3REJB

2.55 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rejB00
3AZGC 3AN2C 5AVBC 3UT9A 1P34C 4H9NA 4M6BA 5GT3D 4HGAB 3X1SC 3B0DB 3REKD 1TZYA 4LD9C 3REID 5G49A 5B24B 4JJNA 5F99B 5GT0A 5B40C 4UUZA 5B40A 1P3PC 1HQ3A 3KWQD 3AZEC 3AZLD 2HIOD 1F66D 5AVCC 5AY8D 2PYOB 1ZLAD 5B32B 3MGQB 3MGSD 5B0ZD 3R45B 1P3KD 4Z5TD 1WWSA 4X23A 1TAFA 1KX3C 1JFIB 2CWEA 4G91B 4H9QB 2HIOC 3VH5A 3V9RB 3MVDC 3WAAA 1P3PB 2NZDD 4CSRB 3C1BD 5B24A 3A6NA 4AWLC 1P3MA 3WTPE 5CPJA 4WU9A 1P3LB 3KWQC 3AZED 3AFAB 2YFVA 4G92C 1M19A 3KSYA 1P3LA 3WA9D 5GSUB 5AV6C 5CPIA 1EQZC 2BYKB 5B1MA 5CPKC 3RELA 3AZMB 4QLCC 1AOIB 4WNNA 3X1UB 5GXQB 5B1LB 3MNND 1M18B 3AV2D 2HIOB 3AZKA 4ZBJB 3X1TD 5AV8B 3A6NB 3RELB 1P34D 1P3AC 5CPIC 5JA4A 3LZ0D 5DNNA 3MGPD 4G91C 1TAFB 4X23B 1JFIA 3AV2C 3W98C 5GT0C 5CP6D 4WU8C 4J8UA 5JRGD 3LZ0C 4J8WA 4YS3A 1BFMA 1M1AC 1F1EA 2FJ7B 4XZQD 1ULYA 3B6FC 4H9PB 3VH5W 3KUYA 3W99A 3MNNA 1BH8A 4WU8A 1P3BB 4HGAC 4YM6D 3W98B 5CPID 4J8VA 5AV5D 4J8VD 3UTBD 3VH6A 1KX4C 1HTAA 5BT1D 3AZLC 5AVCD 3REKB 3W99D 5B1LA 5GXQA 1M18A 3A6ND 3X1TB 1P3FC 4XZQC 3WTPD 3UTAB 3B6FD 1P3AA 4NE3A 5JRGA 3WAAD 1H3OA 2YFWA 4YM6C 4CAYA 5C3IB 5AY8B 4J8VB 2BYKA 5B1MB 3UTBB 1P3ID 4KGCA 4Z2MG 3MGPA 3MGSA 3MGSC 5B32A 4DRAA 4YS3C 3NQUB 3LZ0A 3MGQA 4J8WC 3TU4B 1P3MB 3X1SA 2NQBA 3W97C 3AZKD 3UTAC 4XUJC 2JSSA 4YM6A 3AYWB 5B0YA 2F8NA 4WU8B 2F8ND 3AZMD 1P3BA 5B2JB 4H9OB 1KX3B 5DNMA 1N1JB 3AZJA 1P3LD 3LZ1A 3REHC 1KU5A 5AV8C 3LJAA 3W96C 1P3BC 3AZIA 5DNMB 3AZJB 5KDMB 5B2JC 3LJAB 1WWIA 2NZDA 5GXQD 5B1LD 3TU4C 1M18D 1P3MC 4H9OA 1KX3A 3AFAC 3X1UA 3AZHD 1BH9B 1U35D 3O62B 2YFVB 3UTBA 1P3OC 3B6GC 3AZND 4E45A 5GT3B 5CPIB 3WA9A 3NQUA 4ZBJC 3A6NC 1P3FB 1F66A 4E44A 4H9NB 3X1UC 3MGRD 3UTAA 4QLCA 4WU8D 3LELD 1S32A 5CPJB 5BNXB 1H3OB 4NFTA 2CV5D 4XZQA 5GSUC 3AZLB 2CV5A 1P3IC 5B31G 5DNNC 4NE6A 3LELA 1S32D 5BT1C 4YS3D 4J8WD 3LELC 3AFAD 4J8UD 5CP6A 4Z5TB 5AVBA 3WKJB 3LJAC 1P3FD 5GSUD 5KDMA 3B6GD 3MGRB 3AZNA 3REJD 5DNND 5B2JA 1M1AA 4AWLB 5BO0A 1U35A 4J8XA 3X1UD 4Z2MH 5G49B 3MNNB 5BS7A 3WKJC 3W96A 3AYWD 3W98A 4UUZB 4X23C 3W99C 1B67A 1U35B 3LZ0B 3MVDB 4R8PB 4JJNB 3WTPB 5F99A 4J8UB 5CPJC 1TZYD 3W97D 4EO5B 3B0CW 5AV9B 3B6GA 3KXBB 1P3FA 5CP6B 1F66B 3WKJA 1EQZB 3MNNC 3AFAA 1P3AB 4Z66B 5CPJD 1P3MD 5B1MC 5DNMD 3AZJD 3NQJA 3REJC 3AZFD 5AV8D 3B0DC 1M19C 3AZMA 1P3BD 4YM6B 3AYWA 3W98D 4QLCD 1TZYB 3X1SB 2IO5C 5JRGC 1B6WA 4J8XD 4WU9C 1M1AD 3REKC 5B0ZA 1P3KA 5FUGA 3REJB 5B31A 3REIC 1P3LC 1P3IA 5GSUA 2CV5C 1R4VA 4KUDC 5AVBD 3AZHC 5CPKA 3W96B 5CP6C 1S32C 3AN2A 5B0YC 3KXBC 3B6FA 5GT3C 3REIA 4ZUXC 3C1CA 3VH6W 3WAAB 5B32C 3MGQC 5B32G 4H9PA 4LD9D 4H9SC 5AV9D 5AVCA 5BS7C 3AZEB 2FJ7C 2RVQC 2LY8A 3WKJD 5AV5A 3AZNC 5E5AA 3X1VB 2YFWB 5B40B 5CHLB 3WAAC 3MVDA 3UTBC 1P3OA 4Z5TC 1AOIA 1N1JA 1KX3D 1ID3A 3TU4A 2NQBB 5BNXA 5B32D 3MGQD 1S32B 5FUGB 4Z66A 3REJA 3AYWC 3AZFC 3AZMC 2RVQD 5B2IA 3AV1A 3LJAD 1KX4A 2NQBC 2HUEB 2L5AA 3AZGA 3LZ1D 1TZYC 1P3AD 4KHAA 1BH9A 4CSRA 4WU9B 1P3OB 3X1TA 5B31C 3AV2A 3KUYB 1ID3B 3R45A 4KUDD 4XUJA 3X1SD 4H9QA 3X1TC 3X1VD 3KXBD 5E5AB 5AV5B 3X1VA 1M19D 2AROD 4R8PA 2F8NH 3AZHA 5GT0B 4WU9D 5AV9C 4J8XC 5JA4B 1U35C 5AVCB 3KUYD 1HQ3B 3AZIC 3WTPA 3AZHB 5B24D 1ZLAC 3B0CT 3C1BA 4KUDB 5B0YB 5E5AC 4QLCB 5F99C 3MGRC 5B1LC 5GXQC 1M18C 4LD9B 5BO0B 2FJ7A 4XUJB 3AZID 5B24C 5JRGB 4KGCB 2NZDC 3B0BA 3LZ1B 3C1BC 3LELB 5B0ZB 1P3KB 5AY8A 4WZSB 2IO5B 5AVBB 4G92B 4J8VC 3AV2B 5B0ZC 1P3KC 1P34B 4WNNB 1KX5C 1ID3D 4KGCC 2NZDB 5B0YD 5B2IC 3AN2B 3AV1C 2AROA 2NQBD 4ZUXD 4H9RA 5E5AD 4Z66C 2PYOD 5GT3A 4KGCD 1ZLAB 3O62A 3UT9B 4J8UC 4H9RB 1HQ3C 3AZEA 4R8PC 5BNVA 2FJ7D 3W99B 4EO5C 5AV9A 2BYMA 4JJNC 2F8NG 3VH6T 3C1CB 1P34A 3C1BB 3MGPC 3X1VC 1BH8B 3AZGD 3AZKC 3V9RA 5B33A 4H9SA 3RELD 3LZ1C 3REHA 5B33C 5B1MD 5DNMC 3AZJC 4Z5TA 3O62D 3MGPB 2PYOA 4Z66D 3KUYC 1ZLAA 3REHB 4ZUXA 3C1CC 2HIOA 3AZKB 5DNNB 2F8NB 5GT0D 1AOID 3AZGB 1P3OD 3AZFA 2CV5B 4J8XB 5AV5C 3MGSB 1KX4D 1AOIC 1P3GA 3W97B 5B2IB 3AV1B 1P3GC 3O62C 5BNVB 1ID3C 1KX5B 5AV6A 1EQZA 3B6GB 1M19B 5B31B 3W97A 1P3GB 3C1CD 5C3IC 5AY8C 5F99D 2AROC 3KWQB 3NQJB 3AZFB 3MVDD 4R8PD 1KX4B 1Q9CA 3REKA 3KXBA 5AV6D 1EQZD 3WA9B 4ZUXB 1KX5D 3WTPC 4XUJD 3AZIB 1P3GD 4KUDA 3UT9D 4LD9A 5AV8A 5B33B 2PYOC 3REIB 4NE5A 1P3PA 4J8WB 4YS3B 3VH5T 3AN2D 3UTAD 3B6FB 5CPKD 3MGRA 1A7WA 2BYMB 5B2ID 3AZNB 3AV1D 4WV4B 4X23D 1M1AB 1KX5A 2AROB 5B31D 1P3IB 3REHD 4CAYB 4XZQB 3AZLA 3TU4D 4DRBA 5B33D 3RELC 1HQ3D 3KWQA 3UT9C 5B40D 3W96D 3WA9C 1P3PD 2F8NK 4KHAB 2HUEC 4JJND 1F66C 5B2JD 5CPKB 5AV6B
chains in the Genus database with same CATH superfamily
3AZGC 3AN2C 5AVBC 3UT9A 1P34C 4H9NA 4M6BA 5GT3D 4HGAB 3X1SC 3B0DB 3REKD 1TZYA 4LD9C 1T3UA 3REID 5G49A 5B24B 4JJNA 5F99B 3KFUG 5GT0A 5B40C 4UUZA 3H0RC 5B40A 1P3PC 1HQ3A 3KWQD 3AZEC 3AZLD 2HIOD 1F66D 5AVCC 5AY8D 2PYOB 1ZLAD 5B32B 3MGQB 3MGSD 5B0ZD 3R45B 1P3KD 4Z5TD 1WWSA 4X23A 1TAFA 1KX3C 1JFIB 2CWEA 4G91B 4H9QB 2HIOC 3VH5A 3V9RB 3MVDC 3WAAA 1P3PB 2NZDD 4CSRB 3C1BD 5B24A 3A6NA 4AWLC 1P3MA 3WTPE 5CPJA 4WU9A 1P3LB 3KWQC 3AZED 3AFAB 2JE5A 2YFVA 4G92C 1M19A 3KSYA 1P3LA 3WA9D 5GSUB 2Y2PA 5AV6C 5CPIA 1EQZC 2XD1A 2BYKB 2Y2QA 5B1MA 5CPKC 3RELA 3AZMB 4QLCC 1AOIB 4WNNA 3X1UB 5GXQB 5B1LB 3MNND 1M18B 3AV2D 2HIOB 3AZKA 4ZBJB 3X1TD 5AV8B 3A6NB 3RELB 1P34D 1P3AC 5CPIC 5JA4A 3LZ0D 5DNNA 3MGPD 2Y2IA 4G91C 1TAFB 4X23B 1JFIA 3AV2C 3W98C 5GT0C 5CP6D 4WU8C 2JCHA 4J8UA 5JRGD 3LZ0C 4J8WA 4YS3A 1BFMA 2Y2GA 1F1EA 1M1AC 2FJ7B 4XZQD 1ULYA 3B6FC 4H9PB 3VH5W 3KUYA 3W99A 3MNNA 1BH8A 2ZY2A 4WU8A 1P3BB 4HGAC 4YM6D 3W98B 5CPID 4J8VA 5AV5D 4J8VD 3UTBD 3VH6A 1KX4C 1HTAA 5BT1D 3AZLC 5AVCD 3REKB 3W99D 5B1LA 5GXQA 1M18A 3A6ND 3X1TB 1P3FC 4XZQC 3WTPD 2J8PA 3UTAB 1P3AA 3B6FD 4NE3A 5JRGA 3FDDA 3WAAD 1H3OA 3EPLA 2YFWA 4YM6C 4CAYA 5C3IB 5AY8B 4J8VB 2BYKA 5B1MB 3UTBB 1P3ID 4KGCA 4Z2MG 3MGPA 3MGSA 3MGSC 5B32A 4DRAA 4YS3C 3NQUB 3LZ0A 3MGQA 4J8WC 3TU4B 1P3MB 3X1SA 2NQBA 3W97C 3EPKA 3AZKD 3UTAC 4XUJC 2JSSA 4YM6A 3AYWB 5B0YA 2F8NA 4WU8B 2F8ND 3AZMD 1P3BA 5B2JB 4H9OB 2ZY3A 1KX3B 5DNMA 1N1JB 3AZJA 1P3LD 3LZ1A 3REHC 1KU5A 5AV8C 3LJAA 3W96C 1P3BC 3AZIA 5DNMB 3AZJB 5KDMB 5B2JC 3LJAB 1WWIA 2NZDA 5GXQD 5B1LD 3TU4C 1M18D 1P3MC 4H9OA 1KX3A 3AFAC 3X1UA 3AZHD 1BH9B 1U35D 3O62B 2YFVB 3UTBA 1P3OC 3B6GC 3AZND 4E45A 5GT3B 5CPIB 3WA9A 3NQUA 4ZBJC 3A6NC 1P3FB 1F66A 4E44A 3X1UC 4H9NB 3MGRD 3H0MC 3UTAA 2BG1A 4QLCA 3LELD 4WU8D 1S32A 5CPJB 5BNXB 1H3OB 4NFTA 2CV5D 3EG5B 4XZQA 5GSUC 3AZLB 2CV5A 1P3IC 5B31G 5DNNC 4NE6A 3LELA 1S32D 5BT1C 4YS3D 4J8WD 3LELC 3AFAD 4J8UD 5CP6A 4Z5TB 5AVBA 3WKJB 3LJAC 1P3FD 5GSUD 5KDMA 3B6GD 3IP4C 2VQRA 3MGRB 3AZNA 3REJD 5DNND 5B2JA 1M1AA 4AWLB 5BO0A 1U35A 4J8XA 3X1UD 4Z2MH 5G49B 3MNNB 4UPKA 5BS7A 3WKJC 3W96A 2ZY5A 3AYWD 3W98A 4UUZB 4X23C 3W99C 1B67A 1U35B 3LZ0B 3MVDB 4R8PB 4JJNB 3WTPB 5F99A 4J8UB 5CPJC 3A1KA 1TZYD 3W97D 4EO5B 3B0CW 5AV9B 3B6GA 3KXBB 1P3FA 5CP6B 1F66B 3WKJA 1EQZB 3MNNC 3AFAA 1P3AB 4Z66B 5CPJD 1P3MD 5B1MC 5DNMD 3AZJD 3NQJA 3REJC 2DF4C 3AZFD 5AV8D 3B0DC 1M19C 3AZMA 1P3BD 4YM6B 3AYWA 3W98D 4QLCD 1TZYB 3X1SB 2IO5C 5JRGC 1B6WA 4J8XD 4WU9C 1M1AD 3REKC 5B0ZA 1P3KA 5FUGA 3REJB 5B31A 3REIC 1P3LC 1P3IA 5GSUA 2CV5C 1R4VA 4KUDC 5AVBD 3AZHC 5CPKA 3W96B 5CP6C 1S32C 3AN2A 5B0YC 3KXBC 3B6FA 5GT3C 3REIA 4ZUXC 3C1CA 3VH6W 3WAAB 5B32C 3MGQC 5B32G 2Y2NA 4H9PA 4H9SC 5AV9D 4LD9D 5AVCA 5BS7C 3AZEB 2FJ7C 2RVQC 2LY8A 3WKJD 5AV5A 3AZNC 5E5AA 3X1VB 2YFWB 5B40B 5CHLB 3WAAC 3MVDA 3UTBC 1P3OA 2UWXA 3P5JB 4Z5TC 1AOIA 1N1JA 1KX3D 1Z2CB 1ID3A 4WJ3C 3TU4A 2NQBB 5BNXA 5B32D 3MGQD 1S32B 5FUGB 4Z66A 3REJA 2G5IC 3AYWC 3AZFC 3AZMC 2RVQD 5B2IA 3AV1A 3LJAD 1KX4A 2NQBC 2HUEB 2L5AA 3AZGA 3LZ1D 1TZYC 1P3AD 4KHAA 1BH9A 4CSRA 4WU9B 1P3OB 3X1TA 2F2AC 5B31C 3AV2A 3KUYB 1ID3B 3A1IA 3R45A 4KUDD 4XUJA 3X1SD 4H9QA 3X1TC 3X1VD 3KXBD 5E5AB 5AV5B 3X1VA 1M19D 2AROD 4R8PA 2RIQA 1W2EA 2Y2HA 2F8NH 3AZHA 5GT0B 2Y2MA 5AV9C 4WU9D 4J8XC 5JA4B 1U35C 5AVCB 3KUYD 1HQ3B 2ZY4A 3AZIC 3WTPA 3AZHB 5B24D 1ZLAC 3B0CT 3C1BA 2DQNC 4KUDB 5B0YB 5E5AC 4QLCB 5F99C 3MGRC 5B1LC 5GXQC 1M18C 4LD9B 5BO0B 2FJ7A 4XUJB 3AZID 5B24C 5JRGB 4KGCB 2NZDC 3B0BA 3LZ1B 3C1BC 3LELB 5B0ZB 1P3KB 5AY8A 4WZSB 2IO5B 5AVBB 4G92B 4J8VC 3AV2B 5B0ZC 1P3KC 1P34B 4WNNB 1KX5C 1ID3D 4KGCC 2NZDB 5B0YD 5B2IC 3AN2B 3AV1C 2AROA 2NQBD 4ZUXD 4H9RA 5E5AD 4Z66C 3EPJA 2W8SA 2PYOD 5GT3A 4KGCD 1ZLAB 2Y2JA 3O62A 3UT9B 4J8UC 4H9RB 1HQ3C 3AZEA 4R8PC 5BNVA 2FJ7D 3W99B 4EO5C 5AV9A 2BYMA 4JJNC 2F8NG 3VH6T 3C1CB 1P34A 3C1BB 3MGPC 3X1VC 1BH8B 3AZGD 3AZKC 3V9RA 5B33A 4H9SA 3RELD 3LZ1C 3REHA 5B33C 5B1MD 5DNMC 3AZJC 4Z5TA 3O62D 3MGPB 2PYOA 4Z66D 3KUYC 1ZLAA 3REHB 2Y2LA 4ZUXA 3C1CC 2HIOA 3AZKB 2XD5A 5DNNB 2G5HC 2F8NB 5GT0D 1AOID 3AZGB 1P3OD 3AZFA 2ZM5A 2CV5B 4J8XB 5AV5C 2Y2OA 3MGSB 1KX4D 1AOIC 1P3GA 3W97B 5B2IB 3AV1B 1P3GC 3O62C 5BNVB 1ID3C 1KX5B 5AV6A 1EQZA 3B6GB 1M19B 2Y2KA 5B31B 3W97A 1P3GB 3C1CD 5C3IC 5AY8C 5F99D 2AROC 3AL0C 3KWQB 3NQJB 3AZFB 3MVDD 4R8PD 1KX4B 1Q9CA 3REKA 3KXBA 5AV6D 1EQZD 3WA9B 4ZUXB 1KX5D 3EPHA 3WTPC 4XUJD 3AZIB 3H0LC 1P3GD 1PZRA 4KUDA 3UT9D 4LD9A 5AV8A 5B33B 2PYOC 2FFFB 3REIB 4NE5A 1P3PA 4J8WB 4YS3B 3VH5T 3AN2D 3UTAD 3B6FB 5CPKD 3MGRA 1A7WA 2BYMB 5B2ID 3AZNB 3AV1D 4DQYB 4WV4B 4X23D 1M1AB 1KX5A 2AROB 5B31D 1P3IB 3REHD 4CAYB 4XZQB 3AZLA 3TU4D 4DRBA 5B33D 3RELC 1HQ3D 3KWQA 3F6TA 3UT9C 5B40D 3W96D 3WA9C 1P3PD 2F8NK 4KHAB 2HUEC 4JJND 1F66C 5B2JD 5CPKB 5AV6B
chains in the Genus database with same CATH topology
3AZGC 3AN2C 5AVBC 3UT9A 1P34C 4H9NA 4M6BA 5GT3D 4HGAB 3X1SC 3B0DB 3REKD 1TZYA 4LD9C 1T3UA 3REID 5G49A 5B24B 4JJNA 5F99B 3KFUG 5GT0A 5B40C 4UUZA 3H0RC 5B40A 1P3PC 1HQ3A 3KWQD 3AZEC 3AZLD 2HIOD 1F66D 5AVCC 5AY8D 2PYOB 1ZLAD 5B32B 3MGQB 3MGSD 5B0ZD 3R45B 1P3KD 4Z5TD 1WWSA 4X23A 1TAFA 1KX3C 1JFIB 2CWEA 4G91B 4H9QB 2HIOC 3VH5A 3V9RB 3MVDC 3WAAA 1P3PB 2NZDD 4CSRB 3C1BD 5B24A 3A6NA 4AWLC 1P3MA 3WTPE 5CPJA 4WU9A 1P3LB 3KWQC 3AZED 3AFAB 2JE5A 2YFVA 4G92C 1M19A 3KSYA 1P3LA 3WA9D 5GSUB 2Y2PA 5AV6C 5CPIA 1EQZC 2XD1A 2BYKB 2Y2QA 5B1MA 5CPKC 3RELA 3AZMB 4QLCC 1AOIB 4WNNA 3X1UB 5GXQB 5B1LB 3MNND 1M18B 3AV2D 2HIOB 3AZKA 4ZBJB 3X1TD 5AV8B 3A6NB 3RELB 1P34D 1P3AC 5CPIC 5JA4A 3LZ0D 5DNNA 3MGPD 2Y2IA 4G91C 1TAFB 4X23B 1JFIA 3AV2C 3W98C 5GT0C 5CP6D 4WU8C 2JCHA 4J8UA 5JRGD 3LZ0C 4J8WA 4YS3A 1BFMA 2Y2GA 1F1EA 1M1AC 2FJ7B 4XZQD 1ULYA 3B6FC 4H9PB 3VH5W 3KUYA 3W99A 3MNNA 1BH8A 2ZY2A 4WU8A 1P3BB 4HGAC 4YM6D 3W98B 5CPID 4J8VA 5AV5D 4J8VD 3UTBD 3VH6A 1KX4C 1HTAA 5BT1D 3AZLC 5AVCD 3REKB 3W99D 5B1LA 5GXQA 1M18A 3A6ND 3X1TB 1P3FC 4XZQC 3WTPD 2J8PA 3UTAB 1P3AA 3B6FD 4NE3A 5JRGA 3FDDA 3WAAD 1H3OA 3EPLA 2YFWA 4YM6C 4CAYA 5C3IB 5AY8B 4J8VB 2BYKA 5B1MB 3UTBB 1P3ID 4KGCA 4Z2MG 3MGPA 3MGSA 3MGSC 5B32A 4DRAA 4YS3C 3NQUB 3LZ0A 3MGQA 4J8WC 3TU4B 1P3MB 3X1SA 2NQBA 3W97C 3EPKA 3AZKD 3UTAC 4XUJC 2JSSA 4YM6A 3AYWB 5B0YA 2F8NA 4WU8B 2F8ND 3AZMD 1P3BA 5B2JB 4H9OB 2ZY3A 1KX3B 5DNMA 1N1JB 3AZJA 1P3LD 3LZ1A 3REHC 1KU5A 5AV8C 3LJAA 3W96C 1P3BC 3AZIA 5DNMB 3AZJB 5KDMB 5B2JC 3LJAB 1WWIA 2NZDA 5GXQD 5B1LD 3TU4C 1M18D 1P3MC 4H9OA 1KX3A 3AFAC 3X1UA 3AZHD 1BH9B 1U35D 3O62B 2YFVB 3UTBA 1P3OC 3B6GC 3AZND 4E45A 5GT3B 5CPIB 3WA9A 3NQUA 4ZBJC 3A6NC 1P3FB 1F66A 4E44A 3X1UC 4H9NB 3MGRD 3H0MC 3UTAA 2BG1A 4QLCA 3LELD 4WU8D 1S32A 5CPJB 5BNXB 1H3OB 4NFTA 2CV5D 3EG5B 4XZQA 5GSUC 3AZLB 2CV5A 1P3IC 5B31G 5DNNC 4NE6A 3LELA 1S32D 5BT1C 4YS3D 4J8WD 3LELC 3AFAD 4J8UD 5CP6A 4Z5TB 5AVBA 3WKJB 3LJAC 1P3FD 5GSUD 5KDMA 3B6GD 3IP4C 2VQRA 3MGRB 3AZNA 3REJD 5DNND 5B2JA 1M1AA 4AWLB 5BO0A 1U35A 4J8XA 3X1UD 4Z2MH 5G49B 3MNNB 4UPKA 5BS7A 3WKJC 3W96A 2ZY5A 3AYWD 3W98A 4UUZB 4X23C 3W99C 1B67A 1U35B 3LZ0B 3MVDB 4R8PB 4JJNB 3WTPB 5F99A 4J8UB 5CPJC 3A1KA 1TZYD 3W97D 4EO5B 3B0CW 5AV9B 3B6GA 3KXBB 1P3FA 5CP6B 1F66B 3WKJA 1EQZB 3MNNC 3AFAA 1P3AB 4Z66B 5CPJD 1P3MD 5B1MC 5DNMD 3AZJD 3NQJA 3REJC 2DF4C 3AZFD 5AV8D 3B0DC 1M19C 3AZMA 1P3BD 4YM6B 3AYWA 3W98D 4QLCD 1TZYB 3X1SB 2IO5C 5JRGC 1B6WA 4J8XD 4WU9C 1M1AD 3REKC 5B0ZA 1P3KA 5FUGA 3REJB 5B31A 3REIC 1P3LC 1P3IA 5GSUA 2CV5C 1R4VA 4KUDC 5AVBD 3AZHC 5CPKA 3W96B 5CP6C 1S32C 3AN2A 5B0YC 3KXBC 3B6FA 5GT3C 3REIA 4ZUXC 3C1CA 3VH6W 3WAAB 5B32C 3MGQC 5B32G 2Y2NA 4H9PA 4H9SC 5AV9D 4LD9D 5AVCA 5BS7C 3AZEB 2FJ7C 2RVQC 2LY8A 3WKJD 5AV5A 3AZNC 5E5AA 3X1VB 2YFWB 5B40B 5CHLB 3WAAC 3MVDA 3UTBC 1P3OA 2UWXA 3P5JB 4Z5TC 1AOIA 1N1JA 1KX3D 1Z2CB 1ID3A 4WJ3C 3TU4A 2NQBB 5BNXA 5B32D 3MGQD 1S32B 5FUGB 4Z66A 3REJA 2G5IC 3AYWC 3AZFC 3AZMC 2RVQD 5B2IA 3AV1A 3LJAD 1KX4A 2NQBC 2HUEB 2L5AA 3AZGA 3LZ1D 1TZYC 1P3AD 4KHAA 1BH9A 4CSRA 4WU9B 1P3OB 3X1TA 2F2AC 5B31C 3AV2A 3KUYB 1ID3B 3A1IA 3R45A 4KUDD 4XUJA 3X1SD 4H9QA 3X1TC 3X1VD 3KXBD 5E5AB 5AV5B 3X1VA 1M19D 2AROD 4R8PA 2RIQA 1W2EA 2Y2HA 2F8NH 3AZHA 5GT0B 2Y2MA 5AV9C 4WU9D 4J8XC 5JA4B 1U35C 5AVCB 3KUYD 1HQ3B 2ZY4A 3AZIC 3WTPA 3AZHB 5B24D 1ZLAC 3B0CT 3C1BA 2DQNC 4KUDB 5B0YB 5E5AC 4QLCB 5F99C 3MGRC 5B1LC 5GXQC 1M18C 4LD9B 5BO0B 2FJ7A 4XUJB 3AZID 5B24C 5JRGB 4KGCB 2NZDC 3B0BA 3LZ1B 3C1BC 3LELB 5B0ZB 1P3KB 5AY8A 4WZSB 2IO5B 5AVBB 4G92B 4J8VC 3AV2B 5B0ZC 1P3KC 1P34B 4WNNB 1KX5C 1ID3D 4KGCC 2NZDB 5B0YD 5B2IC 3AN2B 3AV1C 2AROA 2NQBD 4ZUXD 4H9RA 5E5AD 4Z66C 3EPJA 2W8SA 2PYOD 5GT3A 4KGCD 1ZLAB 2Y2JA 3O62A 3UT9B 4J8UC 4H9RB 1HQ3C 3AZEA 4R8PC 5BNVA 2FJ7D 3W99B 4EO5C 5AV9A 2BYMA 4JJNC 2F8NG 3VH6T 3C1CB 1P34A 3C1BB 3MGPC 3X1VC 1BH8B 3AZGD 3AZKC 3V9RA 5B33A 4H9SA 3RELD 3LZ1C 3REHA 5B33C 5B1MD 5DNMC 3AZJC 4Z5TA 3O62D 3MGPB 2PYOA 4Z66D 3KUYC 1ZLAA 3REHB 2Y2LA 4ZUXA 3C1CC 2HIOA 3AZKB 2XD5A 5DNNB 2G5HC 2F8NB 5GT0D 1AOID 3AZGB 1P3OD 3AZFA 2ZM5A 2CV5B 4J8XB 5AV5C 2Y2OA 3MGSB 1KX4D 1AOIC 1P3GA 3W97B 5B2IB 3AV1B 1P3GC 3O62C 5BNVB 1ID3C 1KX5B 5AV6A 1EQZA 3B6GB 1M19B 2Y2KA 5B31B 3W97A 1P3GB 3C1CD 5C3IC 5AY8C 5F99D 2AROC 3AL0C 3KWQB 3NQJB 3AZFB 3MVDD 4R8PD 1KX4B 1Q9CA 3REKA 3KXBA 5AV6D 1EQZD 3WA9B 4ZUXB 1KX5D 3EPHA 3WTPC 4XUJD 3AZIB 3H0LC 1P3GD 1PZRA 4KUDA 3UT9D 4LD9A 5AV8A 5B33B 2PYOC 2FFFB 3REIB 4NE5A 1P3PA 4J8WB 4YS3B 3VH5T 3AN2D 3UTAD 3B6FB 5CPKD 3MGRA 1A7WA 2BYMB 5B2ID 3AZNB 3AV1D 4DQYB 4WV4B 4X23D 1M1AB 1KX5A 2AROB 5B31D 1P3IB 3REHD 4CAYB 4XZQB 3AZLA 3TU4D 4DRBA 5B33D 3RELC 1HQ3D 3KWQA 3F6TA 3UT9C 5B40D 3W96D 3WA9C 1P3PD 2F8NK 4KHAB 2HUEC 4JJND 1F66C 5B2JD 5CPKB 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG C;  3AN2 C;  5AVB C;  3UT9 A;  1P34 C;  4H9N A;  4M6B A;  5GT3 D;  4HGA B;  3X1S C;  3B0D B;  3REK D;  1TZY A;  4LD9 C;  3REI D;  5G49 A;  5B24 B;  4JJN A;  5F99 B;  5GT0 A;  5B40 C;  4UUZ A;  5B40 A;  1P3P C;  1HQ3 A;  3KWQ D;  3AZE C;  3AZL D;  2HIO D;  1F66 D;  5AVC C;  5AY8 D;  2PYO B;  1ZLA D;  5B32 B;  3MGQ B;  3MGS D;  5B0Z D;  3R45 B;  1P3K D;  4Z5T D;  1WWS A;  4X23 A;  1TAF A;  1KX3 C;  1JFI B;  2CWE A;  4G91 B;  4H9Q B;  2HIO C;  3VH5 A;  3V9R B;  3MVD C;  3WAA A;  1P3P B;  2NZD D;  4CSR B;  3C1B D;  5B24 A;  3A6N A;  4AWL C;  1P3M A;  3WTP E;  5CPJ A;  4WU9 A;  1P3L B;  3KWQ C;  3AZE D;  3AFA B;  2YFV A;  4G92 C;  1M19 A;  3KSY A;  1P3L A;  3WA9 D;  5GSU B;  5AV6 C;  5CPI A;  1EQZ C;  2BYK B;  5B1M A;  5CPK C;  3REL A;  3AZM B;  4QLC C;  1AOI B;  4WNN A;  3X1U B;  5GXQ B;  5B1L B;  3MNN D;  1M18 B;  3AV2 D;  2HIO B;  3AZK A;  4ZBJ B;  3X1T D;  5AV8 B;  3A6N B;  3REL B;  1P34 D;  1P3A C;  5CPI C;  5JA4 A;  3LZ0 D;  5DNN A;  3MGP D;  4G91 C;  1TAF B;  4X23 B;  1JFI A;  3AV2 C;  3W98 C;  5GT0 C;  5CP6 D;  4WU8 C;  4J8U A;  5JRG D;  3LZ0 C;  4J8W A;  4YS3 A;  1BFM A;  1M1A C;  1F1E A;  2FJ7 B;  4XZQ D;  1ULY A;  3B6F C;  4H9P B;  3VH5 W;  3KUY A;  3W99 A;  3MNN A;  1BH8 A;  4WU8 A;  1P3B B;  4HGA C;  4YM6 D;  3W98 B;  5CPI D;  4J8V A;  5AV5 D;  4J8V D;  3UTB D;  3VH6 A;  1KX4 C;  1HTA A;  5BT1 D;  3AZL C;  5AVC D;  3REK B;  3W99 D;  5B1L A;  5GXQ A;  1M18 A;  3A6N D;  3X1T B;  1P3F C;  4XZQ C;  3WTP D;  3UTA B;  3B6F D;  1P3A A;  4NE3 A;  5JRG A;  3WAA D;  1H3O A;  2YFW A;  4YM6 C;  4CAY A;  5C3I B;  5AY8 B;  4J8V B;  2BYK A;  5B1M B;  3UTB B;  1P3I D;  4KGC A;  4Z2M G;  3MGP A;  3MGS A;  3MGS C;  5B32 A;  4DRA A;  4YS3 C;  3NQU B;  3LZ0 A;  3MGQ A;  4J8W C;  3TU4 B;  1P3M B;  3X1S A;  2NQB A;  3W97 C;  3AZK D;  3UTA C;  4XUJ C;  2JSS A;  4YM6 A;  3AYW B;  5B0Y A;  2F8N A;  4WU8 B;  2F8N D;  3AZM D;  1P3B A;  5B2J B;  4H9O B;  1KX3 B;  5DNM A;  1N1J B;  3AZJ A;  1P3L D;  3LZ1 A;  3REH C;  1KU5 A;  5AV8 C;  3LJA A;  3W96 C;  1P3B C;  3AZI A;  5DNM B;  3AZJ B;  5KDM B;  5B2J C;  3LJA B;  1WWI A;  2NZD A;  5GXQ D;  5B1L D;  3TU4 C;  1M18 D;  1P3M C;  4H9O A;  1KX3 A;  3AFA C;  3X1U A;  3AZH D;  1BH9 B;  1U35 D;  3O62 B;  2YFV B;  3UTB A;  1P3O C;  3B6G C;  3AZN D;  4E45 A;  5GT3 B;  5CPI B;  3WA9 A;  3NQU A;  4ZBJ C;  3A6N C;  1P3F B;  1F66 A;  4E44 A;  4H9N B;  3X1U C;  3MGR D;  3UTA A;  4QLC A;  4WU8 D;  3LEL D;  1S32 A;  5CPJ B;  5BNX B;  1H3O B;  4NFT A;  2CV5 D;  4XZQ A;  5GSU C;  3AZL B;  2CV5 A;  1P3I C;  5B31 G;  5DNN C;  4NE6 A;  3LEL A;  1S32 D;  5BT1 C;  4YS3 D;  4J8W D;  3LEL C;  3AFA D;  4J8U D;  5CP6 A;  4Z5T B;  5AVB A;  3WKJ B;  3LJA C;  1P3F D;  5GSU D;  5KDM A;  3B6G D;  3MGR B;  3AZN A;  3REJ D;  5DNN D;  5B2J A;  1M1A A;  4AWL B;  5BO0 A;  1U35 A;  4J8X A;  3X1U D;  4Z2M H;  5G49 B;  3MNN B;  5BS7 A;  3WKJ C;  3W96 A;  3AYW D;  3W98 A;  4UUZ B;  4X23 C;  3W99 C;  1B67 A;  1U35 B;  3LZ0 B;  3MVD B;  4R8P B;  4JJN B;  3WTP B;  5F99 A;  4J8U B;  5CPJ C;  1TZY D;  3W97 D;  4EO5 B;  3B0C W;  5AV9 B;  3B6G A;  3KXB B;  1P3F A;  5CP6 B;  1F66 B;  3WKJ A;  1EQZ B;  3MNN C;  3AFA A;  1P3A B;  4Z66 B;  5CPJ D;  1P3M D;  5B1M C;  5DNM D;  3AZJ D;  3NQJ A;  3REJ C;  3AZF D;  5AV8 D;  3B0D C;  1M19 C;  3AZM A;  1P3B D;  4YM6 B;  3AYW A;  3W98 D;  4QLC D;  1TZY B;  3X1S B;  2IO5 C;  5JRG C;  1B6W A;  4J8X D;  4WU9 C;  1M1A D;  3REK C;  5B0Z A;  1P3K A;  5FUG A;  3REJ B;  5B31 A;  3REI C;  1P3L C;  1P3I A;  5GSU A;  2CV5 C;  1R4V A;  4KUD C;  5AVB D;  3AZH C;  5CPK A;  3W96 B;  5CP6 C;  1S32 C;  3AN2 A;  5B0Y C;  3KXB C;  3B6F A;  5GT3 C;  3REI A;  4ZUX C;  3C1C A;  3VH6 W;  3WAA B;  5B32 C;  3MGQ C;  5B32 G;  4H9P A;  4LD9 D;  4H9S C;  5AV9 D;  5AVC A;  5BS7 C;  3AZE B;  2FJ7 C;  2RVQ C;  2LY8 A;  3WKJ D;  5AV5 A;  3AZN C;  5E5A A;  3X1V B;  2YFW B;  5B40 B;  5CHL B;  3WAA C;  3MVD A;  3UTB C;  1P3O A;  4Z5T C;  1AOI A;  1N1J A;  1KX3 D;  1ID3 A;  3TU4 A;  2NQB B;  5BNX A;  5B32 D;  3MGQ D;  1S32 B;  5FUG B;  4Z66 A;  3REJ A;  3AYW C;  3AZF C;  3AZM C;  2RVQ D;  5B2I A;  3AV1 A;  3LJA D;  1KX4 A;  2NQB C;  2HUE B;  2L5A A;  3AZG A;  3LZ1 D;  1TZY C;  1P3A D;  4KHA A;  1BH9 A;  4CSR A;  4WU9 B;  1P3O B;  3X1T A;  5B31 C;  3AV2 A;  3KUY B;  1ID3 B;  3R45 A;  4KUD D;  4XUJ A;  3X1S D;  4H9Q A;  3X1T C;  3X1V D;  3KXB D;  5E5A B;  5AV5 B;  3X1V A;  1M19 D;  2ARO D;  4R8P A;  2F8N H;  3AZH A;  5GT0 B;  4WU9 D;  5AV9 C;  4J8X C;  5JA4 B;  1U35 C;  5AVC B;  3KUY D;  1HQ3 B;  3AZI C;  3WTP A;  3AZH B;  5B24 D;  1ZLA C;  3B0C T;  3C1B A;  4KUD B;  5B0Y B;  5E5A C;  4QLC B;  5F99 C;  3MGR C;  5B1L C;  5GXQ C;  1M18 C;  4LD9 B;  5BO0 B;  2FJ7 A;  4XUJ B;  3AZI D;  5B24 C;  5JRG B;  4KGC B;  2NZD C;  3B0B A;  3LZ1 B;  3C1B C;  3LEL B;  5B0Z B;  1P3K B;  5AY8 A;  4WZS B;  2IO5 B;  5AVB B;  4G92 B;  4J8V C;  3AV2 B;  5B0Z C;  1P3K C;  1P34 B;  4WNN B;  1KX5 C;  1ID3 D;  4KGC C;  2NZD B;  5B0Y D;  5B2I C;  3AN2 B;  3AV1 C;  2ARO A;  2NQB D;  4ZUX D;  4H9R A;  5E5A D;  4Z66 C;  2PYO D;  5GT3 A;  4KGC D;  1ZLA B;  3O62 A;  3UT9 B;  4J8U C;  4H9R B;  1HQ3 C;  3AZE A;  4R8P C;  5BNV A;  2FJ7 D;  3W99 B;  4EO5 C;  5AV9 A;  2BYM A;  4JJN C;  2F8N G;  3VH6 T;  3C1C B;  1P34 A;  3C1B B;  3MGP C;  3X1V C;  1BH8 B;  3AZG D;  3AZK C;  3V9R A;  5B33 A;  4H9S A;  3REL D;  3LZ1 C;  3REH A;  5B33 C;  5B1M D;  5DNM C;  3AZJ C;  4Z5T A;  3O62 D;  3MGP B;  2PYO A;  4Z66 D;  3KUY C;  1ZLA A;  3REH B;  4ZUX A;  3C1C C;  2HIO A;  3AZK B;  5DNN B;  2F8N B;  5GT0 D;  1AOI D;  3AZG B;  1P3O D;  3AZF A;  2CV5 B;  4J8X B;  5AV5 C;  3MGS B;  1KX4 D;  1AOI C;  1P3G A;  3W97 B;  5B2I B;  3AV1 B;  1P3G C;  3O62 C;  5BNV B;  1ID3 C;  1KX5 B;  5AV6 A;  1EQZ A;  3B6G B;  1M19 B;  5B31 B;  3W97 A;  1P3G B;  3C1C D;  5C3I C;  5AY8 C;  5F99 D;  2ARO C;  3KWQ B;  3NQJ B;  3AZF B;  3MVD D;  4R8P D;  1KX4 B;  1Q9C A;  3REK A;  3KXB A;  5AV6 D;  1EQZ D;  3WA9 B;  4ZUX B;  1KX5 D;  3WTP C;  4XUJ D;  3AZI B;  1P3G D;  4KUD A;  3UT9 D;  4LD9 A;  5AV8 A;  5B33 B;  2PYO C;  3REI B;  4NE5 A;  1P3P A;  4J8W B;  4YS3 B;  3VH5 T;  3AN2 D;  3UTA D;  3B6F B;  5CPK D;  3MGR A;  1A7W A;  2BYM B;  5B2I D;  3AZN B;  3AV1 D;  4WV4 B;  4X23 D;  1M1A B;  1KX5 A;  2ARO B;  5B31 D;  1P3I B;  3REH D;  4CAY B;  4XZQ B;  3AZL A;  3TU4 D;  4DRB A;  5B33 D;  3REL C;  1HQ3 D;  3KWQ A;  3UT9 C;  5B40 D;  3W96 D;  3WA9 C;  1P3P D;  2F8N K;  4KHA B;  2HUE C;  4JJN D;  1F66 C;  5B2J D;  5CPK B;  5AV6 B; 
#chains in the Genus database with same CATH topology
 3AZG C;  3AN2 C;  5AVB C;  3UT9 A;  1P34 C;  4H9N A;  4M6B A;  5GT3 D;  4HGA B;  3X1S C;  3B0D B;  3REK D;  1TZY A;  4LD9 C;  1T3U A;  3REI D;  5G49 A;  5B24 B;  4JJN A;  5F99 B;  3KFU G;  5GT0 A;  5B40 C;  4UUZ A;  3H0R C;  5B40 A;  1P3P C;  1HQ3 A;  3KWQ D;  3AZE C;  3AZL D;  2HIO D;  1F66 D;  5AVC C;  5AY8 D;  2PYO B;  1ZLA D;  5B32 B;  3MGQ B;  3MGS D;  5B0Z D;  3R45 B;  1P3K D;  4Z5T D;  1WWS A;  4X23 A;  1TAF A;  1KX3 C;  1JFI B;  2CWE A;  4G91 B;  4H9Q B;  2HIO C;  3VH5 A;  3V9R B;  3MVD C;  3WAA A;  1P3P B;  2NZD D;  4CSR B;  3C1B D;  5B24 A;  3A6N A;  4AWL C;  1P3M A;  3WTP E;  5CPJ A;  4WU9 A;  1P3L B;  3KWQ C;  3AZE D;  3AFA B;  2JE5 A;  2YFV A;  4G92 C;  1M19 A;  3KSY A;  1P3L A;  3WA9 D;  5GSU B;  2Y2P A;  5AV6 C;  5CPI A;  1EQZ C;  2XD1 A;  2BYK B;  2Y2Q A;  5B1M A;  5CPK C;  3REL A;  3AZM B;  4QLC C;  1AOI B;  4WNN A;  3X1U B;  5GXQ B;  5B1L B;  3MNN D;  1M18 B;  3AV2 D;  2HIO B;  3AZK A;  4ZBJ B;  3X1T D;  5AV8 B;  3A6N B;  3REL B;  1P34 D;  1P3A C;  5CPI C;  5JA4 A;  3LZ0 D;  5DNN A;  3MGP D;  2Y2I A;  4G91 C;  1TAF B;  4X23 B;  1JFI A;  3AV2 C;  3W98 C;  5GT0 C;  5CP6 D;  4WU8 C;  2JCH A;  4J8U A;  5JRG D;  3LZ0 C;  4J8W A;  4YS3 A;  1BFM A;  2Y2G A;  1F1E A;  1M1A C;  2FJ7 B;  4XZQ D;  1ULY A;  3B6F C;  4H9P B;  3VH5 W;  3KUY A;  3W99 A;  3MNN A;  1BH8 A;  2ZY2 A;  4WU8 A;  1P3B B;  4HGA C;  4YM6 D;  3W98 B;  5CPI D;  4J8V A;  5AV5 D;  4J8V D;  3UTB D;  3VH6 A;  1KX4 C;  1HTA A;  5BT1 D;  3AZL C;  5AVC D;  3REK B;  3W99 D;  5B1L A;  5GXQ A;  1M18 A;  3A6N D;  3X1T B;  1P3F C;  4XZQ C;  3WTP D;  2J8P A;  3UTA B;  1P3A A;  3B6F D;  4NE3 A;  5JRG A;  3FDD A;  3WAA D;  1H3O A;  3EPL A;  2YFW A;  4YM6 C;  4CAY A;  5C3I B;  5AY8 B;  4J8V B;  2BYK A;  5B1M B;  3UTB B;  1P3I D;  4KGC A;  4Z2M G;  3MGP A;  3MGS A;  3MGS C;  5B32 A;  4DRA A;  4YS3 C;  3NQU B;  3LZ0 A;  3MGQ A;  4J8W C;  3TU4 B;  1P3M B;  3X1S A;  2NQB A;  3W97 C;  3EPK A;  3AZK D;  3UTA C;  4XUJ C;  2JSS A;  4YM6 A;  3AYW B;  5B0Y A;  2F8N A;  4WU8 B;  2F8N D;  3AZM D;  1P3B A;  5B2J B;  4H9O B;  2ZY3 A;  1KX3 B;  5DNM A;  1N1J B;  3AZJ A;  1P3L D;  3LZ1 A;  3REH C;  1KU5 A;  5AV8 C;  3LJA A;  3W96 C;  1P3B C;  3AZI A;  5DNM B;  3AZJ B;  5KDM B;  5B2J C;  3LJA B;  1WWI A;  2NZD A;  5GXQ D;  5B1L D;  3TU4 C;  1M18 D;  1P3M C;  4H9O A;  1KX3 A;  3AFA C;  3X1U A;  3AZH D;  1BH9 B;  1U35 D;  3O62 B;  2YFV B;  3UTB A;  1P3O C;  3B6G C;  3AZN D;  4E45 A;  5GT3 B;  5CPI B;  3WA9 A;  3NQU A;  4ZBJ C;  3A6N C;  1P3F B;  1F66 A;  4E44 A;  3X1U C;  4H9N B;  3MGR D;  3H0M C;  3UTA A;  2BG1 A;  4QLC A;  3LEL D;  4WU8 D;  1S32 A;  5CPJ B;  5BNX B;  1H3O B;  4NFT A;  2CV5 D;  3EG5 B;  4XZQ A;  5GSU C;  3AZL B;  2CV5 A;  1P3I C;  5B31 G;  5DNN C;  4NE6 A;  3LEL A;  1S32 D;  5BT1 C;  4YS3 D;  4J8W D;  3LEL C;  3AFA D;  4J8U D;  5CP6 A;  4Z5T B;  5AVB A;  3WKJ B;  3LJA C;  1P3F D;  5GSU D;  5KDM A;  3B6G D;  3IP4 C;  2VQR A;  3MGR B;  3AZN A;  3REJ D;  5DNN D;  5B2J A;  1M1A A;  4AWL B;  5BO0 A;  1U35 A;  4J8X A;  3X1U D;  4Z2M H;  5G49 B;  3MNN B;  4UPK A;  5BS7 A;  3WKJ C;  3W96 A;  2ZY5 A;  3AYW D;  3W98 A;  4UUZ B;  4X23 C;  3W99 C;  1B67 A;  1U35 B;  3LZ0 B;  3MVD B;  4R8P B;  4JJN B;  3WTP B;  5F99 A;  4J8U B;  5CPJ C;  3A1K A;  1TZY D;  3W97 D;  4EO5 B;  3B0C W;  5AV9 B;  3B6G A;  3KXB B;  1P3F A;  5CP6 B;  1F66 B;  3WKJ A;  1EQZ B;  3MNN C;  3AFA A;  1P3A B;  4Z66 B;  5CPJ D;  1P3M D;  5B1M C;  5DNM D;  3AZJ D;  3NQJ A;  3REJ C;  2DF4 C;  3AZF D;  5AV8 D;  3B0D C;  1M19 C;  3AZM A;  1P3B D;  4YM6 B;  3AYW A;  3W98 D;  4QLC D;  1TZY B;  3X1S B;  2IO5 C;  5JRG C;  1B6W A;  4J8X D;  4WU9 C;  1M1A D;  3REK C;  5B0Z A;  1P3K A;  5FUG A;  3REJ B;  5B31 A;  3REI C;  1P3L C;  1P3I A;  5GSU A;  2CV5 C;  1R4V A;  4KUD C;  5AVB D;  3AZH C;  5CPK A;  3W96 B;  5CP6 C;  1S32 C;  3AN2 A;  5B0Y C;  3KXB C;  3B6F A;  5GT3 C;  3REI A;  4ZUX C;  3C1C A;  3VH6 W;  3WAA B;  5B32 C;  3MGQ C;  5B32 G;  2Y2N A;  4H9P A;  4H9S C;  5AV9 D;  4LD9 D;  5AVC A;  5BS7 C;  3AZE B;  2FJ7 C;  2RVQ C;  2LY8 A;  3WKJ D;  5AV5 A;  3AZN C;  5E5A A;  3X1V B;  2YFW B;  5B40 B;  5CHL B;  3WAA C;  3MVD A;  3UTB C;  1P3O A;  2UWX A;  3P5J B;  4Z5T C;  1AOI A;  1N1J A;  1KX3 D;  1Z2C B;  1ID3 A;  4WJ3 C;  3TU4 A;  2NQB B;  5BNX A;  5B32 D;  3MGQ D;  1S32 B;  5FUG B;  4Z66 A;  3REJ A;  2G5I C;  3AYW C;  3AZF C;  3AZM C;  2RVQ D;  5B2I A;  3AV1 A;  3LJA D;  1KX4 A;  2NQB C;  2HUE B;  2L5A A;  3AZG A;  3LZ1 D;  1TZY C;  1P3A D;  4KHA A;  1BH9 A;  4CSR A;  4WU9 B;  1P3O B;  3X1T A;  2F2A C;  5B31 C;  3AV2 A;  3KUY B;  1ID3 B;  3A1I A;  3R45 A;  4KUD D;  4XUJ A;  3X1S D;  4H9Q A;  3X1T C;  3X1V D;  3KXB D;  5E5A B;  5AV5 B;  3X1V A;  1M19 D;  2ARO D;  4R8P A;  2RIQ A;  1W2E A;  2Y2H A;  2F8N H;  3AZH A;  5GT0 B;  2Y2M A;  5AV9 C;  4WU9 D;  4J8X C;  5JA4 B;  1U35 C;  5AVC B;  3KUY D;  1HQ3 B;  2ZY4 A;  3AZI C;  3WTP A;  3AZH B;  5B24 D;  1ZLA C;  3B0C T;  3C1B A;  2DQN C;  4KUD B;  5B0Y B;  5E5A C;  4QLC B;  5F99 C;  3MGR C;  5B1L C;  5GXQ C;  1M18 C;  4LD9 B;  5BO0 B;  2FJ7 A;  4XUJ B;  3AZI D;  5B24 C;  5JRG B;  4KGC B;  2NZD C;  3B0B A;  3LZ1 B;  3C1B C;  3LEL B;  5B0Z B;  1P3K B;  5AY8 A;  4WZS B;  2IO5 B;  5AVB B;  4G92 B;  4J8V C;  3AV2 B;  5B0Z C;  1P3K C;  1P34 B;  4WNN B;  1KX5 C;  1ID3 D;  4KGC C;  2NZD B;  5B0Y D;  5B2I C;  3AN2 B;  3AV1 C;  2ARO A;  2NQB D;  4ZUX D;  4H9R A;  5E5A D;  4Z66 C;  3EPJ A;  2W8S A;  2PYO D;  5GT3 A;  4KGC D;  1ZLA B;  2Y2J A;  3O62 A;  3UT9 B;  4J8U C;  4H9R B;  1HQ3 C;  3AZE A;  4R8P C;  5BNV A;  2FJ7 D;  3W99 B;  4EO5 C;  5AV9 A;  2BYM A;  4JJN C;  2F8N G;  3VH6 T;  3C1C B;  1P34 A;  3C1B B;  3MGP C;  3X1V C;  1BH8 B;  3AZG D;  3AZK C;  3V9R A;  5B33 A;  4H9S A;  3REL D;  3LZ1 C;  3REH A;  5B33 C;  5B1M D;  5DNM C;  3AZJ C;  4Z5T A;  3O62 D;  3MGP B;  2PYO A;  4Z66 D;  3KUY C;  1ZLA A;  3REH B;  2Y2L A;  4ZUX A;  3C1C C;  2HIO A;  3AZK B;  2XD5 A;  5DNN B;  2G5H C;  2F8N B;  5GT0 D;  1AOI D;  3AZG B;  1P3O D;  3AZF A;  2ZM5 A;  2CV5 B;  4J8X B;  5AV5 C;  2Y2O A;  3MGS B;  1KX4 D;  1AOI C;  1P3G A;  3W97 B;  5B2I B;  3AV1 B;  1P3G C;  3O62 C;  5BNV B;  1ID3 C;  1KX5 B;  5AV6 A;  1EQZ A;  3B6G B;  1M19 B;  2Y2K A;  5B31 B;  3W97 A;  1P3G B;  3C1C D;  5C3I C;  5AY8 C;  5F99 D;  2ARO C;  3AL0 C;  3KWQ B;  3NQJ B;  3AZF B;  3MVD D;  4R8P D;  1KX4 B;  1Q9C A;  3REK A;  3KXB A;  5AV6 D;  1EQZ D;  3WA9 B;  4ZUX B;  1KX5 D;  3EPH A;  3WTP C;  4XUJ D;  3AZI B;  3H0L C;  1P3G D;  1PZR A;  4KUD A;  3UT9 D;  4LD9 A;  5AV8 A;  5B33 B;  2PYO C;  2FFF B;  3REI B;  4NE5 A;  1P3P A;  4J8W B;  4YS3 B;  3VH5 T;  3AN2 D;  3UTA D;  3B6F B;  5CPK D;  3MGR A;  1A7W A;  2BYM B;  5B2I D;  3AZN B;  3AV1 D;  4DQY B;  4WV4 B;  4X23 D;  1M1A B;  1KX5 A;  2ARO B;  5B31 D;  1P3I B;  3REH D;  4CAY B;  4XZQ B;  3AZL A;  3TU4 D;  4DRB A;  5B33 D;  3REL C;  1HQ3 D;  3KWQ A;  3F6T A;  3UT9 C;  5B40 D;  3W96 D;  3WA9 C;  1P3P D;  2F8N K;  4KHA B;  2HUE C;  4JJN D;  1F66 C;  5B2J D;  5CPK B;  5AV6 B; 
#chains in the Genus database with same CATH homology
 3AZG C;  3AN2 C;  5AVB C;  3UT9 A;  1P34 C;  4H9N A;  4M6B A;  5GT3 D;  4HGA B;  3X1S C;  3B0D B;  3REK D;  1TZY A;  4LD9 C;  1T3U A;  3REI D;  5G49 A;  5B24 B;  4JJN A;  5F99 B;  3KFU G;  5GT0 A;  5B40 C;  4UUZ A;  3H0R C;  5B40 A;  1P3P C;  1HQ3 A;  3KWQ D;  3AZE C;  3AZL D;  2HIO D;  1F66 D;  5AVC C;  5AY8 D;  2PYO B;  1ZLA D;  5B32 B;  3MGQ B;  3MGS D;  5B0Z D;  3R45 B;  1P3K D;  4Z5T D;  1WWS A;  4X23 A;  1TAF A;  1KX3 C;  1JFI B;  2CWE A;  4G91 B;  4H9Q B;  2HIO C;  3VH5 A;  3V9R B;  3MVD C;  3WAA A;  1P3P B;  2NZD D;  4CSR B;  3C1B D;  5B24 A;  3A6N A;  4AWL C;  1P3M A;  3WTP E;  5CPJ A;  4WU9 A;  1P3L B;  3KWQ C;  3AZE D;  3AFA B;  2JE5 A;  2YFV A;  4G92 C;  1M19 A;  3KSY A;  1P3L A;  3WA9 D;  5GSU B;  2Y2P A;  5AV6 C;  5CPI A;  1EQZ C;  2XD1 A;  2BYK B;  2Y2Q A;  5B1M A;  5CPK C;  3REL A;  3AZM B;  4QLC C;  1AOI B;  4WNN A;  3X1U B;  5GXQ B;  5B1L B;  3MNN D;  1M18 B;  3AV2 D;  2HIO B;  3AZK A;  4ZBJ B;  3X1T D;  5AV8 B;  3A6N B;  3REL B;  1P34 D;  1P3A C;  5CPI C;  5JA4 A;  3LZ0 D;  5DNN A;  3MGP D;  2Y2I A;  4G91 C;  1TAF B;  4X23 B;  1JFI A;  3AV2 C;  3W98 C;  5GT0 C;  5CP6 D;  4WU8 C;  2JCH A;  4J8U A;  5JRG D;  3LZ0 C;  4J8W A;  4YS3 A;  1BFM A;  2Y2G A;  1F1E A;  1M1A C;  2FJ7 B;  4XZQ D;  1ULY A;  3B6F C;  4H9P B;  3VH5 W;  3KUY A;  3W99 A;  3MNN A;  1BH8 A;  2ZY2 A;  4WU8 A;  1P3B B;  4HGA C;  4YM6 D;  3W98 B;  5CPI D;  4J8V A;  5AV5 D;  4J8V D;  3UTB D;  3VH6 A;  1KX4 C;  1HTA A;  5BT1 D;  3AZL C;  5AVC D;  3REK B;  3W99 D;  5B1L A;  5GXQ A;  1M18 A;  3A6N D;  3X1T B;  1P3F C;  4XZQ C;  3WTP D;  2J8P A;  3UTA B;  1P3A A;  3B6F D;  4NE3 A;  5JRG A;  3FDD A;  3WAA D;  1H3O A;  3EPL A;  2YFW A;  4YM6 C;  4CAY A;  5C3I B;  5AY8 B;  4J8V B;  2BYK A;  5B1M B;  3UTB B;  1P3I D;  4KGC A;  4Z2M G;  3MGP A;  3MGS A;  3MGS C;  5B32 A;  4DRA A;  4YS3 C;  3NQU B;  3LZ0 A;  3MGQ A;  4J8W C;  3TU4 B;  1P3M B;  3X1S A;  2NQB A;  3W97 C;  3EPK A;  3AZK D;  3UTA C;  4XUJ C;  2JSS A;  4YM6 A;  3AYW B;  5B0Y A;  2F8N A;  4WU8 B;  2F8N D;  3AZM D;  1P3B A;  5B2J B;  4H9O B;  2ZY3 A;  1KX3 B;  5DNM A;  1N1J B;  3AZJ A;  1P3L D;  3LZ1 A;  3REH C;  1KU5 A;  5AV8 C;  3LJA A;  3W96 C;  1P3B C;  3AZI A;  5DNM B;  3AZJ B;  5KDM B;  5B2J C;  3LJA B;  1WWI A;  2NZD A;  5GXQ D;  5B1L D;  3TU4 C;  1M18 D;  1P3M C;  4H9O A;  1KX3 A;  3AFA C;  3X1U A;  3AZH D;  1BH9 B;  1U35 D;  3O62 B;  2YFV B;  3UTB A;  1P3O C;  3B6G C;  3AZN D;  4E45 A;  5GT3 B;  5CPI B;  3WA9 A;  3NQU A;  4ZBJ C;  3A6N C;  1P3F B;  1F66 A;  4E44 A;  3X1U C;  4H9N B;  3MGR D;  3H0M C;  3UTA A;  2BG1 A;  4QLC A;  3LEL D;  4WU8 D;  1S32 A;  5CPJ B;  5BNX B;  1H3O B;  4NFT A;  2CV5 D;  3EG5 B;  4XZQ A;  5GSU C;  3AZL B;  2CV5 A;  1P3I C;  5B31 G;  5DNN C;  4NE6 A;  3LEL A;  1S32 D;  5BT1 C;  4YS3 D;  4J8W D;  3LEL C;  3AFA D;  4J8U D;  5CP6 A;  4Z5T B;  5AVB A;  3WKJ B;  3LJA C;  1P3F D;  5GSU D;  5KDM A;  3B6G D;  3IP4 C;  2VQR A;  3MGR B;  3AZN A;  3REJ D;  5DNN D;  5B2J A;  1M1A A;  4AWL B;  5BO0 A;  1U35 A;  4J8X A;  3X1U D;  4Z2M H;  5G49 B;  3MNN B;  4UPK A;  5BS7 A;  3WKJ C;  3W96 A;  2ZY5 A;  3AYW D;  3W98 A;  4UUZ B;  4X23 C;  3W99 C;  1B67 A;  1U35 B;  3LZ0 B;  3MVD B;  4R8P B;  4JJN B;  3WTP B;  5F99 A;  4J8U B;  5CPJ C;  3A1K A;  1TZY D;  3W97 D;  4EO5 B;  3B0C W;  5AV9 B;  3B6G A;  3KXB B;  1P3F A;  5CP6 B;  1F66 B;  3WKJ A;  1EQZ B;  3MNN C;  3AFA A;  1P3A B;  4Z66 B;  5CPJ D;  1P3M D;  5B1M C;  5DNM D;  3AZJ D;  3NQJ A;  3REJ C;  2DF4 C;  3AZF D;  5AV8 D;  3B0D C;  1M19 C;  3AZM A;  1P3B D;  4YM6 B;  3AYW A;  3W98 D;  4QLC D;  1TZY B;  3X1S B;  2IO5 C;  5JRG C;  1B6W A;  4J8X D;  4WU9 C;  1M1A D;  3REK C;  5B0Z A;  1P3K A;  5FUG A;  3REJ B;  5B31 A;  3REI C;  1P3L C;  1P3I A;  5GSU A;  2CV5 C;  1R4V A;  4KUD C;  5AVB D;  3AZH C;  5CPK A;  3W96 B;  5CP6 C;  1S32 C;  3AN2 A;  5B0Y C;  3KXB C;  3B6F A;  5GT3 C;  3REI A;  4ZUX C;  3C1C A;  3VH6 W;  3WAA B;  5B32 C;  3MGQ C;  5B32 G;  2Y2N A;  4H9P A;  4H9S C;  5AV9 D;  4LD9 D;  5AVC A;  5BS7 C;  3AZE B;  2FJ7 C;  2RVQ C;  2LY8 A;  3WKJ D;  5AV5 A;  3AZN C;  5E5A A;  3X1V B;  2YFW B;  5B40 B;  5CHL B;  3WAA C;  3MVD A;  3UTB C;  1P3O A;  2UWX A;  3P5J B;  4Z5T C;  1AOI A;  1N1J A;  1KX3 D;  1Z2C B;  1ID3 A;  4WJ3 C;  3TU4 A;  2NQB B;  5BNX A;  5B32 D;  3MGQ D;  1S32 B;  5FUG B;  4Z66 A;  3REJ A;  2G5I C;  3AYW C;  3AZF C;  3AZM C;  2RVQ D;  5B2I A;  3AV1 A;  3LJA D;  1KX4 A;  2NQB C;  2HUE B;  2L5A A;  3AZG A;  3LZ1 D;  1TZY C;  1P3A D;  4KHA A;  1BH9 A;  4CSR A;  4WU9 B;  1P3O B;  3X1T A;  2F2A C;  5B31 C;  3AV2 A;  3KUY B;  1ID3 B;  3A1I A;  3R45 A;  4KUD D;  4XUJ A;  3X1S D;  4H9Q A;  3X1T C;  3X1V D;  3KXB D;  5E5A B;  5AV5 B;  3X1V A;  1M19 D;  2ARO D;  4R8P A;  2RIQ A;  1W2E A;  2Y2H A;  2F8N H;  3AZH A;  5GT0 B;  2Y2M A;  5AV9 C;  4WU9 D;  4J8X C;  5JA4 B;  1U35 C;  5AVC B;  3KUY D;  1HQ3 B;  2ZY4 A;  3AZI C;  3WTP A;  3AZH B;  5B24 D;  1ZLA C;  3B0C T;  3C1B A;  2DQN C;  4KUD B;  5B0Y B;  5E5A C;  4QLC B;  5F99 C;  3MGR C;  5B1L C;  5GXQ C;  1M18 C;  4LD9 B;  5BO0 B;  2FJ7 A;  4XUJ B;  3AZI D;  5B24 C;  5JRG B;  4KGC B;  2NZD C;  3B0B A;  3LZ1 B;  3C1B C;  3LEL B;  5B0Z B;  1P3K B;  5AY8 A;  4WZS B;  2IO5 B;  5AVB B;  4G92 B;  4J8V C;  3AV2 B;  5B0Z C;  1P3K C;  1P34 B;  4WNN B;  1KX5 C;  1ID3 D;  4KGC C;  2NZD B;  5B0Y D;  5B2I C;  3AN2 B;  3AV1 C;  2ARO A;  2NQB D;  4ZUX D;  4H9R A;  5E5A D;  4Z66 C;  3EPJ A;  2W8S A;  2PYO D;  5GT3 A;  4KGC D;  1ZLA B;  2Y2J A;  3O62 A;  3UT9 B;  4J8U C;  4H9R B;  1HQ3 C;  3AZE A;  4R8P C;  5BNV A;  2FJ7 D;  3W99 B;  4EO5 C;  5AV9 A;  2BYM A;  4JJN C;  2F8N G;  3VH6 T;  3C1C B;  1P34 A;  3C1B B;  3MGP C;  3X1V C;  1BH8 B;  3AZG D;  3AZK C;  3V9R A;  5B33 A;  4H9S A;  3REL D;  3LZ1 C;  3REH A;  5B33 C;  5B1M D;  5DNM C;  3AZJ C;  4Z5T A;  3O62 D;  3MGP B;  2PYO A;  4Z66 D;  3KUY C;  1ZLA A;  3REH B;  2Y2L A;  4ZUX A;  3C1C C;  2HIO A;  3AZK B;  2XD5 A;  5DNN B;  2G5H C;  2F8N B;  5GT0 D;  1AOI D;  3AZG B;  1P3O D;  3AZF A;  2ZM5 A;  2CV5 B;  4J8X B;  5AV5 C;  2Y2O A;  3MGS B;  1KX4 D;  1AOI C;  1P3G A;  3W97 B;  5B2I B;  3AV1 B;  1P3G C;  3O62 C;  5BNV B;  1ID3 C;  1KX5 B;  5AV6 A;  1EQZ A;  3B6G B;  1M19 B;  2Y2K A;  5B31 B;  3W97 A;  1P3G B;  3C1C D;  5C3I C;  5AY8 C;  5F99 D;  2ARO C;  3AL0 C;  3KWQ B;  3NQJ B;  3AZF B;  3MVD D;  4R8P D;  1KX4 B;  1Q9C A;  3REK A;  3KXB A;  5AV6 D;  1EQZ D;  3WA9 B;  4ZUX B;  1KX5 D;  3EPH A;  3WTP C;  4XUJ D;  3AZI B;  3H0L C;  1P3G D;  1PZR A;  4KUD A;  3UT9 D;  4LD9 A;  5AV8 A;  5B33 B;  2PYO C;  2FFF B;  3REI B;  4NE5 A;  1P3P A;  4J8W B;  4YS3 B;  3VH5 T;  3AN2 D;  3UTA D;  3B6F B;  5CPK D;  3MGR A;  1A7W A;  2BYM B;  5B2I D;  3AZN B;  3AV1 D;  4DQY B;  4WV4 B;  4X23 D;  1M1A B;  1KX5 A;  2ARO B;  5B31 D;  1P3I B;  3REH D;  4CAY B;  4XZQ B;  3AZL A;  3TU4 D;  4DRB A;  5B33 D;  3REL C;  1HQ3 D;  3KWQ A;  3F6T A;  3UT9 C;  5B40 D;  3W96 D;  3WA9 C;  1P3P D;  2F8N K;  4KHA B;  2HUE C;  4JJN D;  1F66 C;  5B2J D;  5CPK B;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...