3REIB

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiB00
3W97B 1P3FB 2IO5C 1JFIA 1ULYA 5B33D 3UTBC 4YS3D 1P3GB 1AOIC 2PYOA 1F1EA 3LZ1B 4G92C 1P3KD 5AV6C 3W96A 3AZMC 3REHD 4R8PD 5CPJB 1EQZD 1TAFB 1KX4B 3B6FB 4ZUXA 4ZBJB 5B33C 4YS3C 3W99B 2NQBB 3WAAA 1P3FD 4CSRA 5BS7C 3REHC 1ZLAD 1P3GD 2CWEA 1N1JA 5DNNA 4R8PC 4WU9A 3LZ1D 4H9NB 4CAYA 5AVBB 2FJ7A 3KUYB 5FUGB 2YFVA 4NFTA 3NQJA 5CPJD 1KX4D 1P3FC 3B6FD 1ZLAC 4M6BA 3W99D 2NQBD 1KX5A 2PYOC 3C1BB 3W96C 3X1TB 1M18B 5CPJC 3A6NB 3B6FC 5AVBD 4J8XA 4ZBJC 3MNNA 5B1MA 4KGCA 3AZLD 2NQBC 3MGSB 4J8UD 2NZDA 5BT1D 5B40A 5G49A 5E5AA 3AZLC 1U35B 4NE5A 1M18D 4Z5TA 3A6ND 2L5AA 4J8UC 5BT1C 3MGQA 3W98A 4J8XD 3WA9B 3O62B 1P3AB 3AZHB 3LELB 5BNVA 3AZIA 3AV1A 5CPKB 1M18C 3RELB 5GSUB 3A6NC 3KWQA 5B40D 3NQUB 4G91C 5GT0A 4J8XC 2HUEB 3AV2B 5B31B 4Z2MG 1WWIA 5B31G 3REIA 3UT9A 2NZDC 3MGRA 3AZGB 3O62D 4QLCB 5B40C 5BO0B 4WZSB 1P3AD 3WTPB 1B67A 2AROB 2JSSA 3LELD 1P3PA 5AY8A 5CPKD 1ID3A 5F99A 3AZEB 3AV1D 3X1UB 3B6GB 5AVCA 3AZJA 3AV2D 1S32B 5AV8B 5GT0D 3O62C 3W98C 4H9RA 4XUJA 5B32A 3X1SA 3AFAA 2IO5B 4QLCD 3UTBB 3AZIC 3AV1C 3X1VA 3MGRD 1Q9CA 2YFWB 3VH6W 3WTPD 4H9QA 1A7WA 5GT3B 3VH5T 4JJNA 4G92B 5AV6B 5GT0C 4UUZB 3AZMB 5GXQB 3AZED 4Z66A 1P3BB 1P3IA 5CPIA 3MGPA 5AV8D 5B33B 4QLCC 3AZJD 3MGRC 1P34B 4J8WA 5B2JB 5B1LB 1P3OA 3R45A 5B32D 3UTBD 3AZEC 3X1SD 3AFAD 3REJA 1M1AA 1ID3C 5F99C 5DNMA 5GT3D 3X1VD 2BYKB 5AVCC 3AZJC 1P3MA 5GXQD 3REKA 4H9PA 2BYMB 1P3BD 4XUJC 3LZ0A 4WNNA 5B32C 3KXBA 4XZQA 1ZLAB 3AFAC 3X1SC 1JFIB 3MGPD 4KUDA 5GT3C 1H3OA 3X1VC 1P34D 2PYOB 5B2JD 5B1LD 4JJNC 4LD9A 5GXQC 3W96B 3MVDA 3V9RA 1P3BC 4YM6A 3REJD 3LJAA 4X23A 3MGPC 5KDMA 4ZUXB 1P34C 5B2JC 5B1LC 3WAAB 1P3OC 4CSRB 1R4VA 4E45A 3REJC 1N1JB 5DNNB 2PYOD 4WU9B 4CAYB 3AZLB 2FJ7B 3W96D 3VH5A 4LD9D 2YFVB 3REKC 3WTPE 1HQ3A 4NE3A 3NQJB 4J8UB 3TU4A 4ZUXD 3KSYA 2F8NK 3AZKA 1KX5B 3WAAD 3UTAA 1KX3A 4LD9C 5DNND 4WU9D 4G91B 3LJAC 4ZUXC 4J8XB 2FJ7D 2CV5A 3WAAC 4H9SA 2NZDB 3TU4D 5DNNC 4E44A 5B40B 4WU9C 1KX5D 3AZNA 2FJ7C 5G49B 5E5AB 1F66A 3B0CT 4Z5TB 5BNXA 5JRGA 3MNND 5B1MD 3MGQB 5B2IA 3AN2A 4KGCD 3TU4C 3W98B 1KX5C 5AV9A 3C1CA 3UTAC 2NZDD 1BH9A 5BNVB 3AZIB 3AV1B 5E5AD 3MNNC 5B1MC 1P3LA 1U35A 4KGCC 5GT0B 1M19A 4Z5TD 2CV5C 4H9SC 4WU8A 3MGQD 3REIB 3W98D 3UT9B 3WA9A 3AN2D 5B2ID 3MGRB 5E5AC 3AZFA 3WKJA 4H9OA 1P3PB 1ID3B 5GSUA 5AY8B 4Z5TC 3AZID 1F66C 5B0YA 5F99B 3NQUA 3KWQD 3MGQC 5AVCB 3AZJB 2RVQD 5B31A 5B2IC 3AN2C 1M19D 4H9RB 5CP6A 2HIOA 1BH8A 3B0DB 4XUJB 5B32B 3REID 3AZGA 3X1SB 3AFAB 3UT9D 4WU8D 1KU5A 5AV5A 3KWQC 5B32G 3X1VB 2AROA 4JJNB 2RVQC 1P3PD 1ID3D 5AY8D 1M19C 3WKJD 5F99D 4KHAB 3B6GA 5B0YD 5B24A 5JA4A 4Z66B 5AVCD 3REIC 4WU8C 3UT9C 5CPIB 1S32A 3MGPB 3AYWA 4XUJD 4J8WB 1P3PC 1P3OB 5AY8C 3R45B 3WKJC 4DRAA 1AOIA 3REJB 5B0ZA 5B0YC 2F8NA 5DNMB 4HGAC 4J8VA 4WV4B 4JJND 4UUZA 1P3MB 3REKB 3B0DC 2HIOC 4H9PB 4Z66D 1P3ID 5CPID 4YS3A 4WNNB 3KXBB 1WWSA 4XZQB 1TZYA 1P3KA 4KUDB 1H3OB 4J8WD 1P3OD 3REHA 4LD9B 4R8PA 1M1AD 1EQZA 4Z66C 5DNMD 2BYKA 5CPIC 4YM6B 3LJAB 1P3IC 5B0ZD 2F8ND 4X23B 4AWLB 1P3MD 3W97A 5KDMB 3REKD 4J8WC 3AYWC 1P3FA 1ZLAA 3LZ0D 3KXBD 1P3GA 4XZQD 1M1AC 3LZ1A 5DNMC 4KUDD 1TZYD 5B0ZC 4J8VC 1P3MC 5CHLB 5CPJA 3MVDD 1TAFA 1KX4A 4YM6D 1HQ3B 3B6FA 3LJAD 3LZ0C 4X23D 3KXBC 4XZQC 3W99A 3TU4B 2NQBA 4KUDC 3W97D 1TZYC 3AZKB 1P3KC 3UTAB 1KX3B 3MVDC 3VH6T 4H9NA 4YM6C 5AVBA 1EQZC 3KUYA 4X23C 3MNNB 5FUGA 5B1MB 4AWLC 3AZLA 4KGCB 3W97C 1HQ3D 4J8UA 2CV5B 4NE6A 1P3GC 3LZ1C 3C1BA 3AZKD 3AZNB 3VH5W 3UTAD 3X1TA 4DRBA 1M18A 1KX3D 3A6NA 1F66B 1HQ3C 1KX4C 5BNXB 5JRGB 3KUYD 3W99C 3AN2B 5B2IB 3MGSA 1B6WA 3AZKC 2CV5D 5AV9B 1KX3C 3C1CB 5C3IB 1BH9B 3KWQB 3AZND 5AVBC 3C1BD 3KUYC 1P3LB 1F66D 3X1TD 1M19B 5JRGD 1BFMA 4WU8B 3O62A 1P3AA 3AZHA 5AV9D 3AZNC 3MGSD 3C1BC 3LELA 3AZFB 5CPKA 3C1CD 3RELA 3X1TC 3WKJB 4H9OB 5JRGC 5B0YB 4HGAB 3VH6A 3AV2A 1P3LD 1U35D 5AV9C 2LY8A 3MGSC 5CP6B 2HIOB 1BH8B 3C1CC 4QLCA 5C3IC 4EO5B 5BO0A 3WA9D 3WTPA 5AV5B 4H9QB 3AZHD 3AZFD 1P3LC 1U35C 4Z2MH 3AZEA 3X1UA 3RELD 5GSUD 1P3IB 5AV8A 5B24B 5JA4B 3WA9C 5B31D 1P3AC 5CP6D 2HIOD 3AZHC 3AYWB 3AZFC 3LELC 3UTBA 5CPKC 3RELC 5GSUC 3AZGD 2YFWA 1M1AB 5AV5D 5GT3A 1AOIB 5AV6A 5B0ZB 2F8NB 2AROD 3AZMA 2HUEC 4J8VB 5GXQA 3AV2C 5B31C 4KHAA 2F8NG 5CP6C 1P3BA 3X1UD 3B6GD 5B33A 3LZ0B 5B24D 4EO5C 3AZGC 1S32D 4YS3B 5AV5C 3B0BA 1P34A 5B2JA 5B1LA 3WTPC 3AYWD 1TZYB 2AROC 5BS7A 1P3KB 2F8NH 3REHB 3MVDB 3V9RB 3X1UC 1AOID 3B6GC 4R8PB 1EQZB 3B0CW 5B24C 4J8VD 5AV6D 5AV8C 1S32C 3AZMD 2BYMA 1HTAA
chains in the Genus database with same CATH superfamily
3W97B 1P3FB 2IO5C 1JFIA 1ULYA 5B33D 3UTBC 4YS3D 1P3GB 1AOIC 2PYOA 1F1EA 3LZ1B 4G92C 1P3KD 5AV6C 3W96A 3AZMC 3REHD 4R8PD 5CPJB 1EQZD 1TAFB 1KX4B 3B6FB 4ZUXA 4ZBJB 5B33C 2VQRA 4YS3C 3W99B 2ZY5A 2NQBB 3WAAA 1P3FD 4CSRA 5BS7C 3REHC 1ZLAD 1P3GD 2CWEA 1N1JA 5DNNA 4R8PC 4WU9A 3LZ1D 4H9NB 4CAYA 5AVBB 2FJ7A 2UWXA 3KUYB 5FUGB 2YFVA 4NFTA 3NQJA 5CPJD 1KX4D 1P3FC 3F6TA 3B6FD 1ZLAC 4M6BA 3W99D 2W8SA 2NQBD 1KX5A 2PYOC 3C1BB 3W96C 3X1TB 1M18B 5CPJC 3A6NB 3B6FC 5AVBD 4J8XA 4ZBJC 3MNNA 5B1MA 4KGCA 3AZLD 2NQBC 3H0RC 3MGSB 4J8UD 2NZDA 5BT1D 5B40A 3H0LC 3A1IA 5G49A 5E5AA 3AZLC 1U35B 4NE5A 1M18D 4Z5TA 3A6ND 2L5AA 4J8UC 5BT1C 3MGQA 3W98A 4J8XD 3WA9B 3O62B 3EG5B 1P3AB 3AZHB 3LELB 5BNVA 3AZIA 3AV1A 5CPKB 1M18C 3RELB 5GSUB 3A6NC 3KWQA 5B40D 3NQUB 4G91C 5GT0A 4J8XC 3EPLA 2HUEB 3AV2B 5B31B 4Z2MG 1WWIA 5B31G 3REIA 3UT9A 2NZDC 3MGRA 3AZGB 3O62D 4QLCB 5B40C 5BO0B 4WZSB 1P3AD 3WTPB 1B67A 2AROB 2JSSA 3LELD 1P3PA 5AY8A 1W2EA 5CPKD 1ID3A 5F99A 3AZEB 3EPJA 3AV1D 3X1UB 3B6GB 5AVCA 3AZJA 3AV2D 1S32B 2XD1A 5AV8B 5GT0D 3O62C 3W98C 4H9RA 2Y2JA 2JE5A 4XUJA 5B32A 3X1SA 3AFAA 2IO5B 4QLCD 3UTBB 3AZIC 3AV1C 3X1VA 3MGRD 1PZRA 1Q9CA 2YFWB 3VH6W 4H9QA 1A7WA 5GT3B 3VH5T 3WTPD 4JJNA 4G92B 2FFFB 5GT0C 5AV6B 4UUZB 3AZMB 5GXQB 3AZED 4Z66A 1P3BB 1P3IA 5CPIA 3MGPA 5AV8D 5B33B 4QLCC 3AZJD 3MGRC 2J8PA 1Z2CB 1P34B 4J8WA 5B2JB 2RIQA 5B1LB 1P3OA 3R45A 5B32D 3UTBD 3AZEC 3X1SD 3AFAD 3REJA 1M1AA 1ID3C 5F99C 5DNMA 5GT3D 3X1VD 2BYKB 5AVCC 3AZJC 1P3MA 5GXQD 3REKA 4H9PA 2BYMB 1P3BD 4XUJC 3LZ0A 4WNNA 2Y2PA 5B32C 3KXBA 4XZQA 1ZLAB 3AFAC 3X1SC 1JFIB 3MGPD 3EPKA 4KUDA 5GT3C 1H3OA 3X1VC 1P34D 2PYOB 5B2JD 5B1LD 4JJNC 4LD9A 5GXQC 3W96B 3MVDA 3V9RA 1P3BC 4YM6A 3REJD 1T3UA 2ZY3A 2ZY4A 3LJAA 4X23A 3MGPC 5KDMA 4ZUXB 1P34C 5B2JC 5B1LC 3WAAB 1P3OC 4CSRB 1R4VA 4E45A 4WJ3C 3REJC 1N1JB 5DNNB 2PYOD 2Y2KA 4WU9B 2Y2NA 4CAYB 3AZLB 2FJ7B 3W96D 3VH5A 4LD9D 2YFVB 3REKC 3WTPE 1HQ3A 4NE3A 3NQJB 4J8UB 2F2AC 3TU4A 4ZUXD 3KSYA 2F8NK 3AZKA 1KX5B 3WAAD 3KFUG 3UTAA 1KX3A 4LD9C 5DNND 4WU9D 4G91B 3LJAC 4ZUXC 4J8XB 2FJ7D 2CV5A 3WAAC 4H9SA 2NZDB 3TU4D 5DNNC 4E44A 5B40B 4WU9C 1KX5D 3AZNA 2FJ7C 5G49B 5E5AB 2Y2GA 1F66A 2Y2OA 3B0CT 4Z5TB 5BNXA 5JRGA 3MNND 3AL0C 5B1MD 3MGQB 5B2IA 4UPKA 3AN2A 3TU4C 3W98B 4KGCD 1KX5C 5AV9A 2ZY2A 3C1CA 3UTAC 2NZDD 1BH9A 5BNVB 3AZIB 3AV1B 5E5AD 3MNNC 5B1MC 1P3LA 1U35A 4KGCC 5GT0B 1M19A 4Z5TD 2CV5C 4H9SC 4WU8A 3MGQD 3REIB 3W98D 3UT9B 3WA9A 3AN2D 5B2ID 3MGRB 5E5AC 3AZFA 3WKJA 4H9OA 1P3PB 1ID3B 5GSUA 5AY8B 4Z5TC 3AZID 1F66C 5B0YA 5F99B 3NQUA 3KWQD 2Y2LA 3MGQC 5AVCB 3AZJB 2RVQD 5B31A 5B2IC 3AN2C 1M19D 4H9RB 5CP6A 2HIOA 4DQYB 1BH8A 3B0DB 4XUJB 5B32B 3REID 3AZGA 3X1SB 3AFAB 3UT9D 4WU8D 1KU5A 5AV5A 3KWQC 5B32G 3X1VB 2AROA 4JJNB 2RVQC 1P3PD 1ID3D 5AY8D 1M19C 3WKJD 2XD5A 5F99D 4KHAB 3B6GA 5B0YD 5B24A 5JA4A 4Z66B 5AVCD 3REIC 4WU8C 3UT9C 5CPIB 1S32A 3MGPB 3AYWA 4XUJD 3FDDA 4J8WB 2G5HC 2ZM5A 1P3PC 1P3OB 5AY8C 3R45B 3WKJC 4DRAA 1AOIA 3REJB 5B0ZA 5B0YC 2F8NA 5DNMB 2Y2QA 4HGAC 4WV4B 4J8VA 4JJND 4UUZA 1P3MB 2Y2IA 2G5IC 3REKB 3B0DC 2HIOC 4H9PB 3IP4C 4Z66D 1P3ID 5CPID 4YS3A 4WNNB 3KXBB 1WWSA 4XZQB 1TZYA 1P3KA 4KUDB 1H3OB 4J8WD 1P3OD 3REHA 4LD9B 4R8PA 1M1AD 1EQZA 4Z66C 5DNMD 2BYKA 5CPIC 4YM6B 3LJAB 1P3IC 5B0ZD 2F8ND 4X23B 4AWLB 1P3MD 3W97A 5KDMB 3REKD 2Y2HA 4J8WC 3AYWC 1P3FA 1ZLAA 3LZ0D 3KXBD 1P3GA 4XZQD 1M1AC 3LZ1A 5DNMC 4KUDD 1TZYD 5B0ZC 4J8VC 1P3MC 5CHLB 5CPJA 3MVDD 1TAFA 1KX4A 4YM6D 1HQ3B 3B6FA 3LJAD 3LZ0C 4X23D 3KXBC 4XZQC 3W99A 3TU4B 2NQBA 4KUDC 3W97D 1TZYC 3AZKB 1P3KC 3P5JB 3UTAB 1KX3B 3MVDC 3VH6T 4H9NA 4YM6C 5AVBA 1EQZC 2DF4C 3KUYA 4X23C 3MNNB 5FUGA 5B1MB 4AWLC 3AZLA 4KGCB 3W97C 1HQ3D 4J8UA 2CV5B 4NE6A 1P3GC 3LZ1C 3C1BA 3AZKD 3AZNB 3VH5W 3UTAD 3X1TA 4DRBA 1M18A 1KX3D 3A6NA 1F66B 1HQ3C 1KX4C 5BNXB 5JRGB 3KUYD 3W99C 3AN2B 5B2IB 3MGSA 1B6WA 3AZKC 2CV5D 5AV9B 1KX3C 3C1CB 5C3IB 1BH9B 3KWQB 3AZND 5AVBC 3C1BD 3KUYC 1P3LB 2BG1A 1F66D 3X1TD 1M19B 5JRGD 1BFMA 4WU8B 3O62A 1P3AA 3AZHA 5AV9D 3AZNC 3MGSD 3C1BC 3LELA 3AZFB 5CPKA 3C1CD 3RELA 3X1TC 3WKJB 4H9OB 5JRGC 5B0YB 4HGAB 3VH6A 3AV2A 1P3LD 1U35D 5AV9C 2LY8A 3MGSC 5CP6B 2HIOB 1BH8B 3C1CC 4QLCA 5C3IC 4EO5B 5BO0A 3WA9D 3WTPA 3EPHA 5AV5B 4H9QB 3AZHD 3AZFD 1P3LC 1U35C 4Z2MH 3AZEA 3X1UA 3RELD 5GSUD 1P3IB 5AV8A 2DQNC 2JCHA 5B24B 5JA4B 3WA9C 5B31D 3A1KA 1P3AC 5CP6D 2HIOD 3AZHC 3AYWB 3AZFC 3LELC 3UTBA 5CPKC 3RELC 5GSUC 3AZGD 2YFWA 1M1AB 5AV5D 5GT3A 1AOIB 2Y2MA 5AV6A 5B0ZB 2F8NB 2AROD 3AZMA 2HUEC 4J8VB 5GXQA 3AV2C 5B31C 4KHAA 2F8NG 5CP6C 1P3BA 3X1UD 3B6GD 5B33A 3LZ0B 5B24D 4EO5C 3AZGC 1S32D 3H0MC 4YS3B 5AV5C 3B0BA 1P34A 5B2JA 5B1LA 3WTPC 3AYWD 1TZYB 2AROC 5BS7A 1P3KB 2F8NH 3REHB 3MVDB 3V9RB 3X1UC 1AOID 3B6GC 4R8PB 1EQZB 3B0CW 5B24C 4J8VD 5AV6D 5AV8C 1S32C 3AZMD 2BYMA 1HTAA
chains in the Genus database with same CATH topology
3W97B 1P3FB 2IO5C 1JFIA 1ULYA 5B33D 3UTBC 4YS3D 1P3GB 1AOIC 2PYOA 1F1EA 3LZ1B 4G92C 1P3KD 5AV6C 3W96A 3AZMC 3REHD 4R8PD 5CPJB 1EQZD 1TAFB 1KX4B 3B6FB 4ZUXA 4ZBJB 5B33C 2VQRA 4YS3C 3W99B 2ZY5A 2NQBB 3WAAA 1P3FD 4CSRA 5BS7C 3REHC 1ZLAD 1P3GD 2CWEA 1N1JA 5DNNA 4R8PC 4WU9A 3LZ1D 4H9NB 4CAYA 5AVBB 2FJ7A 2UWXA 3KUYB 5FUGB 2YFVA 4NFTA 3NQJA 5CPJD 1KX4D 1P3FC 3F6TA 3B6FD 1ZLAC 4M6BA 3W99D 2W8SA 2NQBD 1KX5A 2PYOC 3C1BB 3W96C 3X1TB 1M18B 5CPJC 3A6NB 3B6FC 5AVBD 4J8XA 4ZBJC 3MNNA 5B1MA 4KGCA 3AZLD 2NQBC 3H0RC 3MGSB 4J8UD 2NZDA 5BT1D 5B40A 3H0LC 3A1IA 5G49A 5E5AA 3AZLC 1U35B 4NE5A 1M18D 4Z5TA 3A6ND 2L5AA 4J8UC 5BT1C 3MGQA 3W98A 4J8XD 3WA9B 3O62B 3EG5B 1P3AB 3AZHB 3LELB 5BNVA 3AZIA 3AV1A 5CPKB 1M18C 3RELB 5GSUB 3A6NC 3KWQA 5B40D 3NQUB 4G91C 5GT0A 4J8XC 3EPLA 2HUEB 3AV2B 5B31B 4Z2MG 1WWIA 5B31G 3REIA 3UT9A 2NZDC 3MGRA 3AZGB 3O62D 4QLCB 5B40C 5BO0B 4WZSB 1P3AD 3WTPB 1B67A 2AROB 2JSSA 3LELD 1P3PA 5AY8A 1W2EA 5CPKD 1ID3A 5F99A 3AZEB 3EPJA 3AV1D 3X1UB 3B6GB 5AVCA 3AZJA 3AV2D 1S32B 2XD1A 5AV8B 5GT0D 3O62C 3W98C 4H9RA 2Y2JA 2JE5A 4XUJA 5B32A 3X1SA 3AFAA 2IO5B 4QLCD 3UTBB 3AZIC 3AV1C 3X1VA 3MGRD 1PZRA 1Q9CA 2YFWB 3VH6W 4H9QA 1A7WA 5GT3B 3VH5T 3WTPD 4JJNA 4G92B 2FFFB 5GT0C 5AV6B 4UUZB 3AZMB 5GXQB 3AZED 4Z66A 1P3BB 1P3IA 5CPIA 3MGPA 5AV8D 5B33B 4QLCC 3AZJD 3MGRC 2J8PA 1Z2CB 1P34B 4J8WA 5B2JB 2RIQA 5B1LB 1P3OA 3R45A 5B32D 3UTBD 3AZEC 3X1SD 3AFAD 3REJA 1M1AA 1ID3C 5F99C 5DNMA 5GT3D 3X1VD 2BYKB 5AVCC 3AZJC 1P3MA 5GXQD 3REKA 4H9PA 2BYMB 1P3BD 4XUJC 3LZ0A 4WNNA 2Y2PA 5B32C 3KXBA 4XZQA 1ZLAB 3AFAC 3X1SC 1JFIB 3MGPD 3EPKA 4KUDA 5GT3C 1H3OA 3X1VC 1P34D 2PYOB 5B2JD 5B1LD 4JJNC 4LD9A 5GXQC 3W96B 3MVDA 3V9RA 1P3BC 4YM6A 3REJD 1T3UA 2ZY3A 2ZY4A 3LJAA 4X23A 3MGPC 5KDMA 4ZUXB 1P34C 5B2JC 5B1LC 3WAAB 1P3OC 4CSRB 1R4VA 4E45A 4WJ3C 3REJC 1N1JB 5DNNB 2PYOD 2Y2KA 4WU9B 2Y2NA 4CAYB 3AZLB 2FJ7B 3W96D 3VH5A 4LD9D 2YFVB 3REKC 3WTPE 1HQ3A 4NE3A 3NQJB 4J8UB 2F2AC 3TU4A 4ZUXD 3KSYA 2F8NK 3AZKA 1KX5B 3WAAD 3KFUG 3UTAA 1KX3A 4LD9C 5DNND 4WU9D 4G91B 3LJAC 4ZUXC 4J8XB 2FJ7D 2CV5A 3WAAC 4H9SA 2NZDB 3TU4D 5DNNC 4E44A 5B40B 4WU9C 1KX5D 3AZNA 2FJ7C 5G49B 5E5AB 2Y2GA 1F66A 2Y2OA 3B0CT 4Z5TB 5BNXA 5JRGA 3MNND 3AL0C 5B1MD 3MGQB 5B2IA 4UPKA 3AN2A 3TU4C 3W98B 4KGCD 1KX5C 5AV9A 2ZY2A 3C1CA 3UTAC 2NZDD 1BH9A 5BNVB 3AZIB 3AV1B 5E5AD 3MNNC 5B1MC 1P3LA 1U35A 4KGCC 5GT0B 1M19A 4Z5TD 2CV5C 4H9SC 4WU8A 3MGQD 3REIB 3W98D 3UT9B 3WA9A 3AN2D 5B2ID 3MGRB 5E5AC 3AZFA 3WKJA 4H9OA 1P3PB 1ID3B 5GSUA 5AY8B 4Z5TC 3AZID 1F66C 5B0YA 5F99B 3NQUA 3KWQD 2Y2LA 3MGQC 5AVCB 3AZJB 2RVQD 5B31A 5B2IC 3AN2C 1M19D 4H9RB 5CP6A 2HIOA 4DQYB 1BH8A 3B0DB 4XUJB 5B32B 3REID 3AZGA 3X1SB 3AFAB 3UT9D 4WU8D 1KU5A 5AV5A 3KWQC 5B32G 3X1VB 2AROA 4JJNB 2RVQC 1P3PD 1ID3D 5AY8D 1M19C 3WKJD 2XD5A 5F99D 4KHAB 3B6GA 5B0YD 5B24A 5JA4A 4Z66B 5AVCD 3REIC 4WU8C 3UT9C 5CPIB 1S32A 3MGPB 3AYWA 4XUJD 3FDDA 4J8WB 2G5HC 2ZM5A 1P3PC 1P3OB 5AY8C 3R45B 3WKJC 4DRAA 1AOIA 3REJB 5B0ZA 5B0YC 2F8NA 5DNMB 2Y2QA 4HGAC 4WV4B 4J8VA 4JJND 4UUZA 1P3MB 2Y2IA 2G5IC 3REKB 3B0DC 2HIOC 4H9PB 3IP4C 4Z66D 1P3ID 5CPID 4YS3A 4WNNB 3KXBB 1WWSA 4XZQB 1TZYA 1P3KA 4KUDB 1H3OB 4J8WD 1P3OD 3REHA 4LD9B 4R8PA 1M1AD 1EQZA 4Z66C 5DNMD 2BYKA 5CPIC 4YM6B 3LJAB 1P3IC 5B0ZD 2F8ND 4X23B 4AWLB 1P3MD 3W97A 5KDMB 3REKD 2Y2HA 4J8WC 3AYWC 1P3FA 1ZLAA 3LZ0D 3KXBD 1P3GA 4XZQD 1M1AC 3LZ1A 5DNMC 4KUDD 1TZYD 5B0ZC 4J8VC 1P3MC 5CHLB 5CPJA 3MVDD 1TAFA 1KX4A 4YM6D 1HQ3B 3B6FA 3LJAD 3LZ0C 4X23D 3KXBC 4XZQC 3W99A 3TU4B 2NQBA 4KUDC 3W97D 1TZYC 3AZKB 1P3KC 3P5JB 3UTAB 1KX3B 3MVDC 3VH6T 4H9NA 4YM6C 5AVBA 1EQZC 2DF4C 3KUYA 4X23C 3MNNB 5FUGA 5B1MB 4AWLC 3AZLA 4KGCB 3W97C 1HQ3D 4J8UA 2CV5B 4NE6A 1P3GC 3LZ1C 3C1BA 3AZKD 3AZNB 3VH5W 3UTAD 3X1TA 4DRBA 1M18A 1KX3D 3A6NA 1F66B 1HQ3C 1KX4C 5BNXB 5JRGB 3KUYD 3W99C 3AN2B 5B2IB 3MGSA 1B6WA 3AZKC 2CV5D 5AV9B 1KX3C 3C1CB 5C3IB 1BH9B 3KWQB 3AZND 5AVBC 3C1BD 3KUYC 1P3LB 2BG1A 1F66D 3X1TD 1M19B 5JRGD 1BFMA 4WU8B 3O62A 1P3AA 3AZHA 5AV9D 3AZNC 3MGSD 3C1BC 3LELA 3AZFB 5CPKA 3C1CD 3RELA 3X1TC 3WKJB 4H9OB 5JRGC 5B0YB 4HGAB 3VH6A 3AV2A 1P3LD 1U35D 5AV9C 2LY8A 3MGSC 5CP6B 2HIOB 1BH8B 3C1CC 4QLCA 5C3IC 4EO5B 5BO0A 3WA9D 3WTPA 3EPHA 5AV5B 4H9QB 3AZHD 3AZFD 1P3LC 1U35C 4Z2MH 3AZEA 3X1UA 3RELD 5GSUD 1P3IB 5AV8A 2DQNC 2JCHA 5B24B 5JA4B 3WA9C 5B31D 3A1KA 1P3AC 5CP6D 2HIOD 3AZHC 3AYWB 3AZFC 3LELC 3UTBA 5CPKC 3RELC 5GSUC 3AZGD 2YFWA 1M1AB 5AV5D 5GT3A 1AOIB 2Y2MA 5AV6A 5B0ZB 2F8NB 2AROD 3AZMA 2HUEC 4J8VB 5GXQA 3AV2C 5B31C 4KHAA 2F8NG 5CP6C 1P3BA 3X1UD 3B6GD 5B33A 3LZ0B 5B24D 4EO5C 3AZGC 1S32D 3H0MC 4YS3B 5AV5C 3B0BA 1P34A 5B2JA 5B1LA 3WTPC 3AYWD 1TZYB 2AROC 5BS7A 1P3KB 2F8NH 3REHB 3MVDB 3V9RB 3X1UC 1AOID 3B6GC 4R8PB 1EQZB 3B0CW 5B24C 4J8VD 5AV6D 5AV8C 1S32C 3AZMD 2BYMA 1HTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 B;  1P3F B;  2IO5 C;  1JFI A;  1ULY A;  5B33 D;  3UTB C;  4YS3 D;  1P3G B;  1AOI C;  2PYO A;  1F1E A;  3LZ1 B;  4G92 C;  1P3K D;  5AV6 C;  3W96 A;  3AZM C;  3REH D;  4R8P D;  5CPJ B;  1EQZ D;  1TAF B;  1KX4 B;  3B6F B;  4ZUX A;  4ZBJ B;  5B33 C;  4YS3 C;  3W99 B;  2NQB B;  3WAA A;  1P3F D;  4CSR A;  5BS7 C;  3REH C;  1ZLA D;  1P3G D;  2CWE A;  1N1J A;  5DNN A;  4R8P C;  4WU9 A;  3LZ1 D;  4H9N B;  4CAY A;  5AVB B;  2FJ7 A;  3KUY B;  5FUG B;  2YFV A;  4NFT A;  3NQJ A;  5CPJ D;  1KX4 D;  1P3F C;  3B6F D;  1ZLA C;  4M6B A;  3W99 D;  2NQB D;  1KX5 A;  2PYO C;  3C1B B;  3W96 C;  3X1T B;  1M18 B;  5CPJ C;  3A6N B;  3B6F C;  5AVB D;  4J8X A;  4ZBJ C;  3MNN A;  5B1M A;  4KGC A;  3AZL D;  2NQB C;  3MGS B;  4J8U D;  2NZD A;  5BT1 D;  5B40 A;  5G49 A;  5E5A A;  3AZL C;  1U35 B;  4NE5 A;  1M18 D;  4Z5T A;  3A6N D;  2L5A A;  4J8U C;  5BT1 C;  3MGQ A;  3W98 A;  4J8X D;  3WA9 B;  3O62 B;  1P3A B;  3AZH B;  3LEL B;  5BNV A;  3AZI A;  3AV1 A;  5CPK B;  1M18 C;  3REL B;  5GSU B;  3A6N C;  3KWQ A;  5B40 D;  3NQU B;  4G91 C;  5GT0 A;  4J8X C;  2HUE B;  3AV2 B;  5B31 B;  4Z2M G;  1WWI A;  5B31 G;  3REI A;  3UT9 A;  2NZD C;  3MGR A;  3AZG B;  3O62 D;  4QLC B;  5B40 C;  5BO0 B;  4WZS B;  1P3A D;  3WTP B;  1B67 A;  2ARO B;  2JSS A;  3LEL D;  1P3P A;  5AY8 A;  5CPK D;  1ID3 A;  5F99 A;  3AZE B;  3AV1 D;  3X1U B;  3B6G B;  5AVC A;  3AZJ A;  3AV2 D;  1S32 B;  5AV8 B;  5GT0 D;  3O62 C;  3W98 C;  4H9R A;  4XUJ A;  5B32 A;  3X1S A;  3AFA A;  2IO5 B;  4QLC D;  3UTB B;  3AZI C;  3AV1 C;  3X1V A;  3MGR D;  1Q9C A;  2YFW B;  3VH6 W;  3WTP D;  4H9Q A;  1A7W A;  5GT3 B;  3VH5 T;  4JJN A;  4G92 B;  5AV6 B;  5GT0 C;  4UUZ B;  3AZM B;  5GXQ B;  3AZE D;  4Z66 A;  1P3B B;  1P3I A;  5CPI A;  3MGP A;  5AV8 D;  5B33 B;  4QLC C;  3AZJ D;  3MGR C;  1P34 B;  4J8W A;  5B2J B;  5B1L B;  1P3O A;  3R45 A;  5B32 D;  3UTB D;  3AZE C;  3X1S D;  3AFA D;  3REJ A;  1M1A A;  1ID3 C;  5F99 C;  5DNM A;  5GT3 D;  3X1V D;  2BYK B;  5AVC C;  3AZJ C;  1P3M A;  5GXQ D;  3REK A;  4H9P A;  2BYM B;  1P3B D;  4XUJ C;  3LZ0 A;  4WNN A;  5B32 C;  3KXB A;  4XZQ A;  1ZLA B;  3AFA C;  3X1S C;  1JFI B;  3MGP D;  4KUD A;  5GT3 C;  1H3O A;  3X1V C;  1P34 D;  2PYO B;  5B2J D;  5B1L D;  4JJN C;  4LD9 A;  5GXQ C;  3W96 B;  3MVD A;  3V9R A;  1P3B C;  4YM6 A;  3REJ D;  3LJA A;  4X23 A;  3MGP C;  5KDM A;  4ZUX B;  1P34 C;  5B2J C;  5B1L C;  3WAA B;  1P3O C;  4CSR B;  1R4V A;  4E45 A;  3REJ C;  1N1J B;  5DNN B;  2PYO D;  4WU9 B;  4CAY B;  3AZL B;  2FJ7 B;  3W96 D;  3VH5 A;  4LD9 D;  2YFV B;  3REK C;  3WTP E;  1HQ3 A;  4NE3 A;  3NQJ B;  4J8U B;  3TU4 A;  4ZUX D;  3KSY A;  2F8N K;  3AZK A;  1KX5 B;  3WAA D;  3UTA A;  1KX3 A;  4LD9 C;  5DNN D;  4WU9 D;  4G91 B;  3LJA C;  4ZUX C;  4J8X B;  2FJ7 D;  2CV5 A;  3WAA C;  4H9S A;  2NZD B;  3TU4 D;  5DNN C;  4E44 A;  5B40 B;  4WU9 C;  1KX5 D;  3AZN A;  2FJ7 C;  5G49 B;  5E5A B;  1F66 A;  3B0C T;  4Z5T B;  5BNX A;  5JRG A;  3MNN D;  5B1M D;  3MGQ B;  5B2I A;  3AN2 A;  4KGC D;  3TU4 C;  3W98 B;  1KX5 C;  5AV9 A;  3C1C A;  3UTA C;  2NZD D;  1BH9 A;  5BNV B;  3AZI B;  3AV1 B;  5E5A D;  3MNN C;  5B1M C;  1P3L A;  1U35 A;  4KGC C;  5GT0 B;  1M19 A;  4Z5T D;  2CV5 C;  4H9S C;  4WU8 A;  3MGQ D;  3REI B;  3W98 D;  3UT9 B;  3WA9 A;  3AN2 D;  5B2I D;  3MGR B;  5E5A C;  3AZF A;  3WKJ A;  4H9O A;  1P3P B;  1ID3 B;  5GSU A;  5AY8 B;  4Z5T C;  3AZI D;  1F66 C;  5B0Y A;  5F99 B;  3NQU A;  3KWQ D;  3MGQ C;  5AVC B;  3AZJ B;  2RVQ D;  5B31 A;  5B2I C;  3AN2 C;  1M19 D;  4H9R B;  5CP6 A;  2HIO A;  1BH8 A;  3B0D B;  4XUJ B;  5B32 B;  3REI D;  3AZG A;  3X1S B;  3AFA B;  3UT9 D;  4WU8 D;  1KU5 A;  5AV5 A;  3KWQ C;  5B32 G;  3X1V B;  2ARO A;  4JJN B;  2RVQ C;  1P3P D;  1ID3 D;  5AY8 D;  1M19 C;  3WKJ D;  5F99 D;  4KHA B;  3B6G A;  5B0Y D;  5B24 A;  5JA4 A;  4Z66 B;  5AVC D;  3REI C;  4WU8 C;  3UT9 C;  5CPI B;  1S32 A;  3MGP B;  3AYW A;  4XUJ D;  4J8W B;  1P3P C;  1P3O B;  5AY8 C;  3R45 B;  3WKJ C;  4DRA A;  1AOI A;  3REJ B;  5B0Z A;  5B0Y C;  2F8N A;  5DNM B;  4HGA C;  4J8V A;  4WV4 B;  4JJN D;  4UUZ A;  1P3M B;  3REK B;  3B0D C;  2HIO C;  4H9P B;  4Z66 D;  1P3I D;  5CPI D;  4YS3 A;  4WNN B;  3KXB B;  1WWS A;  4XZQ B;  1TZY A;  1P3K A;  4KUD B;  1H3O B;  4J8W D;  1P3O D;  3REH A;  4LD9 B;  4R8P A;  1M1A D;  1EQZ A;  4Z66 C;  5DNM D;  2BYK A;  5CPI C;  4YM6 B;  3LJA B;  1P3I C;  5B0Z D;  2F8N D;  4X23 B;  4AWL B;  1P3M D;  3W97 A;  5KDM B;  3REK D;  4J8W C;  3AYW C;  1P3F A;  1ZLA A;  3LZ0 D;  3KXB D;  1P3G A;  4XZQ D;  1M1A C;  3LZ1 A;  5DNM C;  4KUD D;  1TZY D;  5B0Z C;  4J8V C;  1P3M C;  5CHL B;  5CPJ A;  3MVD D;  1TAF A;  1KX4 A;  4YM6 D;  1HQ3 B;  3B6F A;  3LJA D;  3LZ0 C;  4X23 D;  3KXB C;  4XZQ C;  3W99 A;  3TU4 B;  2NQB A;  4KUD C;  3W97 D;  1TZY C;  3AZK B;  1P3K C;  3UTA B;  1KX3 B;  3MVD C;  3VH6 T;  4H9N A;  4YM6 C;  5AVB A;  1EQZ C;  3KUY A;  4X23 C;  3MNN B;  5FUG A;  5B1M B;  4AWL C;  3AZL A;  4KGC B;  3W97 C;  1HQ3 D;  4J8U A;  2CV5 B;  4NE6 A;  1P3G C;  3LZ1 C;  3C1B A;  3AZK D;  3AZN B;  3VH5 W;  3UTA D;  3X1T A;  4DRB A;  1M18 A;  1KX3 D;  3A6N A;  1F66 B;  1HQ3 C;  1KX4 C;  5BNX B;  5JRG B;  3KUY D;  3W99 C;  3AN2 B;  5B2I B;  3MGS A;  1B6W A;  3AZK C;  2CV5 D;  5AV9 B;  1KX3 C;  3C1C B;  5C3I B;  1BH9 B;  3KWQ B;  3AZN D;  5AVB C;  3C1B D;  3KUY C;  1P3L B;  1F66 D;  3X1T D;  1M19 B;  5JRG D;  1BFM A;  4WU8 B;  3O62 A;  1P3A A;  3AZH A;  5AV9 D;  3AZN C;  3MGS D;  3C1B C;  3LEL A;  3AZF B;  5CPK A;  3C1C D;  3REL A;  3X1T C;  3WKJ B;  4H9O B;  5JRG C;  5B0Y B;  4HGA B;  3VH6 A;  3AV2 A;  1P3L D;  1U35 D;  5AV9 C;  2LY8 A;  3MGS C;  5CP6 B;  2HIO B;  1BH8 B;  3C1C C;  4QLC A;  5C3I C;  4EO5 B;  5BO0 A;  3WA9 D;  3WTP A;  5AV5 B;  4H9Q B;  3AZH D;  3AZF D;  1P3L C;  1U35 C;  4Z2M H;  3AZE A;  3X1U A;  3REL D;  5GSU D;  1P3I B;  5AV8 A;  5B24 B;  5JA4 B;  3WA9 C;  5B31 D;  1P3A C;  5CP6 D;  2HIO D;  3AZH C;  3AYW B;  3AZF C;  3LEL C;  3UTB A;  5CPK C;  3REL C;  5GSU C;  3AZG D;  2YFW A;  1M1A B;  5AV5 D;  5GT3 A;  1AOI B;  5AV6 A;  5B0Z B;  2F8N B;  2ARO D;  3AZM A;  2HUE C;  4J8V B;  5GXQ A;  3AV2 C;  5B31 C;  4KHA A;  2F8N G;  5CP6 C;  1P3B A;  3X1U D;  3B6G D;  5B33 A;  3LZ0 B;  5B24 D;  4EO5 C;  3AZG C;  1S32 D;  4YS3 B;  5AV5 C;  3B0B A;  1P34 A;  5B2J A;  5B1L A;  3WTP C;  3AYW D;  1TZY B;  2ARO C;  5BS7 A;  1P3K B;  2F8N H;  3REH B;  3MVD B;  3V9R B;  3X1U C;  1AOI D;  3B6G C;  4R8P B;  1EQZ B;  3B0C W;  5B24 C;  4J8V D;  5AV6 D;  5AV8 C;  1S32 C;  3AZM D;  2BYM A;  1HTA A; 
#chains in the Genus database with same CATH topology
 3W97 B;  1P3F B;  2IO5 C;  1JFI A;  1ULY A;  5B33 D;  3UTB C;  4YS3 D;  1P3G B;  1AOI C;  2PYO A;  1F1E A;  3LZ1 B;  4G92 C;  1P3K D;  5AV6 C;  3W96 A;  3AZM C;  3REH D;  4R8P D;  5CPJ B;  1EQZ D;  1TAF B;  1KX4 B;  3B6F B;  4ZUX A;  4ZBJ B;  5B33 C;  2VQR A;  4YS3 C;  3W99 B;  2ZY5 A;  2NQB B;  3WAA A;  1P3F D;  4CSR A;  5BS7 C;  3REH C;  1ZLA D;  1P3G D;  2CWE A;  1N1J A;  5DNN A;  4R8P C;  4WU9 A;  3LZ1 D;  4H9N B;  4CAY A;  5AVB B;  2FJ7 A;  2UWX A;  3KUY B;  5FUG B;  2YFV A;  4NFT A;  3NQJ A;  5CPJ D;  1KX4 D;  1P3F C;  3F6T A;  3B6F D;  1ZLA C;  4M6B A;  3W99 D;  2W8S A;  2NQB D;  1KX5 A;  2PYO C;  3C1B B;  3W96 C;  3X1T B;  1M18 B;  5CPJ C;  3A6N B;  3B6F C;  5AVB D;  4J8X A;  4ZBJ C;  3MNN A;  5B1M A;  4KGC A;  3AZL D;  2NQB C;  3H0R C;  3MGS B;  4J8U D;  2NZD A;  5BT1 D;  5B40 A;  3H0L C;  3A1I A;  5G49 A;  5E5A A;  3AZL C;  1U35 B;  4NE5 A;  1M18 D;  4Z5T A;  3A6N D;  2L5A A;  4J8U C;  5BT1 C;  3MGQ A;  3W98 A;  4J8X D;  3WA9 B;  3O62 B;  3EG5 B;  1P3A B;  3AZH B;  3LEL B;  5BNV A;  3AZI A;  3AV1 A;  5CPK B;  1M18 C;  3REL B;  5GSU B;  3A6N C;  3KWQ A;  5B40 D;  3NQU B;  4G91 C;  5GT0 A;  4J8X C;  3EPL A;  2HUE B;  3AV2 B;  5B31 B;  4Z2M G;  1WWI A;  5B31 G;  3REI A;  3UT9 A;  2NZD C;  3MGR A;  3AZG B;  3O62 D;  4QLC B;  5B40 C;  5BO0 B;  4WZS B;  1P3A D;  3WTP B;  1B67 A;  2ARO B;  2JSS A;  3LEL D;  1P3P A;  5AY8 A;  1W2E A;  5CPK D;  1ID3 A;  5F99 A;  3AZE B;  3EPJ A;  3AV1 D;  3X1U B;  3B6G B;  5AVC A;  3AZJ A;  3AV2 D;  1S32 B;  2XD1 A;  5AV8 B;  5GT0 D;  3O62 C;  3W98 C;  4H9R A;  2Y2J A;  2JE5 A;  4XUJ A;  5B32 A;  3X1S A;  3AFA A;  2IO5 B;  4QLC D;  3UTB B;  3AZI C;  3AV1 C;  3X1V A;  3MGR D;  1PZR A;  1Q9C A;  2YFW B;  3VH6 W;  4H9Q A;  1A7W A;  5GT3 B;  3VH5 T;  3WTP D;  4JJN A;  4G92 B;  2FFF B;  5GT0 C;  5AV6 B;  4UUZ B;  3AZM B;  5GXQ B;  3AZE D;  4Z66 A;  1P3B B;  1P3I A;  5CPI A;  3MGP A;  5AV8 D;  5B33 B;  4QLC C;  3AZJ D;  3MGR C;  2J8P A;  1Z2C B;  1P34 B;  4J8W A;  5B2J B;  2RIQ A;  5B1L B;  1P3O A;  3R45 A;  5B32 D;  3UTB D;  3AZE C;  3X1S D;  3AFA D;  3REJ A;  1M1A A;  1ID3 C;  5F99 C;  5DNM A;  5GT3 D;  3X1V D;  2BYK B;  5AVC C;  3AZJ C;  1P3M A;  5GXQ D;  3REK A;  4H9P A;  2BYM B;  1P3B D;  4XUJ C;  3LZ0 A;  4WNN A;  2Y2P A;  5B32 C;  3KXB A;  4XZQ A;  1ZLA B;  3AFA C;  3X1S C;  1JFI B;  3MGP D;  3EPK A;  4KUD A;  5GT3 C;  1H3O A;  3X1V C;  1P34 D;  2PYO B;  5B2J D;  5B1L D;  4JJN C;  4LD9 A;  5GXQ C;  3W96 B;  3MVD A;  3V9R A;  1P3B C;  4YM6 A;  3REJ D;  1T3U A;  2ZY3 A;  2ZY4 A;  3LJA A;  4X23 A;  3MGP C;  5KDM A;  4ZUX B;  1P34 C;  5B2J C;  5B1L C;  3WAA B;  1P3O C;  4CSR B;  1R4V A;  4E45 A;  4WJ3 C;  3REJ C;  1N1J B;  5DNN B;  2PYO D;  2Y2K A;  4WU9 B;  2Y2N A;  4CAY B;  3AZL B;  2FJ7 B;  3W96 D;  3VH5 A;  4LD9 D;  2YFV B;  3REK C;  3WTP E;  1HQ3 A;  4NE3 A;  3NQJ B;  4J8U B;  2F2A C;  3TU4 A;  4ZUX D;  3KSY A;  2F8N K;  3AZK A;  1KX5 B;  3WAA D;  3KFU G;  3UTA A;  1KX3 A;  4LD9 C;  5DNN D;  4WU9 D;  4G91 B;  3LJA C;  4ZUX C;  4J8X B;  2FJ7 D;  2CV5 A;  3WAA C;  4H9S A;  2NZD B;  3TU4 D;  5DNN C;  4E44 A;  5B40 B;  4WU9 C;  1KX5 D;  3AZN A;  2FJ7 C;  5G49 B;  5E5A B;  2Y2G A;  1F66 A;  2Y2O A;  3B0C T;  4Z5T B;  5BNX A;  5JRG A;  3MNN D;  3AL0 C;  5B1M D;  3MGQ B;  5B2I A;  4UPK A;  3AN2 A;  3TU4 C;  3W98 B;  4KGC D;  1KX5 C;  5AV9 A;  2ZY2 A;  3C1C A;  3UTA C;  2NZD D;  1BH9 A;  5BNV B;  3AZI B;  3AV1 B;  5E5A D;  3MNN C;  5B1M C;  1P3L A;  1U35 A;  4KGC C;  5GT0 B;  1M19 A;  4Z5T D;  2CV5 C;  4H9S C;  4WU8 A;  3MGQ D;  3REI B;  3W98 D;  3UT9 B;  3WA9 A;  3AN2 D;  5B2I D;  3MGR B;  5E5A C;  3AZF A;  3WKJ A;  4H9O A;  1P3P B;  1ID3 B;  5GSU A;  5AY8 B;  4Z5T C;  3AZI D;  1F66 C;  5B0Y A;  5F99 B;  3NQU A;  3KWQ D;  2Y2L A;  3MGQ C;  5AVC B;  3AZJ B;  2RVQ D;  5B31 A;  5B2I C;  3AN2 C;  1M19 D;  4H9R B;  5CP6 A;  2HIO A;  4DQY B;  1BH8 A;  3B0D B;  4XUJ B;  5B32 B;  3REI D;  3AZG A;  3X1S B;  3AFA B;  3UT9 D;  4WU8 D;  1KU5 A;  5AV5 A;  3KWQ C;  5B32 G;  3X1V B;  2ARO A;  4JJN B;  2RVQ C;  1P3P D;  1ID3 D;  5AY8 D;  1M19 C;  3WKJ D;  2XD5 A;  5F99 D;  4KHA B;  3B6G A;  5B0Y D;  5B24 A;  5JA4 A;  4Z66 B;  5AVC D;  3REI C;  4WU8 C;  3UT9 C;  5CPI B;  1S32 A;  3MGP B;  3AYW A;  4XUJ D;  3FDD A;  4J8W B;  2G5H C;  2ZM5 A;  1P3P C;  1P3O B;  5AY8 C;  3R45 B;  3WKJ C;  4DRA A;  1AOI A;  3REJ B;  5B0Z A;  5B0Y C;  2F8N A;  5DNM B;  2Y2Q A;  4HGA C;  4WV4 B;  4J8V A;  4JJN D;  4UUZ A;  1P3M B;  2Y2I A;  2G5I C;  3REK B;  3B0D C;  2HIO C;  4H9P B;  3IP4 C;  4Z66 D;  1P3I D;  5CPI D;  4YS3 A;  4WNN B;  3KXB B;  1WWS A;  4XZQ B;  1TZY A;  1P3K A;  4KUD B;  1H3O B;  4J8W D;  1P3O D;  3REH A;  4LD9 B;  4R8P A;  1M1A D;  1EQZ A;  4Z66 C;  5DNM D;  2BYK A;  5CPI C;  4YM6 B;  3LJA B;  1P3I C;  5B0Z D;  2F8N D;  4X23 B;  4AWL B;  1P3M D;  3W97 A;  5KDM B;  3REK D;  2Y2H A;  4J8W C;  3AYW C;  1P3F A;  1ZLA A;  3LZ0 D;  3KXB D;  1P3G A;  4XZQ D;  1M1A C;  3LZ1 A;  5DNM C;  4KUD D;  1TZY D;  5B0Z C;  4J8V C;  1P3M C;  5CHL B;  5CPJ A;  3MVD D;  1TAF A;  1KX4 A;  4YM6 D;  1HQ3 B;  3B6F A;  3LJA D;  3LZ0 C;  4X23 D;  3KXB C;  4XZQ C;  3W99 A;  3TU4 B;  2NQB A;  4KUD C;  3W97 D;  1TZY C;  3AZK B;  1P3K C;  3P5J B;  3UTA B;  1KX3 B;  3MVD C;  3VH6 T;  4H9N A;  4YM6 C;  5AVB A;  1EQZ C;  2DF4 C;  3KUY A;  4X23 C;  3MNN B;  5FUG A;  5B1M B;  4AWL C;  3AZL A;  4KGC B;  3W97 C;  1HQ3 D;  4J8U A;  2CV5 B;  4NE6 A;  1P3G C;  3LZ1 C;  3C1B A;  3AZK D;  3AZN B;  3VH5 W;  3UTA D;  3X1T A;  4DRB A;  1M18 A;  1KX3 D;  3A6N A;  1F66 B;  1HQ3 C;  1KX4 C;  5BNX B;  5JRG B;  3KUY D;  3W99 C;  3AN2 B;  5B2I B;  3MGS A;  1B6W A;  3AZK C;  2CV5 D;  5AV9 B;  1KX3 C;  3C1C B;  5C3I B;  1BH9 B;  3KWQ B;  3AZN D;  5AVB C;  3C1B D;  3KUY C;  1P3L B;  2BG1 A;  1F66 D;  3X1T D;  1M19 B;  5JRG D;  1BFM A;  4WU8 B;  3O62 A;  1P3A A;  3AZH A;  5AV9 D;  3AZN C;  3MGS D;  3C1B C;  3LEL A;  3AZF B;  5CPK A;  3C1C D;  3REL A;  3X1T C;  3WKJ B;  4H9O B;  5JRG C;  5B0Y B;  4HGA B;  3VH6 A;  3AV2 A;  1P3L D;  1U35 D;  5AV9 C;  2LY8 A;  3MGS C;  5CP6 B;  2HIO B;  1BH8 B;  3C1C C;  4QLC A;  5C3I C;  4EO5 B;  5BO0 A;  3WA9 D;  3WTP A;  3EPH A;  5AV5 B;  4H9Q B;  3AZH D;  3AZF D;  1P3L C;  1U35 C;  4Z2M H;  3AZE A;  3X1U A;  3REL D;  5GSU D;  1P3I B;  5AV8 A;  2DQN C;  2JCH A;  5B24 B;  5JA4 B;  3WA9 C;  5B31 D;  3A1K A;  1P3A C;  5CP6 D;  2HIO D;  3AZH C;  3AYW B;  3AZF C;  3LEL C;  3UTB A;  5CPK C;  3REL C;  5GSU C;  3AZG D;  2YFW A;  1M1A B;  5AV5 D;  5GT3 A;  1AOI B;  2Y2M A;  5AV6 A;  5B0Z B;  2F8N B;  2ARO D;  3AZM A;  2HUE C;  4J8V B;  5GXQ A;  3AV2 C;  5B31 C;  4KHA A;  2F8N G;  5CP6 C;  1P3B A;  3X1U D;  3B6G D;  5B33 A;  3LZ0 B;  5B24 D;  4EO5 C;  3AZG C;  1S32 D;  3H0M C;  4YS3 B;  5AV5 C;  3B0B A;  1P34 A;  5B2J A;  5B1L A;  3WTP C;  3AYW D;  1TZY B;  2ARO C;  5BS7 A;  1P3K B;  2F8N H;  3REH B;  3MVD B;  3V9R B;  3X1U C;  1AOI D;  3B6G C;  4R8P B;  1EQZ B;  3B0C W;  5B24 C;  4J8V D;  5AV6 D;  5AV8 C;  1S32 C;  3AZM D;  2BYM A;  1HTA A; 
#chains in the Genus database with same CATH homology
 3W97 B;  1P3F B;  2IO5 C;  1JFI A;  1ULY A;  5B33 D;  3UTB C;  4YS3 D;  1P3G B;  1AOI C;  2PYO A;  1F1E A;  3LZ1 B;  4G92 C;  1P3K D;  5AV6 C;  3W96 A;  3AZM C;  3REH D;  4R8P D;  5CPJ B;  1EQZ D;  1TAF B;  1KX4 B;  3B6F B;  4ZUX A;  4ZBJ B;  5B33 C;  2VQR A;  4YS3 C;  3W99 B;  2ZY5 A;  2NQB B;  3WAA A;  1P3F D;  4CSR A;  5BS7 C;  3REH C;  1ZLA D;  1P3G D;  2CWE A;  1N1J A;  5DNN A;  4R8P C;  4WU9 A;  3LZ1 D;  4H9N B;  4CAY A;  5AVB B;  2FJ7 A;  2UWX A;  3KUY B;  5FUG B;  2YFV A;  4NFT A;  3NQJ A;  5CPJ D;  1KX4 D;  1P3F C;  3F6T A;  3B6F D;  1ZLA C;  4M6B A;  3W99 D;  2W8S A;  2NQB D;  1KX5 A;  2PYO C;  3C1B B;  3W96 C;  3X1T B;  1M18 B;  5CPJ C;  3A6N B;  3B6F C;  5AVB D;  4J8X A;  4ZBJ C;  3MNN A;  5B1M A;  4KGC A;  3AZL D;  2NQB C;  3H0R C;  3MGS B;  4J8U D;  2NZD A;  5BT1 D;  5B40 A;  3H0L C;  3A1I A;  5G49 A;  5E5A A;  3AZL C;  1U35 B;  4NE5 A;  1M18 D;  4Z5T A;  3A6N D;  2L5A A;  4J8U C;  5BT1 C;  3MGQ A;  3W98 A;  4J8X D;  3WA9 B;  3O62 B;  3EG5 B;  1P3A B;  3AZH B;  3LEL B;  5BNV A;  3AZI A;  3AV1 A;  5CPK B;  1M18 C;  3REL B;  5GSU B;  3A6N C;  3KWQ A;  5B40 D;  3NQU B;  4G91 C;  5GT0 A;  4J8X C;  3EPL A;  2HUE B;  3AV2 B;  5B31 B;  4Z2M G;  1WWI A;  5B31 G;  3REI A;  3UT9 A;  2NZD C;  3MGR A;  3AZG B;  3O62 D;  4QLC B;  5B40 C;  5BO0 B;  4WZS B;  1P3A D;  3WTP B;  1B67 A;  2ARO B;  2JSS A;  3LEL D;  1P3P A;  5AY8 A;  1W2E A;  5CPK D;  1ID3 A;  5F99 A;  3AZE B;  3EPJ A;  3AV1 D;  3X1U B;  3B6G B;  5AVC A;  3AZJ A;  3AV2 D;  1S32 B;  2XD1 A;  5AV8 B;  5GT0 D;  3O62 C;  3W98 C;  4H9R A;  2Y2J A;  2JE5 A;  4XUJ A;  5B32 A;  3X1S A;  3AFA A;  2IO5 B;  4QLC D;  3UTB B;  3AZI C;  3AV1 C;  3X1V A;  3MGR D;  1PZR A;  1Q9C A;  2YFW B;  3VH6 W;  4H9Q A;  1A7W A;  5GT3 B;  3VH5 T;  3WTP D;  4JJN A;  4G92 B;  2FFF B;  5GT0 C;  5AV6 B;  4UUZ B;  3AZM B;  5GXQ B;  3AZE D;  4Z66 A;  1P3B B;  1P3I A;  5CPI A;  3MGP A;  5AV8 D;  5B33 B;  4QLC C;  3AZJ D;  3MGR C;  2J8P A;  1Z2C B;  1P34 B;  4J8W A;  5B2J B;  2RIQ A;  5B1L B;  1P3O A;  3R45 A;  5B32 D;  3UTB D;  3AZE C;  3X1S D;  3AFA D;  3REJ A;  1M1A A;  1ID3 C;  5F99 C;  5DNM A;  5GT3 D;  3X1V D;  2BYK B;  5AVC C;  3AZJ C;  1P3M A;  5GXQ D;  3REK A;  4H9P A;  2BYM B;  1P3B D;  4XUJ C;  3LZ0 A;  4WNN A;  2Y2P A;  5B32 C;  3KXB A;  4XZQ A;  1ZLA B;  3AFA C;  3X1S C;  1JFI B;  3MGP D;  3EPK A;  4KUD A;  5GT3 C;  1H3O A;  3X1V C;  1P34 D;  2PYO B;  5B2J D;  5B1L D;  4JJN C;  4LD9 A;  5GXQ C;  3W96 B;  3MVD A;  3V9R A;  1P3B C;  4YM6 A;  3REJ D;  1T3U A;  2ZY3 A;  2ZY4 A;  3LJA A;  4X23 A;  3MGP C;  5KDM A;  4ZUX B;  1P34 C;  5B2J C;  5B1L C;  3WAA B;  1P3O C;  4CSR B;  1R4V A;  4E45 A;  4WJ3 C;  3REJ C;  1N1J B;  5DNN B;  2PYO D;  2Y2K A;  4WU9 B;  2Y2N A;  4CAY B;  3AZL B;  2FJ7 B;  3W96 D;  3VH5 A;  4LD9 D;  2YFV B;  3REK C;  3WTP E;  1HQ3 A;  4NE3 A;  3NQJ B;  4J8U B;  2F2A C;  3TU4 A;  4ZUX D;  3KSY A;  2F8N K;  3AZK A;  1KX5 B;  3WAA D;  3KFU G;  3UTA A;  1KX3 A;  4LD9 C;  5DNN D;  4WU9 D;  4G91 B;  3LJA C;  4ZUX C;  4J8X B;  2FJ7 D;  2CV5 A;  3WAA C;  4H9S A;  2NZD B;  3TU4 D;  5DNN C;  4E44 A;  5B40 B;  4WU9 C;  1KX5 D;  3AZN A;  2FJ7 C;  5G49 B;  5E5A B;  2Y2G A;  1F66 A;  2Y2O A;  3B0C T;  4Z5T B;  5BNX A;  5JRG A;  3MNN D;  3AL0 C;  5B1M D;  3MGQ B;  5B2I A;  4UPK A;  3AN2 A;  3TU4 C;  3W98 B;  4KGC D;  1KX5 C;  5AV9 A;  2ZY2 A;  3C1C A;  3UTA C;  2NZD D;  1BH9 A;  5BNV B;  3AZI B;  3AV1 B;  5E5A D;  3MNN C;  5B1M C;  1P3L A;  1U35 A;  4KGC C;  5GT0 B;  1M19 A;  4Z5T D;  2CV5 C;  4H9S C;  4WU8 A;  3MGQ D;  3REI B;  3W98 D;  3UT9 B;  3WA9 A;  3AN2 D;  5B2I D;  3MGR B;  5E5A C;  3AZF A;  3WKJ A;  4H9O A;  1P3P B;  1ID3 B;  5GSU A;  5AY8 B;  4Z5T C;  3AZI D;  1F66 C;  5B0Y A;  5F99 B;  3NQU A;  3KWQ D;  2Y2L A;  3MGQ C;  5AVC B;  3AZJ B;  2RVQ D;  5B31 A;  5B2I C;  3AN2 C;  1M19 D;  4H9R B;  5CP6 A;  2HIO A;  4DQY B;  1BH8 A;  3B0D B;  4XUJ B;  5B32 B;  3REI D;  3AZG A;  3X1S B;  3AFA B;  3UT9 D;  4WU8 D;  1KU5 A;  5AV5 A;  3KWQ C;  5B32 G;  3X1V B;  2ARO A;  4JJN B;  2RVQ C;  1P3P D;  1ID3 D;  5AY8 D;  1M19 C;  3WKJ D;  2XD5 A;  5F99 D;  4KHA B;  3B6G A;  5B0Y D;  5B24 A;  5JA4 A;  4Z66 B;  5AVC D;  3REI C;  4WU8 C;  3UT9 C;  5CPI B;  1S32 A;  3MGP B;  3AYW A;  4XUJ D;  3FDD A;  4J8W B;  2G5H C;  2ZM5 A;  1P3P C;  1P3O B;  5AY8 C;  3R45 B;  3WKJ C;  4DRA A;  1AOI A;  3REJ B;  5B0Z A;  5B0Y C;  2F8N A;  5DNM B;  2Y2Q A;  4HGA C;  4WV4 B;  4J8V A;  4JJN D;  4UUZ A;  1P3M B;  2Y2I A;  2G5I C;  3REK B;  3B0D C;  2HIO C;  4H9P B;  3IP4 C;  4Z66 D;  1P3I D;  5CPI D;  4YS3 A;  4WNN B;  3KXB B;  1WWS A;  4XZQ B;  1TZY A;  1P3K A;  4KUD B;  1H3O B;  4J8W D;  1P3O D;  3REH A;  4LD9 B;  4R8P A;  1M1A D;  1EQZ A;  4Z66 C;  5DNM D;  2BYK A;  5CPI C;  4YM6 B;  3LJA B;  1P3I C;  5B0Z D;  2F8N D;  4X23 B;  4AWL B;  1P3M D;  3W97 A;  5KDM B;  3REK D;  2Y2H A;  4J8W C;  3AYW C;  1P3F A;  1ZLA A;  3LZ0 D;  3KXB D;  1P3G A;  4XZQ D;  1M1A C;  3LZ1 A;  5DNM C;  4KUD D;  1TZY D;  5B0Z C;  4J8V C;  1P3M C;  5CHL B;  5CPJ A;  3MVD D;  1TAF A;  1KX4 A;  4YM6 D;  1HQ3 B;  3B6F A;  3LJA D;  3LZ0 C;  4X23 D;  3KXB C;  4XZQ C;  3W99 A;  3TU4 B;  2NQB A;  4KUD C;  3W97 D;  1TZY C;  3AZK B;  1P3K C;  3P5J B;  3UTA B;  1KX3 B;  3MVD C;  3VH6 T;  4H9N A;  4YM6 C;  5AVB A;  1EQZ C;  2DF4 C;  3KUY A;  4X23 C;  3MNN B;  5FUG A;  5B1M B;  4AWL C;  3AZL A;  4KGC B;  3W97 C;  1HQ3 D;  4J8U A;  2CV5 B;  4NE6 A;  1P3G C;  3LZ1 C;  3C1B A;  3AZK D;  3AZN B;  3VH5 W;  3UTA D;  3X1T A;  4DRB A;  1M18 A;  1KX3 D;  3A6N A;  1F66 B;  1HQ3 C;  1KX4 C;  5BNX B;  5JRG B;  3KUY D;  3W99 C;  3AN2 B;  5B2I B;  3MGS A;  1B6W A;  3AZK C;  2CV5 D;  5AV9 B;  1KX3 C;  3C1C B;  5C3I B;  1BH9 B;  3KWQ B;  3AZN D;  5AVB C;  3C1B D;  3KUY C;  1P3L B;  2BG1 A;  1F66 D;  3X1T D;  1M19 B;  5JRG D;  1BFM A;  4WU8 B;  3O62 A;  1P3A A;  3AZH A;  5AV9 D;  3AZN C;  3MGS D;  3C1B C;  3LEL A;  3AZF B;  5CPK A;  3C1C D;  3REL A;  3X1T C;  3WKJ B;  4H9O B;  5JRG C;  5B0Y B;  4HGA B;  3VH6 A;  3AV2 A;  1P3L D;  1U35 D;  5AV9 C;  2LY8 A;  3MGS C;  5CP6 B;  2HIO B;  1BH8 B;  3C1C C;  4QLC A;  5C3I C;  4EO5 B;  5BO0 A;  3WA9 D;  3WTP A;  3EPH A;  5AV5 B;  4H9Q B;  3AZH D;  3AZF D;  1P3L C;  1U35 C;  4Z2M H;  3AZE A;  3X1U A;  3REL D;  5GSU D;  1P3I B;  5AV8 A;  2DQN C;  2JCH A;  5B24 B;  5JA4 B;  3WA9 C;  5B31 D;  3A1K A;  1P3A C;  5CP6 D;  2HIO D;  3AZH C;  3AYW B;  3AZF C;  3LEL C;  3UTB A;  5CPK C;  3REL C;  5GSU C;  3AZG D;  2YFW A;  1M1A B;  5AV5 D;  5GT3 A;  1AOI B;  2Y2M A;  5AV6 A;  5B0Z B;  2F8N B;  2ARO D;  3AZM A;  2HUE C;  4J8V B;  5GXQ A;  3AV2 C;  5B31 C;  4KHA A;  2F8N G;  5CP6 C;  1P3B A;  3X1U D;  3B6G D;  5B33 A;  3LZ0 B;  5B24 D;  4EO5 C;  3AZG C;  1S32 D;  3H0M C;  4YS3 B;  5AV5 C;  3B0B A;  1P34 A;  5B2J A;  5B1L A;  3WTP C;  3AYW D;  1TZY B;  2ARO C;  5BS7 A;  1P3K B;  2F8N H;  3REH B;  3MVD B;  3V9R B;  3X1U C;  1AOI D;  3B6G C;  4R8P B;  1EQZ B;  3B0C W;  5B24 C;  4J8V D;  5AV6 D;  5AV8 C;  1S32 C;  3AZM D;  2BYM A;  1HTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...