3REJB

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejB00
5CPIB 5AV8A 5AY8D 5E5AC 2BYKB 3B6GD 4X23B 5JA4A 1P34D 4R8PC 4NE5A 1H3OB 3TU4A 3AV2B 3AZLB 5AV6B 5B33D 4JJNB 3AFAB 3MGPA 1P3AB 2HUEB 3O62C 4UUZA 4J8WA 3V9RA 5E5AD 3WKJA 4KGCA 1P3GB 5CPIC 1JFIB 2YFVA 4QLCA 4X23C 5B1LA 3KXBA 3AZMC 5B0ZB 3AZHA 3AN2D 1BH8A 3AV2C 3AZLC 5AV6C 4JJNC 1P3AC 3AFAC 2F8NH 2F8NA 2HUEC 5B24A 3VH5A 3AZIA 5CPJA 5B2IA 5CPID 4YM6B 3KWQA 5B31B 4X23D 1P3GC 1EQZB 4AWLB 1P3OA 5AVCB 5CP6B 3AV2D 3X1UC 5AV6D 4JJND 3AZLD 3AFAD 1P3AD 2NQBB 5AVBA 4Z5TB 2CWEA 1HTAA 5B0ZC 1KX4A 1P3FA 4CSRA 1P3GD 3NQUA 5GT3B 3KUYA 4YM6C 5B31C 3B6FC 3B0CT 5B0ZD 2NZDB 4H9NA 5JRGA 3W96A 5AVCC 4AWLC 1M18C 3AZEB 2NQBC 5G49A 3X1SB 3AZJA 2PYOB 4YM6D 3UTAB 5B31D 4KHAA 4J8UA 5GT3C 1EQZD 3REJD 5CP6D 2NQBD 3MNNB 4ZBJB 4Z5TD 4Z2MH 2CV5A 2NZDC 3AZEC 3X1SC 2PYOC 5GT3D 1TAFB 4ZUXA 3UTAC 4J8XB 4CAYB 5KDMB 3AZMA 1P3BC 2NZDD 5BNVA 3AZED 3X1SD 3MNNC 2PYOD 3UTAD 5JA4B 2RVQC 3MGPB 5DNMB 3MNND 4UUZB 5BS7C 2BYMA 3V9RB 2YFWA 4J8WB 3WKJB 4KGCB 2YFVB 5AV8C 2LY8A 2RVQD 3C1CA 4QLCB 5B1LB 4J8XD 4WNNA 3KXBB 3B6FA 3AZHB 1KX5D 1BH8B 3TU4C 3MGPC 1ZLAA 5B24B 3AZIB 5CPJB 4E44A 5B2IB 3KWQB 3WKJC 4H9QA 3X1VA 1P3OB 3R45A 4LD9A 3MGPD 5AVBB 4QLCC 5B1LC 3KXBC 5DNMD 5AV5A 3AZHC 1KX4B 1P3FB 4J8WD 4CSRB 3WKJD 3WAAA 5B24C 4KGCD 3NQUB 3KUYB 5B2IC 3MVDA 3KWQC 4QLCD 5B1LD 2AROC 3KXBD 1U35A 3AZNA 3AZHD 4H9NB 5JRGB 1S32C 1P3OC 3W96B 3W99A 4XUJA 5G49B 5AVBC 3AZID 5CPJD 3AZJB 5B2ID 1KX4C 1P3FC 3KWQD 4KHAB 4J8UB 1P3MD 3KUYC 1P3OD 1P3IA 4WU8A 3MGRA 5AVBD 4DRBA 2CV5B 5GT0A 1KX4D 5C3IB 3W96C 1P3FD 3AZJC 3KUYD 5DNNA 4ZUXB 1KX3D 4J8UC 5B0YD 3AZMB 5B32C 5BNVB 5JRGD 5BO0A 3AZKA 2CV5C 4H9PB 3AZJD 3WTPE 5C3IC 4R8PD 4J8UD 3X1UB 4ZUXC 1P3PA 1M18B 1ID3A 3A6NA 3O62D 2CV5D 2YFWB 3B0CW 1KU5A 3C1CB 3B6FB 4WNNB 3LELA 2AROA 3AZMD 1S32A 1ZLAB 1P3LC 5B40A 3KSYA 4EO5C 4H9QB 3X1VB 1F66A 3R45B 2L5AA 3C1CC 4LD9B 3X1UD 3AZGA 5F99A 5AV5B 4NE3A 3WAAB 3REHA 1ZLAC 3UTBA 3MGQA 3MVDB 2FJ7A 3C1CD 3B6FD 1U35B 3AV1A 3X1VC 3AZNB 1P3BB 5B32A 3W99B 4XUJB 4YS3A 5AVCD 1M18D 4LD9C 1ZLAD 5AV5C 3WAAC 3AZFA 4H9OA 3REKA 3B6GA 3MVDC 2IO5B 1P3IB 1P34A 4LD9D 3MGRB 1M19C 1U35C 1AOIA 5AV5D 5GT0B 3AZNC 3W99C 5FUGA 4XUJC 3WAAD 1B6WA 3VH6T 5DNNB 5AV8B 3MVDD 1U35D 3TU4B 3AZND 1P3BD 4Z66A 1TZYA 2IO5C 1P3IC 4XUJD 5AV9A 5BO0B 1P3LA 4WU8C 3MGRC 3RELA 1BFMA 5B2JA 4M6BA 3W97A 3AZKB 5GT0C 5B31G 4NE6A 5DNNC 1P3PB 1P3ID 3MGRD 3A6NB 2HIOA 2F8NB 5BT1C 3AZKC 3UT9A 5DNND 5AV8D 5BNXA 3LELB 2AROB 3NQJA 1S32B 3TU4D 3VH5T 1P3PC 4H9SA 1ID3C 3AYWA 3A6NC 3AZKD 5B40B 1N1JA 3WTPA 2JSSA 1F66B 1P3PD 4G92B 5F99B 3AZGB 3LELC 1M19A 1EQZA 1BH9A 3A6ND 3REJA 5CP6A 3REHB 1WWSA 2F8ND 1B67A 3UTBB 5B24D 4NFTA 3MGQB 1WWIA 5B40C 2FJ7B 1HQ3A 3LELD 3AV1B 5CPKA 2AROD 1F1EA 4XZQA 5B32B 1F66C 4YS3B 1S32D 4G92C 5F99C 3AZGC 5B40D 3WA9C 3REHC 1R4VA 3AZFB 3UTBC 1M1AA 4H9OB 3REKB 3MGQC 1F66D 4J8VA 3B0BA 2FJ7C 3AZGD 5F99D 3AV1C 1AOIB 3B0DC 5FUGB 4YS3C 3W96D 5B1MA 3REHD 3C1BA 3UTBD 3MGQD 1P3KA 2FJ7D 3AZFC 3AV1D 3REKC 3B6GC 4Z66B 1TZYB 5B32D 2F8NG 3VH6A 5CHLB 5AV9B 4YS3D 1P34C 1P3LB 3RELB 5B2JB 1KX5A 3W97B 1AOIC 2BYMB 4EO5B 3AZFD 4WZSB 3W98A 3REKD 4ZUXD 3LZ1A 2HIOB 1AOID 4Z66C 1TZYC 4E45A 4KUDA 5AV9C 5DNMA 3RELC 4WU9A 5B2JC 3AN2C 3W97C 3LZ0A 3UT9B 5GXQA 4H9RA 5BNXB 3NQJB 3MGSA 4Z66D 1TZYD 5AV9D 1P3LD 3AYWB 3RELD 5B2JD 3REIA 2HIOC 3W97D 1N1JB 3X1TA 3WA9A 3WTPB 5GSUA 5B32G 3UT9C 3VH6W 1P3MA 4Z2MG 1M19B 1BH9B 3REJB 2HIOD 4H9SC 3AYWC 3UT9D 1HQ3B 3WTPC 3LJAA 5CPKB 4XZQB 3X1VD 5AY8A 4G91B 1KX3A 5B0YA 4WU8B 3AYWD 1EQZC 3REJC 5B33A 5CP6C 4Z5TC 3WTPD 1M1AB 5E5AA 4J8VB 1HQ3C 4WV4B 4R8PA 5CPKC 1M19D 4XZQC 2F8NK 4G91C 5B1MB 3W99D 3VH5W 3C1BB 3O62A 3AN2A 1P3KB 1HQ3D 1M1AC 1A7WA 5CPKD 5CPIA 4XZQD 4J8VC 2BYKA 4X23A 1ID3B 1KX5B 4WU8D 1H3OA 3AV2A 3AZLA 5AV6A 5GT0D 4JJNA 3AFAA 1P3AA 5B1MC 4ZBJC 3W98B 3C1BC 1M1AD 4H9PA 4J8VD 4HGAB 1P3KC 3LZ1B 1Q9CA 1P3GA 4DRAA 1JFIA 3X1UA 4KUDB 4J8XC 5B1MD 5BT1D 4WU9B 1KX5C 3C1BD 5B0ZA 3LZ0B 5GXQB 4H9RB 1P3KD 3W98C 3MGSB 4YM6A 5B31A 4HGAC 3LZ1C 3REIB 1ID3D 3X1TB 5AVCA 1M18A 2NQBA 3WA9B 4KUDC 4Z5TA 5GSUB 5DNMC 4WU9C 3W98D 3LZ0C 4J8WC 5GXQC 1P3MB 4KGCC 3LZ1D 3B0DB 5GT3A 3MGSC 4KUDD 4WU9D 3REIC 3LZ0D 2NZDA 5GXQD 3X1TC 3AZEA 3LJAB 3X1SA 3AZIC 5CPJC 5GSUC 5AY8B 2PYOA 3B6GB 3MGSD 1KX3B 3UTAA 1P34B 5B0YB 1P3MC 1P3BA 3REID 5B33B 3X1TD 3WA9D 3MNNA 5GSUD 5E5AB 4R8PB 3LJAC 1ULYA 5AY8C 1TAFA 1KX3C 4J8XA 5B0YC 3O62B 4CAYA 3AN2B 5KDMA 5BS7A 5JRGC 5B33C 3LJAD
chains in the Genus database with same CATH superfamily
2DF4C 5CPIB 5AV8A 5AY8D 5E5AC 2BYKB 3B6GD 4X23B 5JA4A 1P34D 4R8PC 4NE5A 1H3OB 3TU4A 3AV2B 3AZLB 5AV6B 5B33D 4JJNB 3AFAB 3MGPA 1P3AB 2HUEB 3O62C 4UUZA 4J8WA 3V9RA 5E5AD 3WKJA 4KGCA 1P3GB 5CPIC 1JFIB 2YFVA 4QLCA 4X23C 5B1LA 3KXBA 3AZMC 5B0ZB 3AZHA 3AN2D 1BH8A 3AV2C 3AZLC 5AV6C 4JJNC 1P3AC 3AFAC 2F8NH 2F8NA 2HUEC 5B24A 3EPHA 3VH5A 3AZIA 5CPJA 5B2IA 5CPID 4YM6B 3KWQA 5B31B 4X23D 1P3GC 1EQZB 4AWLB 1P3OA 5AVCB 5CP6B 3AV2D 3X1UC 5AV6D 4JJND 3AZLD 3AFAD 1P3AD 2NQBB 5AVBA 4Z5TB 1PZRA 2CWEA 1HTAA 5B0ZC 1KX4A 1P3FA 1T3UA 4CSRA 1P3GD 3NQUA 5GT3B 3KUYA 4YM6C 5B31C 3B6FC 3B0CT 5B0ZD 2NZDB 4H9NA 5JRGA 3W96A 5AVCC 4AWLC 1M18C 3AZEB 2NQBC 5G49A 3X1SB 3AZJA 3F6TA 2PYOB 4YM6D 3UTAB 5B31D 4KHAA 4J8UA 5GT3C 1EQZD 3REJD 5CP6D 2NQBD 2Y2KA 4ZBJB 4Z5TD 4Z2MH 3MNNB 2CV5A 2NZDC 3AZEC 2JE5A 2Y2QA 3X1SC 2PYOC 5GT3D 1TAFB 2Y2HA 4ZUXA 3UTAC 4J8XB 4CAYB 5KDMB 3AZMA 1P3BC 2NZDD 5BNVA 3AZED 3X1SD 3MNNC 2PYOD 2XD5A 3UTAD 5JA4B 2RIQA 1Z2CB 2RVQC 3MGPB 5DNMB 3MNND 4UUZB 5BS7C 2BYMA 3V9RB 2YFWA 4J8WB 3WKJB 4KGCB 4UPKA 2YFVB 5AV8C 2LY8A 2RVQD 3C1CA 4QLCB 5B1LB 4J8XD 4WNNA 3KXBB 3B6FA 3AZHB 1KX5D 1BH8B 3TU4C 3MGPC 3EPKA 1ZLAA 5B24B 3AZIB 5CPJB 4E44A 5B2IB 3KWQB 3WKJC 4H9QA 3H0MC 3X1VA 1P3OB 3R45A 4LD9A 3MGPD 5AVBB 4QLCC 5B1LC 3KXBC 5DNMD 5AV5A 3AZHC 1KX4B 1P3FB 4J8WD 4CSRB 3WKJD 3WAAA 5B24C 4KGCD 3NQUB 3KUYB 5B2IC 3MVDA 3KWQC 2G5IC 4QLCD 5B1LD 2AROC 3KXBD 1U35A 3AZNA 3AZHD 4H9NB 5JRGB 1S32C 1P3OC 3W96B 3W99A 4XUJA 5G49B 5AVBC 3AZID 5CPJD 3AZJB 5B2ID 1KX4C 1P3FC 3KWQD 3H0LC 4KHAB 4J8UB 1P3MD 3H0RC 3KUYC 1P3OD 1P3IA 2J8PA 4WU8A 5AVBD 3MGRA 4DRBA 2CV5B 5GT0A 1KX4D 5C3IB 3W96C 1P3FD 3AZJC 3KUYD 5DNNA 4ZUXB 1KX3D 2Y2JA 4J8UC 5B0YD 3AZMB 5B32C 5BNVB 5JRGD 2Y2MA 5BO0A 3AZKA 2CV5C 4H9PB 3AZJD 3WTPE 5C3IC 4R8PD 4J8UD 3X1UB 4ZUXC 1P3PA 1M18B 1ID3A 3A6NA 3O62D 2CV5D 2YFWB 3B0CW 1KU5A 1W2EA 3C1CB 2ZM5A 3B6FB 4WNNB 3LELA 2AROA 3AZMD 1S32A 1ZLAB 1P3LC 2FFFB 5B40A 3KSYA 4EO5C 4H9QB 2Y2OA 3X1VB 1F66A 3R45B 2L5AA 3C1CC 4LD9B 3X1UD 3AZGA 5F99A 5AV5B 4DQYB 4NE3A 3WAAB 2G5HC 3REHA 1ZLAC 3UTBA 3MGQA 3MVDB 3IP4C 2FJ7A 3C1CD 3B6FD 2ZY4A 3AV1A 3X1VC 1U35B 3AZNB 1P3BB 5B32A 3W99B 4XUJB 4YS3A 5AVCD 1M18D 4LD9C 1ZLAD 5AV5C 3EPJA 3WAAC 3AZFA 3A1KA 4H9OA 3REKA 3B6GA 3MVDC 2IO5B 1P3IB 1P34A 4LD9D 2UWXA 3MGRB 1M19C 1U35C 1AOIA 5AV5D 2ZY5A 5GT0B 3AZNC 3W99C 5FUGA 4XUJC 3WAAD 1B6WA 3VH6T 5DNNB 5AV8B 3MVDD 3EPLA 1U35D 3TU4B 3AZND 1P3BD 4Z66A 1TZYA 2IO5C 1P3IC 4XUJD 5AV9A 5BO0B 1P3LA 4WU8C 2XD1A 3MGRC 3RELA 5B2JA 4WJ3C 4M6BA 3W97A 3AZKB 1BFMA 5GT0C 5B31G 4NE6A 5DNNC 1P3PB 1P3ID 3MGRD 3A6NB 2HIOA 2F8NB 5BT1C 2JCHA 3AZKC 3UT9A 5DNND 5AV8D 5BNXA 3LELB 2AROB 3NQJA 1S32B 3TU4D 3VH5T 1P3PC 2DQNC 4H9SA 1ID3C 3AYWA 3A6NC 3AZKD 5B40B 1N1JA 3WTPA 2JSSA 1F66B 1P3PD 4G92B 5F99B 3AZGB 3LELC 2Y2NA 1M19A 1BH9A 3A6ND 3REJA 1EQZA 5CP6A 3REHB 1WWSA 2F8ND 1B67A 3UTBB 5B24D 4NFTA 3MGQB 1WWIA 5B40C 2Y2LA 2FJ7B 1HQ3A 3LELD 3AV1B 5CPKA 2AROD 1F1EA 4XZQA 5B32B 1F66C 4YS3B 1S32D 4G92C 5F99C 3AZGC 5B40D 3WA9C 3REHC 1R4VA 3AZFB 3UTBC 1M1AA 4H9OB 3REKB 3MGQC 1F66D 3KFUG 4J8VA 3B0BA 2FJ7C 3AZGD 5F99D 3AV1C 1AOIB 3B0DC 5FUGB 4YS3C 3W96D 5B1MA 3REHD 3C1BA 3UTBD 3MGQD 1P3KA 2FJ7D 3AZFC 3AV1D 2Y2IA 3FDDA 3REKC 3B6GC 4Z66B 1TZYB 5B32D 2F8NG 3VH6A 5CHLB 5AV9B 4YS3D 1P34C 1P3LB 3RELB 5B2JB 1KX5A 3W97B 1AOIC 2BYMB 4EO5B 2Y2PA 3AZFD 4WZSB 3W98A 3REKD 4ZUXD 3A1IA 3LZ1A 2HIOB 1AOID 4Z66C 1TZYC 4E45A 4KUDA 5AV9C 5DNMA 3RELC 4WU9A 5B2JC 3AN2C 3W97C 3LZ0A 3UT9B 5GXQA 4H9RA 5BNXB 3NQJB 3MGSA 4Z66D 1TZYD 5AV9D 1P3LD 3AYWB 3RELD 5B2JD 3REIA 2HIOC 3W97D 1N1JB 3X1TA 3WA9A 3WTPB 5GSUA 5B32G 3UT9C 3VH6W 2ZY2A 1P3MA 2F2AC 4Z2MG 3P5JB 1M19B 1BH9B 3REJB 2HIOD 4H9SC 3AYWC 3UT9D 2W8SA 3EG5B 1HQ3B 3WTPC 3LJAA 5CPKB 4XZQB 3X1VD 5AY8A 4G91B 2VQRA 1KX3A 5B0YA 4WU8B 3AYWD 1EQZC 3REJC 5B33A 5CP6C 4Z5TC 3WTPD 1M1AB 5E5AA 4J8VB 1HQ3C 4WV4B 4R8PA 5CPKC 1M19D 4XZQC 2F8NK 4G91C 5B1MB 3W99D 3VH5W 3C1BB 3O62A 3AN2A 1P3KB 1HQ3D 1M1AC 1A7WA 5CPKD 5CPIA 4XZQD 4J8VC 2BYKA 4X23A 1ID3B 1KX5B 4WU8D 1H3OA 3AV2A 3AZLA 5AV6A 5GT0D 4JJNA 3AFAA 1P3AA 5B1MC 4ZBJC 3W98B 3C1BC 1M1AD 4H9PA 4J8VD 4HGAB 1P3KC 3LZ1B 1Q9CA 1P3GA 4DRAA 1JFIA 3X1UA 4KUDB 4J8XC 5B1MD 5BT1D 4WU9B 2ZY3A 1KX5C 3C1BD 5B0ZA 3LZ0B 5GXQB 4H9RB 1P3KD 3W98C 3MGSB 4YM6A 3AL0C 5B31A 4HGAC 3LZ1C 3REIB 1ID3D 3X1TB 5AVCA 1M18A 2NQBA 3WA9B 4KUDC 4Z5TA 5GSUB 5DNMC 4WU9C 3W98D 3LZ0C 4J8WC 5GXQC 2BG1A 1P3MB 4KGCC 3LZ1D 3B0DB 5GT3A 3MGSC 4KUDD 4WU9D 3REIC 3LZ0D 2NZDA 5GXQD 3X1TC 3AZEA 2Y2GA 3LJAB 3X1SA 3AZIC 5CPJC 5GSUC 5AY8B 2PYOA 3B6GB 3MGSD 1KX3B 3UTAA 1P34B 5B0YB 1P3MC 1P3BA 3REID 5B33B 3X1TD 3WA9D 3MNNA 5GSUD 5E5AB 4R8PB 3LJAC 1ULYA 5AY8C 1TAFA 1KX3C 4J8XA 5B0YC 3O62B 4CAYA 3AN2B 5KDMA 5BS7A 5JRGC 5B33C 3LJAD
chains in the Genus database with same CATH topology
2DF4C 5CPIB 5AV8A 5AY8D 5E5AC 2BYKB 3B6GD 4X23B 5JA4A 1P34D 4R8PC 4NE5A 1H3OB 3TU4A 3AV2B 3AZLB 5AV6B 5B33D 4JJNB 3AFAB 3MGPA 1P3AB 2HUEB 3O62C 4UUZA 4J8WA 3V9RA 5E5AD 3WKJA 4KGCA 1P3GB 5CPIC 1JFIB 2YFVA 4QLCA 4X23C 5B1LA 3KXBA 3AZMC 5B0ZB 3AZHA 3AN2D 1BH8A 3AV2C 3AZLC 5AV6C 4JJNC 1P3AC 3AFAC 2F8NH 2F8NA 2HUEC 5B24A 3EPHA 3VH5A 3AZIA 5CPJA 5B2IA 5CPID 4YM6B 3KWQA 5B31B 4X23D 1P3GC 1EQZB 4AWLB 1P3OA 5AVCB 5CP6B 3AV2D 3X1UC 5AV6D 4JJND 3AZLD 3AFAD 1P3AD 2NQBB 5AVBA 4Z5TB 1PZRA 2CWEA 1HTAA 5B0ZC 1KX4A 1P3FA 1T3UA 4CSRA 1P3GD 3NQUA 5GT3B 3KUYA 4YM6C 5B31C 3B6FC 3B0CT 5B0ZD 2NZDB 4H9NA 5JRGA 3W96A 5AVCC 4AWLC 1M18C 3AZEB 2NQBC 5G49A 3X1SB 3AZJA 3F6TA 2PYOB 4YM6D 3UTAB 5B31D 4KHAA 4J8UA 5GT3C 1EQZD 3REJD 5CP6D 2NQBD 2Y2KA 4ZBJB 4Z5TD 4Z2MH 3MNNB 2CV5A 2NZDC 3AZEC 2JE5A 2Y2QA 3X1SC 2PYOC 5GT3D 1TAFB 2Y2HA 4ZUXA 3UTAC 4J8XB 4CAYB 5KDMB 3AZMA 1P3BC 2NZDD 5BNVA 3AZED 3X1SD 3MNNC 2PYOD 2XD5A 3UTAD 5JA4B 2RIQA 1Z2CB 2RVQC 3MGPB 5DNMB 3MNND 4UUZB 5BS7C 2BYMA 3V9RB 2YFWA 4J8WB 3WKJB 4KGCB 4UPKA 2YFVB 5AV8C 2LY8A 2RVQD 3C1CA 4QLCB 5B1LB 4J8XD 4WNNA 3KXBB 3B6FA 3AZHB 1KX5D 1BH8B 3TU4C 3MGPC 3EPKA 1ZLAA 5B24B 3AZIB 5CPJB 4E44A 5B2IB 3KWQB 3WKJC 4H9QA 3H0MC 3X1VA 1P3OB 3R45A 4LD9A 3MGPD 5AVBB 4QLCC 5B1LC 3KXBC 5DNMD 5AV5A 3AZHC 1KX4B 1P3FB 4J8WD 4CSRB 3WKJD 3WAAA 5B24C 4KGCD 3NQUB 3KUYB 5B2IC 3MVDA 3KWQC 2G5IC 4QLCD 5B1LD 2AROC 3KXBD 1U35A 3AZNA 3AZHD 4H9NB 5JRGB 1S32C 1P3OC 3W96B 3W99A 4XUJA 5G49B 5AVBC 3AZID 5CPJD 3AZJB 5B2ID 1KX4C 1P3FC 3KWQD 3H0LC 4KHAB 4J8UB 1P3MD 3H0RC 3KUYC 1P3OD 1P3IA 2J8PA 4WU8A 5AVBD 3MGRA 4DRBA 2CV5B 5GT0A 1KX4D 5C3IB 3W96C 1P3FD 3AZJC 3KUYD 5DNNA 4ZUXB 1KX3D 2Y2JA 4J8UC 5B0YD 3AZMB 5B32C 5BNVB 5JRGD 2Y2MA 5BO0A 3AZKA 2CV5C 4H9PB 3AZJD 3WTPE 5C3IC 4R8PD 4J8UD 3X1UB 4ZUXC 1P3PA 1M18B 1ID3A 3A6NA 3O62D 2CV5D 2YFWB 3B0CW 1KU5A 1W2EA 3C1CB 2ZM5A 3B6FB 4WNNB 3LELA 2AROA 3AZMD 1S32A 1ZLAB 1P3LC 2FFFB 5B40A 3KSYA 4EO5C 4H9QB 2Y2OA 3X1VB 1F66A 3R45B 2L5AA 3C1CC 4LD9B 3X1UD 3AZGA 5F99A 5AV5B 4DQYB 4NE3A 3WAAB 2G5HC 3REHA 1ZLAC 3UTBA 3MGQA 3MVDB 3IP4C 2FJ7A 3C1CD 3B6FD 2ZY4A 3AV1A 3X1VC 1U35B 3AZNB 1P3BB 5B32A 3W99B 4XUJB 4YS3A 5AVCD 1M18D 4LD9C 1ZLAD 5AV5C 3EPJA 3WAAC 3AZFA 3A1KA 4H9OA 3REKA 3B6GA 3MVDC 2IO5B 1P3IB 1P34A 4LD9D 2UWXA 3MGRB 1M19C 1U35C 1AOIA 5AV5D 2ZY5A 5GT0B 3AZNC 3W99C 5FUGA 4XUJC 3WAAD 1B6WA 3VH6T 5DNNB 5AV8B 3MVDD 3EPLA 1U35D 3TU4B 3AZND 1P3BD 4Z66A 1TZYA 2IO5C 1P3IC 4XUJD 5AV9A 5BO0B 1P3LA 4WU8C 2XD1A 3MGRC 3RELA 5B2JA 4WJ3C 4M6BA 3W97A 3AZKB 1BFMA 5GT0C 5B31G 4NE6A 5DNNC 1P3PB 1P3ID 3MGRD 3A6NB 2HIOA 2F8NB 5BT1C 2JCHA 3AZKC 3UT9A 5DNND 5AV8D 5BNXA 3LELB 2AROB 3NQJA 1S32B 3TU4D 3VH5T 1P3PC 2DQNC 4H9SA 1ID3C 3AYWA 3A6NC 3AZKD 5B40B 1N1JA 3WTPA 2JSSA 1F66B 1P3PD 4G92B 5F99B 3AZGB 3LELC 2Y2NA 1M19A 1BH9A 3A6ND 3REJA 1EQZA 5CP6A 3REHB 1WWSA 2F8ND 1B67A 3UTBB 5B24D 4NFTA 3MGQB 1WWIA 5B40C 2Y2LA 2FJ7B 1HQ3A 3LELD 3AV1B 5CPKA 2AROD 1F1EA 4XZQA 5B32B 1F66C 4YS3B 1S32D 4G92C 5F99C 3AZGC 5B40D 3WA9C 3REHC 1R4VA 3AZFB 3UTBC 1M1AA 4H9OB 3REKB 3MGQC 1F66D 3KFUG 4J8VA 3B0BA 2FJ7C 3AZGD 5F99D 3AV1C 1AOIB 3B0DC 5FUGB 4YS3C 3W96D 5B1MA 3REHD 3C1BA 3UTBD 3MGQD 1P3KA 2FJ7D 3AZFC 3AV1D 2Y2IA 3FDDA 3REKC 3B6GC 4Z66B 1TZYB 5B32D 2F8NG 3VH6A 5CHLB 5AV9B 4YS3D 1P34C 1P3LB 3RELB 5B2JB 1KX5A 3W97B 1AOIC 2BYMB 4EO5B 2Y2PA 3AZFD 4WZSB 3W98A 3REKD 4ZUXD 3A1IA 3LZ1A 2HIOB 1AOID 4Z66C 1TZYC 4E45A 4KUDA 5AV9C 5DNMA 3RELC 4WU9A 5B2JC 3AN2C 3W97C 3LZ0A 3UT9B 5GXQA 4H9RA 5BNXB 3NQJB 3MGSA 4Z66D 1TZYD 5AV9D 1P3LD 3AYWB 3RELD 5B2JD 3REIA 2HIOC 3W97D 1N1JB 3X1TA 3WA9A 3WTPB 5GSUA 5B32G 3UT9C 3VH6W 2ZY2A 1P3MA 2F2AC 4Z2MG 3P5JB 1M19B 1BH9B 3REJB 2HIOD 4H9SC 3AYWC 3UT9D 2W8SA 3EG5B 1HQ3B 3WTPC 3LJAA 5CPKB 4XZQB 3X1VD 5AY8A 4G91B 2VQRA 1KX3A 5B0YA 4WU8B 3AYWD 1EQZC 3REJC 5B33A 5CP6C 4Z5TC 3WTPD 1M1AB 5E5AA 4J8VB 1HQ3C 4WV4B 4R8PA 5CPKC 1M19D 4XZQC 2F8NK 4G91C 5B1MB 3W99D 3VH5W 3C1BB 3O62A 3AN2A 1P3KB 1HQ3D 1M1AC 1A7WA 5CPKD 5CPIA 4XZQD 4J8VC 2BYKA 4X23A 1ID3B 1KX5B 4WU8D 1H3OA 3AV2A 3AZLA 5AV6A 5GT0D 4JJNA 3AFAA 1P3AA 5B1MC 4ZBJC 3W98B 3C1BC 1M1AD 4H9PA 4J8VD 4HGAB 1P3KC 3LZ1B 1Q9CA 1P3GA 4DRAA 1JFIA 3X1UA 4KUDB 4J8XC 5B1MD 5BT1D 4WU9B 2ZY3A 1KX5C 3C1BD 5B0ZA 3LZ0B 5GXQB 4H9RB 1P3KD 3W98C 3MGSB 4YM6A 3AL0C 5B31A 4HGAC 3LZ1C 3REIB 1ID3D 3X1TB 5AVCA 1M18A 2NQBA 3WA9B 4KUDC 4Z5TA 5GSUB 5DNMC 4WU9C 3W98D 3LZ0C 4J8WC 5GXQC 2BG1A 1P3MB 4KGCC 3LZ1D 3B0DB 5GT3A 3MGSC 4KUDD 4WU9D 3REIC 3LZ0D 2NZDA 5GXQD 3X1TC 3AZEA 2Y2GA 3LJAB 3X1SA 3AZIC 5CPJC 5GSUC 5AY8B 2PYOA 3B6GB 3MGSD 1KX3B 3UTAA 1P34B 5B0YB 1P3MC 1P3BA 3REID 5B33B 3X1TD 3WA9D 3MNNA 5GSUD 5E5AB 4R8PB 3LJAC 1ULYA 5AY8C 1TAFA 1KX3C 4J8XA 5B0YC 3O62B 4CAYA 3AN2B 5KDMA 5BS7A 5JRGC 5B33C 3LJAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI B;  5AV8 A;  5AY8 D;  5E5A C;  2BYK B;  3B6G D;  4X23 B;  5JA4 A;  1P34 D;  4R8P C;  4NE5 A;  1H3O B;  3TU4 A;  3AV2 B;  3AZL B;  5AV6 B;  5B33 D;  4JJN B;  3AFA B;  3MGP A;  1P3A B;  2HUE B;  3O62 C;  4UUZ A;  4J8W A;  3V9R A;  5E5A D;  3WKJ A;  4KGC A;  1P3G B;  5CPI C;  1JFI B;  2YFV A;  4QLC A;  4X23 C;  5B1L A;  3KXB A;  3AZM C;  5B0Z B;  3AZH A;  3AN2 D;  1BH8 A;  3AV2 C;  3AZL C;  5AV6 C;  4JJN C;  1P3A C;  3AFA C;  2F8N H;  2F8N A;  2HUE C;  5B24 A;  3VH5 A;  3AZI A;  5CPJ A;  5B2I A;  5CPI D;  4YM6 B;  3KWQ A;  5B31 B;  4X23 D;  1P3G C;  1EQZ B;  4AWL B;  1P3O A;  5AVC B;  5CP6 B;  3AV2 D;  3X1U C;  5AV6 D;  4JJN D;  3AZL D;  3AFA D;  1P3A D;  2NQB B;  5AVB A;  4Z5T B;  2CWE A;  1HTA A;  5B0Z C;  1KX4 A;  1P3F A;  4CSR A;  1P3G D;  3NQU A;  5GT3 B;  3KUY A;  4YM6 C;  5B31 C;  3B6F C;  3B0C T;  5B0Z D;  2NZD B;  4H9N A;  5JRG A;  3W96 A;  5AVC C;  4AWL C;  1M18 C;  3AZE B;  2NQB C;  5G49 A;  3X1S B;  3AZJ A;  2PYO B;  4YM6 D;  3UTA B;  5B31 D;  4KHA A;  4J8U A;  5GT3 C;  1EQZ D;  3REJ D;  5CP6 D;  2NQB D;  3MNN B;  4ZBJ B;  4Z5T D;  4Z2M H;  2CV5 A;  2NZD C;  3AZE C;  3X1S C;  2PYO C;  5GT3 D;  1TAF B;  4ZUX A;  3UTA C;  4J8X B;  4CAY B;  5KDM B;  3AZM A;  1P3B C;  2NZD D;  5BNV A;  3AZE D;  3X1S D;  3MNN C;  2PYO D;  3UTA D;  5JA4 B;  2RVQ C;  3MGP B;  5DNM B;  3MNN D;  4UUZ B;  5BS7 C;  2BYM A;  3V9R B;  2YFW A;  4J8W B;  3WKJ B;  4KGC B;  2YFV B;  5AV8 C;  2LY8 A;  2RVQ D;  3C1C A;  4QLC B;  5B1L B;  4J8X D;  4WNN A;  3KXB B;  3B6F A;  3AZH B;  1KX5 D;  1BH8 B;  3TU4 C;  3MGP C;  1ZLA A;  5B24 B;  3AZI B;  5CPJ B;  4E44 A;  5B2I B;  3KWQ B;  3WKJ C;  4H9Q A;  3X1V A;  1P3O B;  3R45 A;  4LD9 A;  3MGP D;  5AVB B;  4QLC C;  5B1L C;  3KXB C;  5DNM D;  5AV5 A;  3AZH C;  1KX4 B;  1P3F B;  4J8W D;  4CSR B;  3WKJ D;  3WAA A;  5B24 C;  4KGC D;  3NQU B;  3KUY B;  5B2I C;  3MVD A;  3KWQ C;  4QLC D;  5B1L D;  2ARO C;  3KXB D;  1U35 A;  3AZN A;  3AZH D;  4H9N B;  5JRG B;  1S32 C;  1P3O C;  3W96 B;  3W99 A;  4XUJ A;  5G49 B;  5AVB C;  3AZI D;  5CPJ D;  3AZJ B;  5B2I D;  1KX4 C;  1P3F C;  3KWQ D;  4KHA B;  4J8U B;  1P3M D;  3KUY C;  1P3O D;  1P3I A;  4WU8 A;  3MGR A;  5AVB D;  4DRB A;  2CV5 B;  5GT0 A;  1KX4 D;  5C3I B;  3W96 C;  1P3F D;  3AZJ C;  3KUY D;  5DNN A;  4ZUX B;  1KX3 D;  4J8U C;  5B0Y D;  3AZM B;  5B32 C;  5BNV B;  5JRG D;  5BO0 A;  3AZK A;  2CV5 C;  4H9P B;  3AZJ D;  3WTP E;  5C3I C;  4R8P D;  4J8U D;  3X1U B;  4ZUX C;  1P3P A;  1M18 B;  1ID3 A;  3A6N A;  3O62 D;  2CV5 D;  2YFW B;  3B0C W;  1KU5 A;  3C1C B;  3B6F B;  4WNN B;  3LEL A;  2ARO A;  3AZM D;  1S32 A;  1ZLA B;  1P3L C;  5B40 A;  3KSY A;  4EO5 C;  4H9Q B;  3X1V B;  1F66 A;  3R45 B;  2L5A A;  3C1C C;  4LD9 B;  3X1U D;  3AZG A;  5F99 A;  5AV5 B;  4NE3 A;  3WAA B;  3REH A;  1ZLA C;  3UTB A;  3MGQ A;  3MVD B;  2FJ7 A;  3C1C D;  3B6F D;  1U35 B;  3AV1 A;  3X1V C;  3AZN B;  1P3B B;  5B32 A;  3W99 B;  4XUJ B;  4YS3 A;  5AVC D;  1M18 D;  4LD9 C;  1ZLA D;  5AV5 C;  3WAA C;  3AZF A;  4H9O A;  3REK A;  3B6G A;  3MVD C;  2IO5 B;  1P3I B;  1P34 A;  4LD9 D;  3MGR B;  1M19 C;  1U35 C;  1AOI A;  5AV5 D;  5GT0 B;  3AZN C;  3W99 C;  5FUG A;  4XUJ C;  3WAA D;  1B6W A;  3VH6 T;  5DNN B;  5AV8 B;  3MVD D;  1U35 D;  3TU4 B;  3AZN D;  1P3B D;  4Z66 A;  1TZY A;  2IO5 C;  1P3I C;  4XUJ D;  5AV9 A;  5BO0 B;  1P3L A;  4WU8 C;  3MGR C;  3REL A;  1BFM A;  5B2J A;  4M6B A;  3W97 A;  3AZK B;  5GT0 C;  5B31 G;  4NE6 A;  5DNN C;  1P3P B;  1P3I D;  3MGR D;  3A6N B;  2HIO A;  2F8N B;  5BT1 C;  3AZK C;  3UT9 A;  5DNN D;  5AV8 D;  5BNX A;  3LEL B;  2ARO B;  3NQJ A;  1S32 B;  3TU4 D;  3VH5 T;  1P3P C;  4H9S A;  1ID3 C;  3AYW A;  3A6N C;  3AZK D;  5B40 B;  1N1J A;  3WTP A;  2JSS A;  1F66 B;  1P3P D;  4G92 B;  5F99 B;  3AZG B;  3LEL C;  1M19 A;  1EQZ A;  1BH9 A;  3A6N D;  3REJ A;  5CP6 A;  3REH B;  1WWS A;  2F8N D;  1B67 A;  3UTB B;  5B24 D;  4NFT A;  3MGQ B;  1WWI A;  5B40 C;  2FJ7 B;  1HQ3 A;  3LEL D;  3AV1 B;  5CPK A;  2ARO D;  1F1E A;  4XZQ A;  5B32 B;  1F66 C;  4YS3 B;  1S32 D;  4G92 C;  5F99 C;  3AZG C;  5B40 D;  3WA9 C;  3REH C;  1R4V A;  3AZF B;  3UTB C;  1M1A A;  4H9O B;  3REK B;  3MGQ C;  1F66 D;  4J8V A;  3B0B A;  2FJ7 C;  3AZG D;  5F99 D;  3AV1 C;  1AOI B;  3B0D C;  5FUG B;  4YS3 C;  3W96 D;  5B1M A;  3REH D;  3C1B A;  3UTB D;  3MGQ D;  1P3K A;  2FJ7 D;  3AZF C;  3AV1 D;  3REK C;  3B6G C;  4Z66 B;  1TZY B;  5B32 D;  2F8N G;  3VH6 A;  5CHL B;  5AV9 B;  4YS3 D;  1P34 C;  1P3L B;  3REL B;  5B2J B;  1KX5 A;  3W97 B;  1AOI C;  2BYM B;  4EO5 B;  3AZF D;  4WZS B;  3W98 A;  3REK D;  4ZUX D;  3LZ1 A;  2HIO B;  1AOI D;  4Z66 C;  1TZY C;  4E45 A;  4KUD A;  5AV9 C;  5DNM A;  3REL C;  4WU9 A;  5B2J C;  3AN2 C;  3W97 C;  3LZ0 A;  3UT9 B;  5GXQ A;  4H9R A;  5BNX B;  3NQJ B;  3MGS A;  4Z66 D;  1TZY D;  5AV9 D;  1P3L D;  3AYW B;  3REL D;  5B2J D;  3REI A;  2HIO C;  3W97 D;  1N1J B;  3X1T A;  3WA9 A;  3WTP B;  5GSU A;  5B32 G;  3UT9 C;  3VH6 W;  1P3M A;  4Z2M G;  1M19 B;  1BH9 B;  3REJ B;  2HIO D;  4H9S C;  3AYW C;  3UT9 D;  1HQ3 B;  3WTP C;  3LJA A;  5CPK B;  4XZQ B;  3X1V D;  5AY8 A;  4G91 B;  1KX3 A;  5B0Y A;  4WU8 B;  3AYW D;  1EQZ C;  3REJ C;  5B33 A;  5CP6 C;  4Z5T C;  3WTP D;  1M1A B;  5E5A A;  4J8V B;  1HQ3 C;  4WV4 B;  4R8P A;  5CPK C;  1M19 D;  4XZQ C;  2F8N K;  4G91 C;  5B1M B;  3W99 D;  3VH5 W;  3C1B B;  3O62 A;  3AN2 A;  1P3K B;  1HQ3 D;  1M1A C;  1A7W A;  5CPK D;  5CPI A;  4XZQ D;  4J8V C;  2BYK A;  4X23 A;  1ID3 B;  1KX5 B;  4WU8 D;  1H3O A;  3AV2 A;  3AZL A;  5AV6 A;  5GT0 D;  4JJN A;  3AFA A;  1P3A A;  5B1M C;  4ZBJ C;  3W98 B;  3C1B C;  1M1A D;  4H9P A;  4J8V D;  4HGA B;  1P3K C;  3LZ1 B;  1Q9C A;  1P3G A;  4DRA A;  1JFI A;  3X1U A;  4KUD B;  4J8X C;  5B1M D;  5BT1 D;  4WU9 B;  1KX5 C;  3C1B D;  5B0Z A;  3LZ0 B;  5GXQ B;  4H9R B;  1P3K D;  3W98 C;  3MGS B;  4YM6 A;  5B31 A;  4HGA C;  3LZ1 C;  3REI B;  1ID3 D;  3X1T B;  5AVC A;  1M18 A;  2NQB A;  3WA9 B;  4KUD C;  4Z5T A;  5GSU B;  5DNM C;  4WU9 C;  3W98 D;  3LZ0 C;  4J8W C;  5GXQ C;  1P3M B;  4KGC C;  3LZ1 D;  3B0D B;  5GT3 A;  3MGS C;  4KUD D;  4WU9 D;  3REI C;  3LZ0 D;  2NZD A;  5GXQ D;  3X1T C;  3AZE A;  3LJA B;  3X1S A;  3AZI C;  5CPJ C;  5GSU C;  5AY8 B;  2PYO A;  3B6G B;  3MGS D;  1KX3 B;  3UTA A;  1P34 B;  5B0Y B;  1P3M C;  1P3B A;  3REI D;  5B33 B;  3X1T D;  3WA9 D;  3MNN A;  5GSU D;  5E5A B;  4R8P B;  3LJA C;  1ULY A;  5AY8 C;  1TAF A;  1KX3 C;  4J8X A;  5B0Y C;  3O62 B;  4CAY A;  3AN2 B;  5KDM A;  5BS7 A;  5JRG C;  5B33 C;  3LJA D; 
#chains in the Genus database with same CATH topology
 2DF4 C;  5CPI B;  5AV8 A;  5AY8 D;  5E5A C;  2BYK B;  3B6G D;  4X23 B;  5JA4 A;  1P34 D;  4R8P C;  4NE5 A;  1H3O B;  3TU4 A;  3AV2 B;  3AZL B;  5AV6 B;  5B33 D;  4JJN B;  3AFA B;  3MGP A;  1P3A B;  2HUE B;  3O62 C;  4UUZ A;  4J8W A;  3V9R A;  5E5A D;  3WKJ A;  4KGC A;  1P3G B;  5CPI C;  1JFI B;  2YFV A;  4QLC A;  4X23 C;  5B1L A;  3KXB A;  3AZM C;  5B0Z B;  3AZH A;  3AN2 D;  1BH8 A;  3AV2 C;  3AZL C;  5AV6 C;  4JJN C;  1P3A C;  3AFA C;  2F8N H;  2F8N A;  2HUE C;  5B24 A;  3EPH A;  3VH5 A;  3AZI A;  5CPJ A;  5B2I A;  5CPI D;  4YM6 B;  3KWQ A;  5B31 B;  4X23 D;  1P3G C;  1EQZ B;  4AWL B;  1P3O A;  5AVC B;  5CP6 B;  3AV2 D;  3X1U C;  5AV6 D;  4JJN D;  3AZL D;  3AFA D;  1P3A D;  2NQB B;  5AVB A;  4Z5T B;  1PZR A;  2CWE A;  1HTA A;  5B0Z C;  1KX4 A;  1P3F A;  1T3U A;  4CSR A;  1P3G D;  3NQU A;  5GT3 B;  3KUY A;  4YM6 C;  5B31 C;  3B6F C;  3B0C T;  5B0Z D;  2NZD B;  4H9N A;  5JRG A;  3W96 A;  5AVC C;  4AWL C;  1M18 C;  3AZE B;  2NQB C;  5G49 A;  3X1S B;  3AZJ A;  3F6T A;  2PYO B;  4YM6 D;  3UTA B;  5B31 D;  4KHA A;  4J8U A;  5GT3 C;  1EQZ D;  3REJ D;  5CP6 D;  2NQB D;  2Y2K A;  4ZBJ B;  4Z5T D;  4Z2M H;  3MNN B;  2CV5 A;  2NZD C;  3AZE C;  2JE5 A;  2Y2Q A;  3X1S C;  2PYO C;  5GT3 D;  1TAF B;  2Y2H A;  4ZUX A;  3UTA C;  4J8X B;  4CAY B;  5KDM B;  3AZM A;  1P3B C;  2NZD D;  5BNV A;  3AZE D;  3X1S D;  3MNN C;  2PYO D;  2XD5 A;  3UTA D;  5JA4 B;  2RIQ A;  1Z2C B;  2RVQ C;  3MGP B;  5DNM B;  3MNN D;  4UUZ B;  5BS7 C;  2BYM A;  3V9R B;  2YFW A;  4J8W B;  3WKJ B;  4KGC B;  4UPK A;  2YFV B;  5AV8 C;  2LY8 A;  2RVQ D;  3C1C A;  4QLC B;  5B1L B;  4J8X D;  4WNN A;  3KXB B;  3B6F A;  3AZH B;  1KX5 D;  1BH8 B;  3TU4 C;  3MGP C;  3EPK A;  1ZLA A;  5B24 B;  3AZI B;  5CPJ B;  4E44 A;  5B2I B;  3KWQ B;  3WKJ C;  4H9Q A;  3H0M C;  3X1V A;  1P3O B;  3R45 A;  4LD9 A;  3MGP D;  5AVB B;  4QLC C;  5B1L C;  3KXB C;  5DNM D;  5AV5 A;  3AZH C;  1KX4 B;  1P3F B;  4J8W D;  4CSR B;  3WKJ D;  3WAA A;  5B24 C;  4KGC D;  3NQU B;  3KUY B;  5B2I C;  3MVD A;  3KWQ C;  2G5I C;  4QLC D;  5B1L D;  2ARO C;  3KXB D;  1U35 A;  3AZN A;  3AZH D;  4H9N B;  5JRG B;  1S32 C;  1P3O C;  3W96 B;  3W99 A;  4XUJ A;  5G49 B;  5AVB C;  3AZI D;  5CPJ D;  3AZJ B;  5B2I D;  1KX4 C;  1P3F C;  3KWQ D;  3H0L C;  4KHA B;  4J8U B;  1P3M D;  3H0R C;  3KUY C;  1P3O D;  1P3I A;  2J8P A;  4WU8 A;  5AVB D;  3MGR A;  4DRB A;  2CV5 B;  5GT0 A;  1KX4 D;  5C3I B;  3W96 C;  1P3F D;  3AZJ C;  3KUY D;  5DNN A;  4ZUX B;  1KX3 D;  2Y2J A;  4J8U C;  5B0Y D;  3AZM B;  5B32 C;  5BNV B;  5JRG D;  2Y2M A;  5BO0 A;  3AZK A;  2CV5 C;  4H9P B;  3AZJ D;  3WTP E;  5C3I C;  4R8P D;  4J8U D;  3X1U B;  4ZUX C;  1P3P A;  1M18 B;  1ID3 A;  3A6N A;  3O62 D;  2CV5 D;  2YFW B;  3B0C W;  1KU5 A;  1W2E A;  3C1C B;  2ZM5 A;  3B6F B;  4WNN B;  3LEL A;  2ARO A;  3AZM D;  1S32 A;  1ZLA B;  1P3L C;  2FFF B;  5B40 A;  3KSY A;  4EO5 C;  4H9Q B;  2Y2O A;  3X1V B;  1F66 A;  3R45 B;  2L5A A;  3C1C C;  4LD9 B;  3X1U D;  3AZG A;  5F99 A;  5AV5 B;  4DQY B;  4NE3 A;  3WAA B;  2G5H C;  3REH A;  1ZLA C;  3UTB A;  3MGQ A;  3MVD B;  3IP4 C;  2FJ7 A;  3C1C D;  3B6F D;  2ZY4 A;  3AV1 A;  3X1V C;  1U35 B;  3AZN B;  1P3B B;  5B32 A;  3W99 B;  4XUJ B;  4YS3 A;  5AVC D;  1M18 D;  4LD9 C;  1ZLA D;  5AV5 C;  3EPJ A;  3WAA C;  3AZF A;  3A1K A;  4H9O A;  3REK A;  3B6G A;  3MVD C;  2IO5 B;  1P3I B;  1P34 A;  4LD9 D;  2UWX A;  3MGR B;  1M19 C;  1U35 C;  1AOI A;  5AV5 D;  2ZY5 A;  5GT0 B;  3AZN C;  3W99 C;  5FUG A;  4XUJ C;  3WAA D;  1B6W A;  3VH6 T;  5DNN B;  5AV8 B;  3MVD D;  3EPL A;  1U35 D;  3TU4 B;  3AZN D;  1P3B D;  4Z66 A;  1TZY A;  2IO5 C;  1P3I C;  4XUJ D;  5AV9 A;  5BO0 B;  1P3L A;  4WU8 C;  2XD1 A;  3MGR C;  3REL A;  5B2J A;  4WJ3 C;  4M6B A;  3W97 A;  3AZK B;  1BFM A;  5GT0 C;  5B31 G;  4NE6 A;  5DNN C;  1P3P B;  1P3I D;  3MGR D;  3A6N B;  2HIO A;  2F8N B;  5BT1 C;  2JCH A;  3AZK C;  3UT9 A;  5DNN D;  5AV8 D;  5BNX A;  3LEL B;  2ARO B;  3NQJ A;  1S32 B;  3TU4 D;  3VH5 T;  1P3P C;  2DQN C;  4H9S A;  1ID3 C;  3AYW A;  3A6N C;  3AZK D;  5B40 B;  1N1J A;  3WTP A;  2JSS A;  1F66 B;  1P3P D;  4G92 B;  5F99 B;  3AZG B;  3LEL C;  2Y2N A;  1M19 A;  1BH9 A;  3A6N D;  3REJ A;  1EQZ A;  5CP6 A;  3REH B;  1WWS A;  2F8N D;  1B67 A;  3UTB B;  5B24 D;  4NFT A;  3MGQ B;  1WWI A;  5B40 C;  2Y2L A;  2FJ7 B;  1HQ3 A;  3LEL D;  3AV1 B;  5CPK A;  2ARO D;  1F1E A;  4XZQ A;  5B32 B;  1F66 C;  4YS3 B;  1S32 D;  4G92 C;  5F99 C;  3AZG C;  5B40 D;  3WA9 C;  3REH C;  1R4V A;  3AZF B;  3UTB C;  1M1A A;  4H9O B;  3REK B;  3MGQ C;  1F66 D;  3KFU G;  4J8V A;  3B0B A;  2FJ7 C;  3AZG D;  5F99 D;  3AV1 C;  1AOI B;  3B0D C;  5FUG B;  4YS3 C;  3W96 D;  5B1M A;  3REH D;  3C1B A;  3UTB D;  3MGQ D;  1P3K A;  2FJ7 D;  3AZF C;  3AV1 D;  2Y2I A;  3FDD A;  3REK C;  3B6G C;  4Z66 B;  1TZY B;  5B32 D;  2F8N G;  3VH6 A;  5CHL B;  5AV9 B;  4YS3 D;  1P34 C;  1P3L B;  3REL B;  5B2J B;  1KX5 A;  3W97 B;  1AOI C;  2BYM B;  4EO5 B;  2Y2P A;  3AZF D;  4WZS B;  3W98 A;  3REK D;  4ZUX D;  3A1I A;  3LZ1 A;  2HIO B;  1AOI D;  4Z66 C;  1TZY C;  4E45 A;  4KUD A;  5AV9 C;  5DNM A;  3REL C;  4WU9 A;  5B2J C;  3AN2 C;  3W97 C;  3LZ0 A;  3UT9 B;  5GXQ A;  4H9R A;  5BNX B;  3NQJ B;  3MGS A;  4Z66 D;  1TZY D;  5AV9 D;  1P3L D;  3AYW B;  3REL D;  5B2J D;  3REI A;  2HIO C;  3W97 D;  1N1J B;  3X1T A;  3WA9 A;  3WTP B;  5GSU A;  5B32 G;  3UT9 C;  3VH6 W;  2ZY2 A;  1P3M A;  2F2A C;  4Z2M G;  3P5J B;  1M19 B;  1BH9 B;  3REJ B;  2HIO D;  4H9S C;  3AYW C;  3UT9 D;  2W8S A;  3EG5 B;  1HQ3 B;  3WTP C;  3LJA A;  5CPK B;  4XZQ B;  3X1V D;  5AY8 A;  4G91 B;  2VQR A;  1KX3 A;  5B0Y A;  4WU8 B;  3AYW D;  1EQZ C;  3REJ C;  5B33 A;  5CP6 C;  4Z5T C;  3WTP D;  1M1A B;  5E5A A;  4J8V B;  1HQ3 C;  4WV4 B;  4R8P A;  5CPK C;  1M19 D;  4XZQ C;  2F8N K;  4G91 C;  5B1M B;  3W99 D;  3VH5 W;  3C1B B;  3O62 A;  3AN2 A;  1P3K B;  1HQ3 D;  1M1A C;  1A7W A;  5CPK D;  5CPI A;  4XZQ D;  4J8V C;  2BYK A;  4X23 A;  1ID3 B;  1KX5 B;  4WU8 D;  1H3O A;  3AV2 A;  3AZL A;  5AV6 A;  5GT0 D;  4JJN A;  3AFA A;  1P3A A;  5B1M C;  4ZBJ C;  3W98 B;  3C1B C;  1M1A D;  4H9P A;  4J8V D;  4HGA B;  1P3K C;  3LZ1 B;  1Q9C A;  1P3G A;  4DRA A;  1JFI A;  3X1U A;  4KUD B;  4J8X C;  5B1M D;  5BT1 D;  4WU9 B;  2ZY3 A;  1KX5 C;  3C1B D;  5B0Z A;  3LZ0 B;  5GXQ B;  4H9R B;  1P3K D;  3W98 C;  3MGS B;  4YM6 A;  3AL0 C;  5B31 A;  4HGA C;  3LZ1 C;  3REI B;  1ID3 D;  3X1T B;  5AVC A;  1M18 A;  2NQB A;  3WA9 B;  4KUD C;  4Z5T A;  5GSU B;  5DNM C;  4WU9 C;  3W98 D;  3LZ0 C;  4J8W C;  5GXQ C;  2BG1 A;  1P3M B;  4KGC C;  3LZ1 D;  3B0D B;  5GT3 A;  3MGS C;  4KUD D;  4WU9 D;  3REI C;  3LZ0 D;  2NZD A;  5GXQ D;  3X1T C;  3AZE A;  2Y2G A;  3LJA B;  3X1S A;  3AZI C;  5CPJ C;  5GSU C;  5AY8 B;  2PYO A;  3B6G B;  3MGS D;  1KX3 B;  3UTA A;  1P34 B;  5B0Y B;  1P3M C;  1P3B A;  3REI D;  5B33 B;  3X1T D;  3WA9 D;  3MNN A;  5GSU D;  5E5A B;  4R8P B;  3LJA C;  1ULY A;  5AY8 C;  1TAF A;  1KX3 C;  4J8X A;  5B0Y C;  3O62 B;  4CAY A;  3AN2 B;  5KDM A;  5BS7 A;  5JRG C;  5B33 C;  3LJA D; 
#chains in the Genus database with same CATH homology
 2DF4 C;  5CPI B;  5AV8 A;  5AY8 D;  5E5A C;  2BYK B;  3B6G D;  4X23 B;  5JA4 A;  1P34 D;  4R8P C;  4NE5 A;  1H3O B;  3TU4 A;  3AV2 B;  3AZL B;  5AV6 B;  5B33 D;  4JJN B;  3AFA B;  3MGP A;  1P3A B;  2HUE B;  3O62 C;  4UUZ A;  4J8W A;  3V9R A;  5E5A D;  3WKJ A;  4KGC A;  1P3G B;  5CPI C;  1JFI B;  2YFV A;  4QLC A;  4X23 C;  5B1L A;  3KXB A;  3AZM C;  5B0Z B;  3AZH A;  3AN2 D;  1BH8 A;  3AV2 C;  3AZL C;  5AV6 C;  4JJN C;  1P3A C;  3AFA C;  2F8N H;  2F8N A;  2HUE C;  5B24 A;  3EPH A;  3VH5 A;  3AZI A;  5CPJ A;  5B2I A;  5CPI D;  4YM6 B;  3KWQ A;  5B31 B;  4X23 D;  1P3G C;  1EQZ B;  4AWL B;  1P3O A;  5AVC B;  5CP6 B;  3AV2 D;  3X1U C;  5AV6 D;  4JJN D;  3AZL D;  3AFA D;  1P3A D;  2NQB B;  5AVB A;  4Z5T B;  1PZR A;  2CWE A;  1HTA A;  5B0Z C;  1KX4 A;  1P3F A;  1T3U A;  4CSR A;  1P3G D;  3NQU A;  5GT3 B;  3KUY A;  4YM6 C;  5B31 C;  3B6F C;  3B0C T;  5B0Z D;  2NZD B;  4H9N A;  5JRG A;  3W96 A;  5AVC C;  4AWL C;  1M18 C;  3AZE B;  2NQB C;  5G49 A;  3X1S B;  3AZJ A;  3F6T A;  2PYO B;  4YM6 D;  3UTA B;  5B31 D;  4KHA A;  4J8U A;  5GT3 C;  1EQZ D;  3REJ D;  5CP6 D;  2NQB D;  2Y2K A;  4ZBJ B;  4Z5T D;  4Z2M H;  3MNN B;  2CV5 A;  2NZD C;  3AZE C;  2JE5 A;  2Y2Q A;  3X1S C;  2PYO C;  5GT3 D;  1TAF B;  2Y2H A;  4ZUX A;  3UTA C;  4J8X B;  4CAY B;  5KDM B;  3AZM A;  1P3B C;  2NZD D;  5BNV A;  3AZE D;  3X1S D;  3MNN C;  2PYO D;  2XD5 A;  3UTA D;  5JA4 B;  2RIQ A;  1Z2C B;  2RVQ C;  3MGP B;  5DNM B;  3MNN D;  4UUZ B;  5BS7 C;  2BYM A;  3V9R B;  2YFW A;  4J8W B;  3WKJ B;  4KGC B;  4UPK A;  2YFV B;  5AV8 C;  2LY8 A;  2RVQ D;  3C1C A;  4QLC B;  5B1L B;  4J8X D;  4WNN A;  3KXB B;  3B6F A;  3AZH B;  1KX5 D;  1BH8 B;  3TU4 C;  3MGP C;  3EPK A;  1ZLA A;  5B24 B;  3AZI B;  5CPJ B;  4E44 A;  5B2I B;  3KWQ B;  3WKJ C;  4H9Q A;  3H0M C;  3X1V A;  1P3O B;  3R45 A;  4LD9 A;  3MGP D;  5AVB B;  4QLC C;  5B1L C;  3KXB C;  5DNM D;  5AV5 A;  3AZH C;  1KX4 B;  1P3F B;  4J8W D;  4CSR B;  3WKJ D;  3WAA A;  5B24 C;  4KGC D;  3NQU B;  3KUY B;  5B2I C;  3MVD A;  3KWQ C;  2G5I C;  4QLC D;  5B1L D;  2ARO C;  3KXB D;  1U35 A;  3AZN A;  3AZH D;  4H9N B;  5JRG B;  1S32 C;  1P3O C;  3W96 B;  3W99 A;  4XUJ A;  5G49 B;  5AVB C;  3AZI D;  5CPJ D;  3AZJ B;  5B2I D;  1KX4 C;  1P3F C;  3KWQ D;  3H0L C;  4KHA B;  4J8U B;  1P3M D;  3H0R C;  3KUY C;  1P3O D;  1P3I A;  2J8P A;  4WU8 A;  5AVB D;  3MGR A;  4DRB A;  2CV5 B;  5GT0 A;  1KX4 D;  5C3I B;  3W96 C;  1P3F D;  3AZJ C;  3KUY D;  5DNN A;  4ZUX B;  1KX3 D;  2Y2J A;  4J8U C;  5B0Y D;  3AZM B;  5B32 C;  5BNV B;  5JRG D;  2Y2M A;  5BO0 A;  3AZK A;  2CV5 C;  4H9P B;  3AZJ D;  3WTP E;  5C3I C;  4R8P D;  4J8U D;  3X1U B;  4ZUX C;  1P3P A;  1M18 B;  1ID3 A;  3A6N A;  3O62 D;  2CV5 D;  2YFW B;  3B0C W;  1KU5 A;  1W2E A;  3C1C B;  2ZM5 A;  3B6F B;  4WNN B;  3LEL A;  2ARO A;  3AZM D;  1S32 A;  1ZLA B;  1P3L C;  2FFF B;  5B40 A;  3KSY A;  4EO5 C;  4H9Q B;  2Y2O A;  3X1V B;  1F66 A;  3R45 B;  2L5A A;  3C1C C;  4LD9 B;  3X1U D;  3AZG A;  5F99 A;  5AV5 B;  4DQY B;  4NE3 A;  3WAA B;  2G5H C;  3REH A;  1ZLA C;  3UTB A;  3MGQ A;  3MVD B;  3IP4 C;  2FJ7 A;  3C1C D;  3B6F D;  2ZY4 A;  3AV1 A;  3X1V C;  1U35 B;  3AZN B;  1P3B B;  5B32 A;  3W99 B;  4XUJ B;  4YS3 A;  5AVC D;  1M18 D;  4LD9 C;  1ZLA D;  5AV5 C;  3EPJ A;  3WAA C;  3AZF A;  3A1K A;  4H9O A;  3REK A;  3B6G A;  3MVD C;  2IO5 B;  1P3I B;  1P34 A;  4LD9 D;  2UWX A;  3MGR B;  1M19 C;  1U35 C;  1AOI A;  5AV5 D;  2ZY5 A;  5GT0 B;  3AZN C;  3W99 C;  5FUG A;  4XUJ C;  3WAA D;  1B6W A;  3VH6 T;  5DNN B;  5AV8 B;  3MVD D;  3EPL A;  1U35 D;  3TU4 B;  3AZN D;  1P3B D;  4Z66 A;  1TZY A;  2IO5 C;  1P3I C;  4XUJ D;  5AV9 A;  5BO0 B;  1P3L A;  4WU8 C;  2XD1 A;  3MGR C;  3REL A;  5B2J A;  4WJ3 C;  4M6B A;  3W97 A;  3AZK B;  1BFM A;  5GT0 C;  5B31 G;  4NE6 A;  5DNN C;  1P3P B;  1P3I D;  3MGR D;  3A6N B;  2HIO A;  2F8N B;  5BT1 C;  2JCH A;  3AZK C;  3UT9 A;  5DNN D;  5AV8 D;  5BNX A;  3LEL B;  2ARO B;  3NQJ A;  1S32 B;  3TU4 D;  3VH5 T;  1P3P C;  2DQN C;  4H9S A;  1ID3 C;  3AYW A;  3A6N C;  3AZK D;  5B40 B;  1N1J A;  3WTP A;  2JSS A;  1F66 B;  1P3P D;  4G92 B;  5F99 B;  3AZG B;  3LEL C;  2Y2N A;  1M19 A;  1BH9 A;  3A6N D;  3REJ A;  1EQZ A;  5CP6 A;  3REH B;  1WWS A;  2F8N D;  1B67 A;  3UTB B;  5B24 D;  4NFT A;  3MGQ B;  1WWI A;  5B40 C;  2Y2L A;  2FJ7 B;  1HQ3 A;  3LEL D;  3AV1 B;  5CPK A;  2ARO D;  1F1E A;  4XZQ A;  5B32 B;  1F66 C;  4YS3 B;  1S32 D;  4G92 C;  5F99 C;  3AZG C;  5B40 D;  3WA9 C;  3REH C;  1R4V A;  3AZF B;  3UTB C;  1M1A A;  4H9O B;  3REK B;  3MGQ C;  1F66 D;  3KFU G;  4J8V A;  3B0B A;  2FJ7 C;  3AZG D;  5F99 D;  3AV1 C;  1AOI B;  3B0D C;  5FUG B;  4YS3 C;  3W96 D;  5B1M A;  3REH D;  3C1B A;  3UTB D;  3MGQ D;  1P3K A;  2FJ7 D;  3AZF C;  3AV1 D;  2Y2I A;  3FDD A;  3REK C;  3B6G C;  4Z66 B;  1TZY B;  5B32 D;  2F8N G;  3VH6 A;  5CHL B;  5AV9 B;  4YS3 D;  1P34 C;  1P3L B;  3REL B;  5B2J B;  1KX5 A;  3W97 B;  1AOI C;  2BYM B;  4EO5 B;  2Y2P A;  3AZF D;  4WZS B;  3W98 A;  3REK D;  4ZUX D;  3A1I A;  3LZ1 A;  2HIO B;  1AOI D;  4Z66 C;  1TZY C;  4E45 A;  4KUD A;  5AV9 C;  5DNM A;  3REL C;  4WU9 A;  5B2J C;  3AN2 C;  3W97 C;  3LZ0 A;  3UT9 B;  5GXQ A;  4H9R A;  5BNX B;  3NQJ B;  3MGS A;  4Z66 D;  1TZY D;  5AV9 D;  1P3L D;  3AYW B;  3REL D;  5B2J D;  3REI A;  2HIO C;  3W97 D;  1N1J B;  3X1T A;  3WA9 A;  3WTP B;  5GSU A;  5B32 G;  3UT9 C;  3VH6 W;  2ZY2 A;  1P3M A;  2F2A C;  4Z2M G;  3P5J B;  1M19 B;  1BH9 B;  3REJ B;  2HIO D;  4H9S C;  3AYW C;  3UT9 D;  2W8S A;  3EG5 B;  1HQ3 B;  3WTP C;  3LJA A;  5CPK B;  4XZQ B;  3X1V D;  5AY8 A;  4G91 B;  2VQR A;  1KX3 A;  5B0Y A;  4WU8 B;  3AYW D;  1EQZ C;  3REJ C;  5B33 A;  5CP6 C;  4Z5T C;  3WTP D;  1M1A B;  5E5A A;  4J8V B;  1HQ3 C;  4WV4 B;  4R8P A;  5CPK C;  1M19 D;  4XZQ C;  2F8N K;  4G91 C;  5B1M B;  3W99 D;  3VH5 W;  3C1B B;  3O62 A;  3AN2 A;  1P3K B;  1HQ3 D;  1M1A C;  1A7W A;  5CPK D;  5CPI A;  4XZQ D;  4J8V C;  2BYK A;  4X23 A;  1ID3 B;  1KX5 B;  4WU8 D;  1H3O A;  3AV2 A;  3AZL A;  5AV6 A;  5GT0 D;  4JJN A;  3AFA A;  1P3A A;  5B1M C;  4ZBJ C;  3W98 B;  3C1B C;  1M1A D;  4H9P A;  4J8V D;  4HGA B;  1P3K C;  3LZ1 B;  1Q9C A;  1P3G A;  4DRA A;  1JFI A;  3X1U A;  4KUD B;  4J8X C;  5B1M D;  5BT1 D;  4WU9 B;  2ZY3 A;  1KX5 C;  3C1B D;  5B0Z A;  3LZ0 B;  5GXQ B;  4H9R B;  1P3K D;  3W98 C;  3MGS B;  4YM6 A;  3AL0 C;  5B31 A;  4HGA C;  3LZ1 C;  3REI B;  1ID3 D;  3X1T B;  5AVC A;  1M18 A;  2NQB A;  3WA9 B;  4KUD C;  4Z5T A;  5GSU B;  5DNM C;  4WU9 C;  3W98 D;  3LZ0 C;  4J8W C;  5GXQ C;  2BG1 A;  1P3M B;  4KGC C;  3LZ1 D;  3B0D B;  5GT3 A;  3MGS C;  4KUD D;  4WU9 D;  3REI C;  3LZ0 D;  2NZD A;  5GXQ D;  3X1T C;  3AZE A;  2Y2G A;  3LJA B;  3X1S A;  3AZI C;  5CPJ C;  5GSU C;  5AY8 B;  2PYO A;  3B6G B;  3MGS D;  1KX3 B;  3UTA A;  1P34 B;  5B0Y B;  1P3M C;  1P3B A;  3REI D;  5B33 B;  3X1T D;  3WA9 D;  3MNN A;  5GSU D;  5E5A B;  4R8P B;  3LJA C;  1ULY A;  5AY8 C;  1TAF A;  1KX3 C;  4J8X A;  5B0Y C;  3O62 B;  4CAY A;  3AN2 B;  5KDM A;  5BS7 A;  5JRG C;  5B33 C;  3LJA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...