMA 5B24D 5CP6B 5B0ZC 3X1TB 3W98D 4ZUXD 5B31G 3AZGD 1KX4B 4WU9A 5BNVB 3KUYC 5B24B 3W98B 3AZHA 4ZUXB 4J8VC 3AZGB 5JRGC 2PYOD 4R8PC 1M19D 1P3PA 3W97C 5KDMB 4WU9D 2PYOB 3X1UC 2BYMB 1P3BD 3AZHD 4WU9B 1EQZC 3AZHB 1P3PD 5B32G 4Z5TA 5C3IB 1P3PB 3TU4A 3MNNC 1H3OA 4NE6A 3WTPE 4Z5TD 2DF4C 1A7WA 1U35C 4EO5C 3AZLC 1P3AC 1P34C 1P3MC 3AFAC 3MGQC 4Z5TB 1ULYA 1Q9CA 5AV5A 3LZ1C 5GT3A 1P3IA 2NQBC 2G5HC 5B1LA 1H3OB 2Y2PA 3WTPC 1B67A 1HQ3A 1P3LC 4J8UA 3V9RA 3AZMA 5B0ZD 3AZEC 3W99A 1F1EA 4ZBJC 5GT3D 1P3ID 1ID3C 5B1LD 3REKA 2CV5A 1S32C 5JRGD 1HQ3D 3VH5W 5GT3B 5AV5B 4R8PD 4J8UD 3AZMD 1P3IB 5B1LB 5JRGB 2J8PA 1HQ3B 3X1UD 3V9RB 4R8PB 4J8UB 3AZMB 3WA9A 3REKD 1BH9A 5DNMC 3W99B 2HUEC 4LD9C 3C1CA 2F8NH 3F6TA 3B6GC 3REKB 4KHAA 2YFWA 2CV5B 1M1AC 3W96C 1P3KA 3REHC 3WA9D 3UTBA 4Z66C 5AV8A 3MNND 3UTAA 5B31C 3C1CD 3VH5T 3WA9B 4QLCC 3MVDA 3AZIC 3AZNA 5DNNA 1M18C 1P3KD 4J8WA 3C1CB 3AZLD 1U35D 3X1VA 1P34D 5AV8D 4KHAB 5B2JA 2YFWB 3A6NC 4G92C 5AV6A 5B33C 1TAFA 1P3KB 1U35B 5AVBC 3UTBB 3AZLB 1P34B 5AV8B 3AZND 5DNND 3LZ1D 1ZLAA 3MGPC 5CPIC 3X1VD 3EPKA 3WTPD 5B2JD 3AZNB 5DNNB 3REIA 5AV6D 1W2EA 4WU8C 4E44A 5B1MA 4Z2MG 5B32C 1AOIA 2ZY4A 3X1VB 4WNNA 4G91C 3WTPB 5B2JB 2IO5B 3AZJC 5AV6B 4XZQA 1TAFB 1P3GA 4NE5A 1ID3D 4X23A 4ZBJB 4JJNA 3AN2A 5BO0A 5B1MD 1AOID 3AZKC 3B6FA 3VH6A 1KX5A 3AV1A 3LJAA 4KUDA 5B1MB 1P3GD 1AOIB 4WNNB 4WV4B 4JJND 4LD9D 1P3GB 2F8ND 3B6FD 1F66A 1KX5D 4X23B 4DRBA 4JJNB 5E5AC 3KWQC 3LJAD 5BO0B 2F8NB 3B6FB 1KX5B 3KXBC 3MGSC 5AY8C 3LJAB 4KUDB 4QLCD 3WAAC 3AZID 2ZY3A 3AZFA 5AVCA 4QLCB 3AZIB 3W98A 1WWIA 1F66B 3H0LC 5BS7A 5AVBD 3AZFD 2Y2MA 5AVCD 1P3OC 5GXQC 1M19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5A A;  5B32 D;  3X1S C;  3REL C;  3AZF B;  5AVC B;  1P3B A;  4J8X A;  4NE3 A;  4YM6 C;  4G91 B;  3O62 A;  4AWL C;  5B0Y A;  2CWE A;  5B2I C;  2YFV A;  4J8X D;  3REJ A;  1M19 B;  5GSU A;  3KSY A;  1HTA A;  4CAY A;  3O62 D;  4J8X B;  1P3B B;  4H9O B;  5B0Y D;  3MGR C;  3O62 B;  3REJ D;  5GSU D;  5B0Y B;  5F99 C;  2YFV B;  3REJ B;  1R4V A;  1TZY A;  5GSU B;  3AV2 A;  5GT0 C;  1KX3 C;  4YS3 C;  4CAY B;  4HGA B;  5B0Z A;  2ARO C;  1TZY D;  3AV2 D;  2FJ7 C;  3KUY A;  3B0D C;  4J8V A;  5JRG A;  1TZY B;  3AV2 B;  4R8P A;  3LZ0 C;  3W97 A;  3REL D;  3KUY D;  3X1U A;  3WKJ C;  5B0Z B;  4J8V D;  1BH8 A;  4YM6 D;  2HIO C;  3KUY B;  3B0B A;  1EQZ A;  4J8V B;  3W97 D;  5B2I D;  4YM6 B;  3W97 B;  3MNN A;  5B2I B;  3X1U B;  1EQZ D;  1BH8 B;  4NFT A;  1U35 A;  3AZL A;  1P3A A;  1P34 A;  1EQZ B;  1P3M A;  3NQU A;  3AFA A;  2F8N K;  3MGQ A;  3LZ1 A;  3MNN B;  4H9Q B;  4XUJ C;  2NQB A;  1P3A D;  5BT1 C;  3WTP A;  3AFA D;  1P3M D;  4KGC C;  3MGQ D;  1P3L A;  3AZE A;  4EO5 B;  1P3A B;  1P3M B;  3NQU B;  3AFA B;  5AV9 C;  3MGQ B;  1WWS A;  3LEL C;  1ID3 A;  2NQB D;  5CPJ C;  2RVQ C;  1S32 A;  2NZD C;  3LZ1 B;  1P3L D;  3UT9 C;  2NQB B;  3AZE D;  3AYW C;  5CPK C;  1P3L B;  3WKJ D;  3AZE B;  5B40 C;  5DNM A;  1S32 D;  4M6B A;  4LD9 A;  2HIO D;  4H9S C;  3B6G A;  1ID3 B;  2F8N A;  1M1A A;  1S32 B;  3W96 A;  3REH A;  4Z66 A;  5CP6 C;  4H9N A;  3X1T C;  3VH6 W;  5DNM D;  3B0C W;  1KX4 C;  5B31 A;  5CHL B;  3B6G D;  4QLC A;  5B24 C;  3AZI A;  1M18 A;  4ZUX C;  5DNM B;  2HUE B;  3AZG C;  1M1A D;  3W96 D;  4LD9 B;  3REH D;  3B6G B;  4Z66 D;  3A6N A;  1M1A B;  3C1B C;  5B33 A;  3W96 B;  5B31 D;  3REH B;  2PYO C;  5AVB A;  4Z66 B;  4H9N B;  1M18 D;  4XUJ D;  5B31 B;  3MGP A;  4WU9 C;  5CPI A;  5BT1 D;  3A6N D;  1P3F A;  1N1J B;  3AZH C;  4WU8 A;  1M18 B;  3VH6 T;  5B33 D;  2NZD A;  5B32 A;  3B0C T;  5C3I C;  3NQJ A;  3A6N B;  4G92 B;  3AZJ A;  1P3P C;  5B33 B;  2BYK A;  3MGP D;  5AVB B;  5CPI D;  2RVQ D;  1P3F D;  2NZD D;  4WU8 D;  3AZK A;  3MGP B;  5CPI B;  3AYW D;  1P3F B;  3AZJ D;  4WU8 B;  5CPK D;  2NZD B;  4H9O A;  4Z5T C;  5B32 B;  3NQJ B;  3AZJ B;  5CPK B;  3TU4 C;  2BYK B;  3AZK D;  5E5A A;  3KWQ A;  2F8N G;  3AZK B;  5JA4 A;  3KXB A;  3MGS A;  5BNX A;  5AY8 A;  1KX4 D;  3WAA A;  5E5A D;  3KWQ D;  5AV5 C;  5GT3 C;  1P3I C;  4H9P A;  4Z2M H;  5B1L C;  3C1B D;  3KXB D;  3MGS D;  5AY8 D;  5E5A B;  3KWQ B;  1HQ3 C;  4J8U C;  3AZM C;  3WAA D;  5JA4 B;  3C1B B;  3KXB B;  3W99 C;  5BNX B;  5AY8 B;  3MGS B;  1P3O A;  3WAA B;  5GXQ A;  3REK C;  2CV5 C;  3X1S A;  3REL A;  4H9P B;  4YM6 A;  3WA9 C;  1P3O D;  5GXQ D;  3X1S D;  5B2I A;  3C1C C;  1P3O B;  5GXQ B;  5FUG A;  3X1S B;  3REL B;  1P3K C;  3UTB C;  4UUZ A;  5AV8 C;  3TU4 D;  3UTA C;  2LY8 A;  3MGR A;  3MVD C;  3AZN C;  5DNN C;  4AWL B;  3TU4 B;  4H9Q A;  5F99 A;  4J8W C;  3X1V C;  5B2J C;  2IO5 C;  5AV6 C;  5FUG B;  5GT0 A;  1KX3 A;  3MGR D;  4YS3 A;  4UUZ B;  4H9R A;  5AV5 D;  3VH5 A;  1ZLA C;  5F99 D;  3MGR B;  2ARO A;  3REI C;  2FJ7 A;  5B1M C;  5GT0 D;  1KX3 D;  5F99 B;  1AOI C;  3R45 A;  4YS3 D;  3W99 D;  4XZQ C;  5GT0 B;  1P3G C;  1KX3 B;  4YS3 B;  3LZ0 A;  2ARO D;  2CV5 D;  4X23 C;  4H9R B;  4JJN C;  3AN2 C;  2FJ7 D;  3WKJ A;  3B6F C;  2ARO B;  1KX5 C;  3AV1 C;  2FJ7 B;  3LJA C;  2HIO A;  4KUD C;  3R45 B;  3B0D B;  3LZ0 D;  1B6W A;  4CSR A;  1KU5 A;  1BH9 B;  3LZ0 B;  1F66 C;  3UTB D;  3WKJ B;  3UTA D;  2HIO B;  3MVD D;  2JSS A;  4CSR B;  3UTA B;  4J8W D;  3AZF C;  5AVC C;  3MVD B;  3W98 C;  1N1J A;  4XUJ A;  5BS7 C;  4J8W B;  4KGC A;  1ZLA D;  4DRA A;  3REI D;  1M19 C;  5AV9 A;  1ZLA B;  3LEL A;  5CPJ A;  1P3B C;  4J8X C;  3REI B;  4KGC D;  4XZQ D;  3UT9 A;  4XUJ B;  4X23 D;  3O62 C;  3AYW A;  3AN2 D;  5AV9 D;  5CPK A;  4XZQ B;  4KGC B;  5B0Y C;  3LEL D;  5CPJ D;  5B40 A;  1JFI A;  3AV1 D;  3REJ C;  3AN2 B;  5AV9 B;  5GSU C;  3UT9 D;  4KUD D;  4H9S A;  3LEL B;  5G49 A;  5CPJ B;  4WZS B;  3AV1 B;  3UT9 B;  4HGA C;  5CP6 A;  3X1T A;  5B40 D;  4E45 A;  1F66 D;  3AYW B;  1KX4 A;  5BNV A;  5B24 A;  5B40 B;  4ZUX A;  1JFI B;  3AZG A;  1TZY C;  3AV2 C;  5G49 B;  5CP6 D;  3X1T D;  3C1B A;  5KDM A;  1BFM A;  2PYO A;  2BYM A;  5B24 D;  5CP6 B;  5B0Z C;  3X1T B;  3W98 D;  4ZUX D;  5B31 G;  3AZG D;  1KX4 B;  4WU9 A;  5BNV B;  3KUY C;  5B24 B;  3W98 B;  3AZH A;  4ZUX B;  4J8V C;  3AZG B;  5JRG C;  2PYO D;  4R8P C;  1M19 D;  1P3P A;  3W97 C;  5KDM B;  4WU9 D;  2PYO B;  3X1U C;  2BYM B;  1P3B D;  3AZH D;  4WU9 B;  1EQZ C;  3AZH B;  1P3P D;  5B32 G;  4Z5T A;  5C3I B;  1P3P B;  3TU4 A;  3MNN C;  1H3O A;  4NE6 A;  3WTP E;  4Z5T D;  1A7W A;  1U35 C;  4EO5 C;  3AZL C;  1P3A C;  1P34 C;  1P3M C;  3AFA C;  3MGQ C;  4Z5T B;  1ULY A;  1Q9C A;  5AV5 A;  3LZ1 C;  5GT3 A;  1P3I A;  2NQB C;  5B1L A;  1H3O B;  3WTP C;  1B67 A;  1HQ3 A;  1P3L C;  4J8U A;  3V9R A;  3AZM A;  5B0Z D;  3AZE C;  3W99 A;  1F1E A;  4ZBJ C;  5GT3 D;  1P3I D;  1ID3 C;  5B1L D;  3REK A;  2CV5 A;  1S32 C;  5JRG D;  1HQ3 D;  3VH5 W;  5GT3 B;  5AV5 B;  4R8P D;  4J8U D;  3AZM D;  1P3I B;  5B1L B;  5JRG B;  1HQ3 B;  3X1U D;  3V9R B;  4R8P B;  4J8U B;  3AZM B;  3WA9 A;  3REK D;  1BH9 A;  5DNM C;  3W99 B;  2HUE C;  4LD9 C;  3C1C A;  2F8N H;  3B6G C;  3REK B;  4KHA A;  2YFW A;  2CV5 B;  1M1A C;  3W96 C;  1P3K A;  3REH C;  3WA9 D;  3UTB A;  4Z66 C;  5AV8 A;  3MNN D;  3UTA A;  5B31 C;  3C1C D;  3VH5 T;  3WA9 B;  4QLC C;  3MVD A;  3AZI C;  3AZN A;  5DNN A;  1M18 C;  1P3K D;  4J8W A;  3C1C B;  3AZL D;  1U35 D;  3X1V A;  1P34 D;  5AV8 D;  4KHA B;  5B2J A;  2YFW B;  3A6N C;  4G92 C;  5AV6 A;  5B33 C;  1TAF A;  1P3K B;  1U35 B;  5AVB C;  3UTB B;  3AZL B;  1P34 B;  5AV8 B;  3AZN D;  5DNN D;  3LZ1 D;  1ZLA A;  3MGP C;  5CPI C;  3X1V D;  3WTP D;  5B2J D;  3AZN B;  5DNN B;  3REI A;  5AV6 D;  4WU8 C;  1P3F C;  4E44 A;  5B1M A;  4Z2M G;  5B32 C;  1AOI A;  3X1V B;  4WNN A;  4G91 C;  3WTP B;  5B2J B;  2IO5 B;  3AZJ C;  5AV6 B;  4XZQ A;  1TAF B;  1P3G A;  4NE5 A;  1ID3 D;  4X23 A;  4ZBJ B;  4JJN A;  3AN2 A;  5BO0 A;  5B1M D;  1AOI D;  3AZK C;  3B6F A;  3VH6 A;  1KX5 A;  3AV1 A;  3LJA A;  4KUD A;  5B1M B;  1P3G D;  1AOI B;  4WNN B;  4WV4 B;  4JJN D;  4LD9 D;  1P3G B;  2F8N D;  3B6F D;  1F66 A;  1KX5 D;  4X23 B;  4DRB A;  4JJN B;  5E5A C;  3KWQ C;  3LJA D;  5BO0 B;  2F8N B;  3B6F B;  1KX5 B;  3KXB C;  3MGS C;  5AY8 C;  3LJA B;  4KUD B;  4QLC D;  3WAA C;  3AZI D;  3AZF A;  5AVC A;  4QLC B;  3AZI B;  3W98 A;  1WWI A;  1F66 B;  5BS7 A;  5AVB D;  3AZF D;  5AVC D;  1P3O C;  5GXQ C;  1M19 A; 
#chains in the Genus database with same CATH topology
 2L5A A;  5B32 D;  3X1S C;  3REL C;  3AZF B;  5AVC B;  2VQR A;  1P3B A;  4J8X A;  2Y2L A;  4NE3 A;  4YM6 C;  4G91 B;  3O62 A;  4AWL C;  5B0Y A;  2CWE A;  5B2I C;  2YFV A;  4J8X D;  3REJ A;  1M19 B;  5GSU A;  3KSY A;  1HTA A;  4CAY A;  3O62 D;  4J8X B;  1P3B B;  4H9O B;  5B0Y D;  3MGR C;  3O62 B;  3REJ D;  5GSU D;  5B0Y B;  1T3U A;  5F99 C;  2YFV B;  3REJ B;  1R4V A;  1TZY A;  5GSU B;  3AV2 A;  5GT0 C;  1KX3 C;  4YS3 C;  4CAY B;  4HGA B;  5B0Z A;  2ARO C;  1TZY D;  3AV2 D;  2FJ7 C;  3KUY A;  3B0D C;  4J8V A;  5JRG A;  1TZY B;  3H0M C;  3AV2 B;  4R8P A;  3LZ0 C;  3W97 A;  3REL D;  2W8S A;  3KUY D;  2ZY5 A;  3X1U A;  3WKJ C;  5B0Z B;  1PZR A;  4J8V D;  3A1I A;  1BH8 A;  4YM6 D;  2HIO C;  3KUY B;  2Y2O A;  3B0B A;  1EQZ A;  4J8V B;  3W97 D;  5B2I D;  4YM6 B;  3W97 B;  3MNN A;  5B2I B;  3X1U B;  1EQZ D;  1BH8 B;  4NFT A;  1U35 A;  3AZL A;  1P3A A;  1P34 A;  1EQZ B;  1P3M A;  3NQU A;  3AFA A;  2F8N K;  3MGQ A;  3LZ1 A;  3MNN B;  4H9Q B;  4XUJ C;  2NQB A;  1P3A D;  5BT1 C;  3WTP A;  3AFA D;  1P3M D;  4KGC C;  3MGQ D;  1P3L A;  3AZE A;  4EO5 B;  1P3A B;  1P3M B;  3NQU B;  3AFA B;  5AV9 C;  3MGQ B;  1WWS A;  2Y2K A;  3LEL C;  1ID3 A;  2NQB D;  5CPJ C;  2RVQ C;  1S32 A;  2NZD C;  3LZ1 B;  1P3L D;  3UT9 C;  2DQN C;  2NQB B;  3AZE D;  3AYW C;  5CPK C;  1P3L B;  3WKJ D;  3AZE B;  5B40 C;  5DNM A;  1S32 D;  4M6B A;  4LD9 A;  2HIO D;  4H9S C;  3B6G A;  1ID3 B;  2F8N A;  1M1A A;  1S32 B;  3W96 A;  3REH A;  2F2A C;  4Z66 A;  5CP6 C;  4H9N A;  3X1T C;  3VH6 W;  5DNM D;  3B0C W;  1KX4 C;  5B31 A;  5CHL B;  3B6G D;  4QLC A;  5B24 C;  3AZI A;  1M18 A;  4ZUX C;  5DNM B;  2HUE B;  3AZG C;  1M1A D;  3W96 D;  4LD9 B;  3REH D;  3B6G B;  4Z66 D;  3A6N A;  1M1A B;  3C1B C;  5B33 A;  3W96 B;  2Y2Q A;  5B31 D;  3REH B;  2PYO C;  5AVB A;  4Z66 B;  4H9N B;  1M18 D;  3IP4 C;  2ZY2 A;  4XUJ D;  5B31 B;  3MGP A;  2ZM5 A;  4WU9 C;  5BT1 D;  5CPI A;  3A6N D;  1P3F A;  1N1J B;  3AZH C;  4WU8 A;  1M18 B;  3VH6 T;  2G5I C;  5B33 D;  2NZD A;  4WJ3 C;  5B32 A;  3B0C T;  5C3I C;  3NQJ A;  3A6N B;  4G92 B;  3AZJ A;  1P3P C;  5B33 B;  2BYK A;  3MGP D;  5AVB B;  5CPI D;  2RVQ D;  1P3F D;  2NZD D;  4WU8 D;  3AZK A;  3MGP B;  5CPI B;  2JE5 A;  3AYW D;  1P3F B;  3AZJ D;  4WU8 B;  5CPK D;  2NZD B;  4H9O A;  4Z5T C;  5B32 B;  3H0R C;  3AL0 C;  3NQJ B;  3AZJ B;  5CPK B;  3TU4 C;  2BYK B;  3AZK D;  5E5A A;  3KWQ A;  2F8N G;  1P3F C;  2XD5 A;  3AZK B;  3EPH A;  5JA4 A;  3KXB A;  3MGS A;  5BNX A;  5AY8 A;  1KX4 D;  3WAA A;  2BG1 A;  4UPK A;  5E5A D;  3KWQ D;  5AV5 C;  5GT3 C;  1P3I C;  4H9P A;  4Z2M H;  5B1L C;  2Y2N A;  3C1B D;  3KXB D;  3MGS D;  5AY8 D;  5E5A B;  3KWQ B;  1HQ3 C;  4J8U C;  3AZM C;  3WAA D;  5JA4 B;  3C1B B;  3KXB B;  3W99 C;  5BNX B;  5AY8 B;  3MGS B;  1P3O A;  3WAA B;  5GXQ A;  3REK C;  2CV5 C;  3X1S A;  3REL A;  4H9P B;  2XD1 A;  4YM6 A;  3WA9 C;  1P3O D;  5GXQ D;  3X1S D;  5B2I A;  3C1C C;  1P3O B;  5GXQ B;  5FUG A;  3X1S B;  3REL B;  1P3K C;  3UTB C;  4UUZ A;  5AV8 C;  3TU4 D;  3UTA C;  2LY8 A;  3MGR A;  3MVD C;  2UWX A;  3AZN C;  5DNN C;  4AWL B;  3TU4 B;  4H9Q A;  5F99 A;  4J8W C;  3X1V C;  5B2J C;  2IO5 C;  5AV6 C;  5FUG B;  5GT0 A;  1KX3 A;  3MGR D;  4YS3 A;  4UUZ B;  2Y2G A;  4H9R A;  5AV5 D;  3VH5 A;  1ZLA C;  5F99 D;  3FDD A;  3MGR B;  3EPL A;  2ARO A;  3REI C;  2FJ7 A;  5B1M C;  5GT0 D;  1KX3 D;  5F99 B;  1AOI C;  3R45 A;  4YS3 D;  3W99 D;  4XZQ C;  5GT0 B;  1P3G C;  1KX3 B;  3P5J B;  4YS3 B;  3LZ0 A;  2ARO D;  2CV5 D;  4X23 C;  4H9R B;  4JJN C;  3AN2 C;  2FJ7 D;  3WKJ A;  3A1K A;  3B6F C;  3EG5 B;  2ARO B;  1KX5 C;  3AV1 C;  2FJ7 B;  3LJA C;  2HIO A;  4KUD C;  3R45 B;  3B0D B;  3LZ0 D;  1B6W A;  2Y2I A;  4CSR A;  1KU5 A;  1BH9 B;  3LZ0 B;  1F66 C;  3KFU G;  3UTB D;  3WKJ B;  3UTA D;  2HIO B;  3MVD D;  2JSS A;  4CSR B;  3UTA B;  4J8W D;  3AZF C;  2Y2H A;  5AVC C;  2RIQ A;  3MVD B;  3W98 C;  1N1J A;  1Z2C B;  4XUJ A;  5BS7 C;  4J8W B;  3EPJ A;  4KGC A;  1ZLA D;  4DRA A;  3REI D;  1M19 C;  5AV9 A;  1ZLA B;  2Y2J A;  3LEL A;  5CPJ A;  1P3B C;  4J8X C;  3REI B;  4KGC D;  4XZQ D;  3UT9 A;  4XUJ B;  4X23 D;  3O62 C;  3AYW A;  3AN2 D;  5AV9 D;  5CPK A;  4XZQ B;  4KGC B;  5B0Y C;  3LEL D;  5CPJ D;  5B40 A;  1JFI A;  3AV1 D;  3REJ C;  3AN2 B;  5AV9 B;  5GSU C;  3UT9 D;  4KUD D;  4H9S A;  3LEL B;  5G49 A;  5CPJ B;  4WZS B;  4DQY B;  3AV1 B;  2JCH A;  3UT9 B;  4HGA C;  5CP6 A;  3X1T A;  5B40 D;  4E45 A;  1F66 D;  3AYW B;  1KX4 A;  5BNV A;  5B24 A;  5B40 B;  4ZUX A;  1JFI B;  3AZG A;  1TZY C;  3AV2 C;  5G49 B;  5CP6 D;  3X1T D;  3C1B A;  5KDM A;  2FFF B;  1BFM A;  2PYO A;  2BYM A;  5B24 D;  5CP6 B;  5B0Z C;  3X1T B;  3W98 D;  4ZUX D;  5B31 G;  3AZG D;  1KX4 B;  4WU9 A;  5BNV B;  3KUY C;  5B24 B;  3W98 B;  3AZH A;  4ZUX B;  4J8V C;  3AZG B;  5JRG C;  2PYO D;  4R8P C;  1M19 D;  1P3P A;  3W97 C;  5KDM B;  4WU9 D;  2PYO B;  3X1U C;  2BYM B;  1P3B D;  3AZH D;  4WU9 B;  1EQZ C;  3AZH B;  1P3P D;  5B32 G;  4Z5T A;  5C3I B;  1P3P B;  3TU4 A;  3MNN C;  1H3O A;  4NE6 A;  3WTP E;  4Z5T D;  2DF4 C;  1A7W A;  1U35 C;  4EO5 C;  3AZL C;  1P3A C;  1P34 C;  1P3M C;  3AFA C;  3MGQ C;  4Z5T B;  1ULY A;  1Q9C A;  5AV5 A;  3LZ1 C;  5GT3 A;  1P3I A;  2NQB C;  2G5H C;  5B1L A;  1H3O B;  2Y2P A;  3WTP C;  1B67 A;  1HQ3 A;  1P3L C;  4J8U A;  3V9R A;  3AZM A;  5B0Z D;  3AZE C;  3W99 A;  1F1E A;  4ZBJ C;  5GT3 D;  1P3I D;  1ID3 C;  5B1L D;  3REK A;  2CV5 A;  1S32 C;  5JRG D;  1HQ3 D;  3VH5 W;  5GT3 B;  5AV5 B;  4R8P D;  4J8U D;  3AZM D;  1P3I B;  5B1L B;  5JRG B;  2J8P A;  1HQ3 B;  3X1U D;  3V9R B;  4R8P B;  4J8U B;  3AZM B;  3WA9 A;  3REK D;  1BH9 A;  5DNM C;  3W99 B;  2HUE C;  4LD9 C;  3C1C A;  2F8N H;  3F6T A;  3B6G C;  3REK B;  4KHA A;  2YFW A;  2CV5 B;  1M1A C;  3W96 C;  1P3K A;  3REH C;  3WA9 D;  3UTB A;  4Z66 C;  5AV8 A;  3MNN D;  3UTA A;  5B31 C;  3C1C D;  3VH5 T;  3WA9 B;  4QLC C;  3MVD A;  3AZI C;  3AZN A;  5DNN A;  1M18 C;  1P3K D;  4J8W A;  3C1C B;  3AZL D;  1U35 D;  3X1V A;  1P34 D;  5AV8 D;  4KHA B;  5B2J A;  2YFW B;  3A6N C;  4G92 C;  5AV6 A;  5B33 C;  1TAF A;  1P3K B;  1U35 B;  5AVB C;  3UTB B;  3AZL B;  1P34 B;  5AV8 B;  3AZN D;  5DNN D;  3LZ1 D;  1ZLA A;  3MGP C;  5CPI C;  3X1V D;  3EPK A;  3WTP D;  5B2J D;  3AZN B;  5DNN B;  3REI A;  5AV6 D;  1W2E A;  4WU8 C;  4E44 A;  5B1M A;  4Z2M G;  5B32 C;  1AOI A;  2ZY4 A;  3X1V B;  4WNN A;  4G91 C;  3WTP B;  5B2J B;  2IO5 B;  3AZJ C;  5AV6 B;  4XZQ A;  1TAF B;  1P3G A;  4NE5 A;  1ID3 D;  4X23 A;  4ZBJ B;  4JJN A;  3AN2 A;  5BO0 A;  5B1M D;  1AOI D;  3AZK C;  3B6F A;  3VH6 A;  1KX5 A;  3AV1 A;  3LJA A;  4KUD A;  5B1M B;  1P3G D;  1AOI B;  4WNN B;  4WV4 B;  4JJN D;  4LD9 D;  1P3G B;  2F8N D;  3B6F D;  1F66 A;  1KX5 D;  4X23 B;  4DRB A;  4JJN B;  5E5A C;  3KWQ C;  3LJA D;  5BO0 B;  2F8N B;  3B6F B;  1KX5 B;  3KXB C;  3MGS C;  5AY8 C;  3LJA B;  4KUD B;  4QLC D;  3WAA C;  3AZI D;  2ZY3 A;  3AZF A;  5AVC A;  4QLC B;  3AZI B;  3W98 A;  1WWI A;  1F66 B;  3H0L C;  5BS7 A;  5AVB D;  3AZF D;  2Y2M A;  5AVC D;  1P3O C;  5GXQ C;  1M19 A; 
#chains in the Genus database with same CATH homology
 2L5A A;  5B32 D;  3X1S C;  3REL C;  3AZF B;  5AVC B;  2VQR A;  1P3B A;  4J8X A;  2Y2L A;  4NE3 A;  4YM6 C;  4G91 B;  3O62 A;  4AWL C;  5B0Y A;  2CWE A;  5B2I C;  2YFV A;  4J8X D;  3REJ A;  1M19 B;  5GSU A;  3KSY A;  1HTA A;  4CAY A;  3O62 D;  4J8X B;  1P3B B;  4H9O B;  5B0Y D;  3MGR C;  3O62 B;  3REJ D;  5GSU D;  5B0Y B;  1T3U A;  5F99 C;  2YFV B;  3REJ B;  1R4V A;  1TZY A;  5GSU B;  3AV2 A;  5GT0 C;  1KX3 C;  4YS3 C;  4CAY B;  4HGA B;  5B0Z A;  2ARO C;  1TZY D;  3AV2 D;  2FJ7 C;  3KUY A;  3B0D C;  4J8V A;  5JRG A;  1TZY B;  3H0M C;  3AV2 B;  4R8P A;  3LZ0 C;  3W97 A;  3REL D;  2W8S A;  3KUY D;  2ZY5 A;  3X1U A;  3WKJ C;  5B0Z B;  1PZR A;  4J8V D;  3A1I A;  1BH8 A;  4YM6 D;  2HIO C;  3KUY B;  2Y2O A;  3B0B A;  1EQZ A;  4J8V B;  3W97 D;  5B2I D;  4YM6 B;  3W97 B;  3MNN A;  5B2I B;  3X1U B;  1EQZ D;  1BH8 B;  4NFT A;  1U35 A;  3AZL A;  1P3A A;  1P34 A;  1EQZ B;  1P3M A;  3NQU A;  3AFA A;  2F8N K;  3MGQ A;  3LZ1 A;  3MNN B;  4H9Q B;  4XUJ C;  2NQB A;  1P3A D;  5BT1 C;  3WTP A;  3AFA D;  1P3M D;  4KGC C;  3MGQ D;  1P3L A;  3AZE A;  4EO5 B;  1P3A B;  1P3M B;  3NQU B;  3AFA B;  5AV9 C;  3MGQ B;  1WWS A;  2Y2K A;  3LEL C;  1ID3 A;  2NQB D;  5CPJ C;  2RVQ C;  1S32 A;  2NZD C;  3LZ1 B;  1P3L D;  3UT9 C;  2DQN C;  2NQB B;  3AZE D;  3AYW C;  5CPK C;  1P3L B;  3WKJ D;  3AZE B;  5B40 C;  5DNM A;  1S32 D;  4M6B A;  4LD9 A;  2HIO D;  4H9S C;  3B6G A;  1ID3 B;  2F8N A;  1M1A A;  1S32 B;  3W96 A;  3REH A;  2F2A C;  4Z66 A;  5CP6 C;  4H9N A;  3X1T C;  3VH6 W;  5DNM D;  3B0C W;  1KX4 C;  5B31 A;  5CHL B;  3B6G D;  4QLC A;  5B24 C;  3AZI A;  1M18 A;  4ZUX C;  5DNM B;  2HUE B;  3AZG C;  1M1A D;  3W96 D;  4LD9 B;  3REH D;  3B6G B;  4Z66 D;  3A6N A;  1M1A B;  3C1B C;  5B33 A;  3W96 B;  2Y2Q A;  5B31 D;  3REH B;  2PYO C;  5AVB A;  4Z66 B;  4H9N B;  1M18 D;  3IP4 C;  2ZY2 A;  4XUJ D;  5B31 B;  3MGP A;  2ZM5 A;  4WU9 C;  5BT1 D;  5CPI A;  3A6N D;  1P3F A;  1N1J B;  3AZH C;  4WU8 A;  1M18 B;  3VH6 T;  2G5I C;  5B33 D;  2NZD A;  4WJ3 C;  5B32 A;  3B0C T;  5C3I C;  3NQJ A;  3A6N B;  4G92 B;  3AZJ A;  1P3P C;  5B33 B;  2BYK A;  3MGP D;  5AVB B;  5CPI D;  2RVQ D;  1P3F D;  2NZD D;  4WU8 D;  3AZK A;  3MGP B;  5CPI B;  2JE5 A;  3AYW D;  1P3F B;  3AZJ D;  4WU8 B;  5CPK D;  2NZD B;  4H9O A;  4Z5T C;  5B32 B;  3H0R C;  3AL0 C;  3NQJ B;  3AZJ B;  5CPK B;  3TU4 C;  2BYK B;  3AZK D;  5E5A A;  3KWQ A;  2F8N G;  1P3F C;  2XD5 A;  3AZK B;  3EPH A;  5JA4 A;  3KXB A;  3MGS A;  5BNX A;  5AY8 A;  1KX4 D;  3WAA A;  2BG1 A;  4UPK A;  5E5A D;  3KWQ D;  5AV5 C;  5GT3 C;  1P3I C;  4H9P A;  4Z2M H;  5B1L C;  2Y2N A;  3C1B D;  3KXB D;  3MGS D;  5AY8 D;  5E5A B;  3KWQ B;  1HQ3 C;  4J8U C;  3AZM C;  3WAA D;  5JA4 B;  3C1B B;  3KXB B;  3W99 C;  5BNX B;  5AY8 B;  3MGS B;  1P3O A;  3WAA B;  5GXQ A;  3REK C;  2CV5 C;  3X1S A;  3REL A;  4H9P B;  2XD1 A;  4YM6 A;  3WA9 C;  1P3O D;  5GXQ D;  3X1S D;  5B2I A;  3C1C C;  1P3O B;  5GXQ B;  5FUG A;  3X1S B;  3REL B;  1P3K C;  3UTB C;  4UUZ A;  5AV8 C;  3TU4 D;  3UTA C;  2LY8 A;  3MGR A;  3MVD C;  2UWX A;  3AZN C;  5DNN C;  4AWL B;  3TU4 B;  4H9Q A;  5F99 A;  4J8W C;  3X1V C;  5B2J C;  2IO5 C;  5AV6 C;  5FUG B;  5GT0 A;  1KX3 A;  3MGR D;  4YS3 A;  4UUZ B;  2Y2G A;  4H9R A;  5AV5 D;  3VH5 A;  1ZLA C;  5F99 D;  3FDD A;  3MGR B;  3EPL A;  2ARO A;  3REI C;  2FJ7 A;  5B1M C;  5GT0 D;  1KX3 D;  5F99 B;  1AOI C;  3R45 A;  4YS3 D;  3W99 D;  4XZQ C;  5GT0 B;  1P3G C;  1KX3 B;  3P5J B;  4YS3 B;  3LZ0 A;  2ARO D;  2CV5 D;  4X23 C;  4H9R B;  4JJN C;  3AN2 C;  2FJ7 D;  3WKJ A;  3A1K A;  3B6F C;  3EG5 B;  2ARO B;  1KX5 C;  3AV1 C;  2FJ7 B;  3LJA C;  2HIO A;  4KUD C;  3R45 B;  3B0D B;  3LZ0 D;  1B6W A;  2Y2I A;  4CSR A;  1KU5 A;  1BH9 B;  3LZ0 B;  1F66 C;  3KFU G;  3UTB D;  3WKJ B;  3UTA D;  2HIO B;  3MVD D;  2JSS A;  4CSR B;  3UTA B;  4J8W D;  3AZF C;  2Y2H A;  5AVC C;  2RIQ A;  3MVD B;  3W98 C;  1N1J A;  1Z2C B;  4XUJ A;  5BS7 C;  4J8W B;  3EPJ A;  4KGC A;  1ZLA D;  4DRA A;  3REI D;  1M19 C;  5AV9 A;  1ZLA B;  2Y2J A;  3LEL A;  5CPJ A;  1P3B C;  4J8X C;  3REI B;  4KGC D;  4XZQ D;  3UT9 A;  4XUJ B;  4X23 D;  3O62 C;  3AYW A;  3AN2 D;  5AV9 D;  5CPK A;  4XZQ B;  4KGC B;  5B0Y C;  3LEL D;  5CPJ D;  5B40 A;  1JFI A;  3AV1 D;  3REJ C;  3AN2 B;  5AV9 B;  5GSU C;  3UT9 D;  4KUD D;  4H9S A;  3LEL B;  5G49 A;  5CPJ B;  4WZS B;  4DQY B;  3AV1 B;  2JCH A;  3UT9 B;  4HGA C;  5CP6 A;  3X1T A;  5B40 D;  4E45 A;  1F66 D;  3AYW B;  1KX4 A;  5BNV A;  5B24 A;  5B40 B;  4ZUX A;  1JFI B;  3AZG A;  1TZY C;  3AV2 C;  5G49 B;  5CP6 D;  3X1T D;  3C1B A;  5KDM A;  2FFF B;  1BFM A;  2PYO A;  2BYM A;  5B24 D;  5CP6 B;  5B0Z C;  3X1T B;  3W98 D;  4ZUX D;  5B31 G;  3AZG D;  1KX4 B;  4WU9 A;  5BNV B;  3KUY C;  5B24 B;  3W98 B;  3AZH A;  4ZUX B;  4J8V C;  3AZG B;  5JRG C;  2PYO D;  4R8P C;  1M19 D;  1P3P A;  3W97 C;  5KDM B;  4WU9 D;  2PYO B;  3X1U C;  2BYM B;  1P3B D;  3AZH D;  4WU9 B;  1EQZ C;  3AZH B;  1P3P D;  5B32 G;  4Z5T A;  5C3I B;  1P3P B;  3TU4 A;  3MNN C;  1H3O A;  4NE6 A;  3WTP E;  4Z5T D;  2DF4 C;  1A7W A;  1U35 C;  4EO5 C;  3AZL C;  1P3A C;  1P34 C;  1P3M C;  3AFA C;  3MGQ C;  4Z5T B;  1ULY A;  1Q9C A;  5AV5 A;  3LZ1 C;  5GT3 A;  1P3I A;  2NQB C;  2G5H C;  5B1L A;  1H3O B;  2Y2P A;  3WTP C;  1B67 A;  1HQ3 A;  1P3L C;  4J8U A;  3V9R A;  3AZM A;  5B0Z D;  3AZE C;  3W99 A;  1F1E A;  4ZBJ C;  5GT3 D;  1P3I D;  1ID3 C;  5B1L D;  3REK A;  2CV5 A;  1S32 C;  5JRG D;  1HQ3 D;  3VH5 W;  5GT3 B;  5AV5 B;  4R8P D;  4J8U D;  3AZM D;  1P3I B;  5B1L B;  5JRG B;  2J8P A;  1HQ3 B;  3X1U D;  3V9R B;  4R8P B;  4J8U B;  3AZM B;  3WA9 A;  3REK D;  1BH9 A;  5DNM C;  3W99 B;  2HUE C;  4LD9 C;  3C1C A;  2F8N H;  3F6T A;  3B6G C;  3REK B;  4KHA A;  2YFW A;  2CV5 B;  1M1A C;  3W96 C;  1P3K A;  3REH C;  3WA9 D;  3UTB A;  4Z66 C;  5AV8 A;  3MNN D;  3UTA A;  5B31 C;  3C1C D;  3VH5 T;  3WA9 B;  4QLC C;  3MVD A;  3AZI C;  3AZN A;  5DNN A;  1M18 C;  1P3K D;  4J8W A;  3C1C B;  3AZL D;  1U35 D;  3X1V A;  1P34 D;  5AV8 D;  4KHA B;  5B2J A;  2YFW B;  3A6N C;  4G92 C;  5AV6 A;  5B33 C;  1TAF A;  1P3K B;  1U35 B;  5AVB C;  3UTB B;  3AZL B;  1P34 B;  5AV8 B;  3AZN D;  5DNN D;  3LZ1 D;  1ZLA A;  3MGP C;  5CPI C;  3X1V D;  3EPK A;  3WTP D;  5B2J D;  3AZN B;  5DNN B;  3REI A;  5AV6 D;  1W2E A;  4WU8 C;  4E44 A;  5B1M A;  4Z2M G;  5B32 C;  1AOI A;  2ZY4 A;  3X1V B;  4WNN A;  4G91 C;  3WTP B;  5B2J B;  2IO5 B;  3AZJ C;  5AV6 B;  4XZQ A;  1TAF B;  1P3G A;  4NE5 A;  1ID3 D;  4X23 A;  4ZBJ B;  4JJN A;  3AN2 A;  5BO0 A;  5B1M D;  1AOI D;  3AZK C;  3B6F A;  3VH6 A;  1KX5 A;  3AV1 A;  3LJA A;  4KUD A;  5B1M B;  1P3G D;  1AOI B;  4WNN B;  4WV4 B;  4JJN D;  4LD9 D;  1P3G B;  2F8N D;  3B6F D;  1F66 A;  1KX5 D;  4X23 B;  4DRB A;  4JJN B;  5E5A C;  3KWQ C;  3LJA D;  5BO0 B;  2F8N B;  3B6F B;  1KX5 B;  3KXB C;  3MGS C;  5AY8 C;  3LJA B;  4KUD B;  4QLC D;  3WAA C;  3AZI D;  2ZY3 A;  3AZF A;  5AVC A;  4QLC B;  3AZI B;  3W98 A;  1WWI A;  1F66 B;  3H0L C;  5BS7 A;  5AVB D;  3AZF D;  2Y2M A;  5AVC D;  1P3O C;  5GXQ C;  1M19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...