3REIB

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiB00
1M18C 2F8NH 3REHB 4YM6B 5E5AC 1P3AB 3AZLD 5GXQB 4KGCC 2BYMA 1M1AB 3A6NC 5B33C 2F8NG 3AZEB 2FJ7B 2IO5C 1P3OB 1ID3D 1KX5C 3AZID 5B2ID 2NZDC 4J8VC 4WU8A 3WTPB 3KXBD 4WU9A 4XZQC 5CPID 3AZHC 1U35C 1P3PC 1ZLAD 2AROA 3X1VA 3R45B 4H9SC 5AV5C 5JRGC 5AV6B 3AZJA 3AFAB 3VH6T 4X23D 4KUDC 4NFTA 1P3BC 3AYWA 1WWSA 5B40C 3LJAC 3AV2C 3MGRB 3TU4A 4ZBJB 4LD9A 5BNXB 3LELD 5BO0B 5B0YC 3X1SA 1TZYD 5B32B 3AZMB 3X1VD 5DNNC 1ID3C 1TAFB 1P3MC 4HGAB 5GT0D 3MNND 4G92B 3AZJD 3C1BC 1M18B 5E5AB 3AZLC 5CPKD 3C1CA 1P34A 3B6GA 3A6NB 5B33B 3X1UA 3TU4D 3UTBA 3RELD 1AOID 1KU5A 3LZ0A 2IO5B 5GXQD 4XUJD 5B2IC 5AVCC 1KX5B 2NZDB 3X1SD 4J8VB 4XZQB 3AZHB 1ZLAC 1U35B 1P3PB 1H3OB 1HQ3D 3WTPD 3AZNA 3B0CT 1N1JA 3UTAD 4H9NB 1P34D 5AV5B 5BT1C 5JRGB 4Z5TD 4UUZB 4J8UA 3AZFA 3LZ0D 4KUDB 5B40B 4CSRA 3MGSA 3AV2B 4WU8C 1P3IA 4WU9C 5B24A 4J8WA 3W99A 5B0YB 2AROC 3X1VC 5B31A 4AWLC 5DNNB 5GSUB 1ID3B 5GT0C 4H9QB 3MNNC 1KX3A 3AZJC 3W96A 3AZLB 5CPKC 2JSSA 2YFVA 3LZ1A 3AYWC 3TU4C 5B1LD 1AOIC 5E5AD 3RELC 2PYOA 4Z66A 2YFWA 4LD9C 4XUJC 2NQBD 4KGCD 5AVCB 5B2IB 3X1SC 3W99D 5B33D 3KSYA 3KXBB 1S32A 1KX5D 1ZLAB 2CV5A 5DNMA 1HQ3C 3C1CC 1P34C 5AVBD 5B31G 3LZ1D 2BYMB 5G49B 4R8PA 3AZHD 3X1UC 1U35D 3KWQA 3REKA 4X23B 1F66D 1BFMA 3LZ0C 5B2JA 2F8NA 4CAYA 1Q9CA 4WU9B 1EQZA 3WA9A 3B6FD 4KUDD 3LELB 3VH5A 1P3BD 1JFIA 3LJAD 1TZYB 3VH5W 4AWLB 3AZNC 3X1VB 5AY8A 5CP6A 3AZKA 1P3KA 5GT0B 3MNNB 3AZJB 5BS7A 3AZFC 4J8UC 3AZGD 4Z2MG 3KWQD 3REKD 5CPKB 3W97A 5DNND 2F8ND 1P3MD 4H9PA 3MGSC 5B1LC 3C1BD 3TU4B 5JA4A 1AOIB 5B24C 3RELB 4LD9B 2NQBC 4XUJB 4J8WC 3W99C 3X1SB 5B31C 3REJA 1P3KD 5FUGA 1KX3C 3W96C 5AVCD 1HQ3B 3NQJA 3C1CB 3UTAB 5AVBC 3LZ1C 1P34B 4Z5TB 1F66C 3X1UB 4J8XA 2PYOC 3LZ0B 1R4VA 2F8NK 3W98A 5BT1D 1S32C 3B6FC 2HIOA 3MGPA 4WU8D 4WU9D 5GT3A 1N1JB 4R8PC 4NE5A 3AZGC 3KWQC 1BH9A 4J8UB 2AROD 3REKC 4YS3A 5B2JC 3O62A 5AV8A 4CSRB 5B1LB 1EQZC 5B24B 3WA9C 2NQBB 3AN2A 4KGCB 4J8WB 3AYWD 4JJNA 3W99B 3NQUA 5AY8C 5CP6C 3AZKC 5GT3D 1P3KC 4LD9D 3V9RB 4YM6A 1KX3B 3W96B 5BS7C 4KHAA 4H9RA 3W97C 2CWEA 5AVBB 2YFVB 3LZ1B 3AZEA 5AV9A 1P3LA 2FJ7A 1F66B 2PYOB 2YFWB 3C1CD 3AN2D 3VH5T 3B6GD 3X1UD 3UTBD 1S32B 3B6FB 1KX4A 1P3BB 4NE6A 3X1TA 3LJAB 3AV1A 4E44A 3AZGB 5AV9D 4J8XC 1P3LD 5F99A 3KWQB 3REKB 5B2JB 3AZND 3W98C 2F8NB 1P3MB 4CAYB 3C1BB 3AZFD 4J8UD 1EQZB 5BO0A 1KX4D 3MGQA 5B1MA 5B32A 2HIOC 3X1TD 3MGSD 3MGPC 3AV1D 1F1EA 5KDMA 1P3ID 5AY8B 5GT3C 5CP6B 5B24D 3AZKB 5BNVB 1P3KB 4J8WD 1ULYA 5B31D 3W97B 3O62C 5AV8C 1M19A 3VH6A 1KX3D 3W96D 2RVQD 5JA4B 3WAAA 3AN2C 4M6BA 4WNNA 4JJNC 3B6GC 3UTBC 3UT9A 3B0DC 2PYOD 4Z66D 3MVDA 2HUEC 1P3PA 5FUGB 2BYKA 4H9SA 5B32G 4WU8B 3NQJB 4ZUXA 5AV5A 5B0ZA 1S32D 1M19D 1A7WA 4UUZA 5AV9C 1P3LC 2CV5D 5DNMD 2AROB 3W98B 5B40A 4R8PD 3UT9D 3REIA 1KX4C 5B2JD 3MVDD 3AYWB 3X1TC 2HIOB 3AV1C 1P3IC 5GSUA 3MGPB 4H9QA 4ZUXD 1EQZD 5GT3B 3WA9D 1P3FA 3AZLA 5F99C 1BH9B 5CPJA 3B0CW 5AY8D 5CP6D 3O62B 3AZKD 5AV8B 4QLCA 2RVQC 4WZSB 3AZIA 3W97D 3MGQC 5B1MC 3AN2B 5B32C 3KXBA 3B6GB 5CPIA 3NQUB 3KUYA 4G92C 4Z66C 3UTBB 3B0DB 1ZLAA 2HUEB 1P3FD 5C3IC 4KHAB 4H9RB 5CPJD 5G49A 1M19C 3REJD 4WV4B 4X23A 4QLCD 2CV5C 5DNMC 5AV9B 1P3LB 3WAAC 3AZNB 1P3GA 3AZFB 4J8XD 3UT9C 1BH8A 3LELA 3KUYD 3MVDC 1KX4B 3W98D 4H9OA 1TZYA 4EO5C 3X1TB 3MGSB 3AV1B 4ZUXC 1P3IB 5GT0A 5B0ZC 3MNNA 3WKJA 5CPKA 2HIOD 5F99B 5B31B 3MGPD 1P3OA 3REHA 1B67A 1P3GD 1P3AA 1AOIA 3RELA 4YS3D 5GXQA 4XUJA 3REIC 1M1AA 3O62D 3MGQB 5B1MB 5AV8D 4DRBA 5GSUC 5KDMB 4Z66B 1P3FC 5C3IB 1HQ3A 3WTPA 4JJND 3WKJD 3UTAA 5CPJC 1P3OD 3REJC 4Z5TA 1M19B 3REHD 4YM6D 4QLCC 1P3AD 3R45A 2CV5B 5DNMB 1WWIA 3AZIC 3WAAB 4DRAA 5AV6A 1M1AD 3AFAA 3WTPE 4WNNB 3KXBC 4R8PB 3AZED 5CPIC 2FJ7D 3KUYC 3UT9B 3MVDB 3MGRA 2BYKB 4EO5B 5CHLB 5BNXA 4ZUXB 5B0ZB 3WA9B 4X23C 1JFIB 3AZMA 4E45A 1TAFA 4G91C 5AV6D 1P3GC 1M18A 5B1LA 3AFAD 5E5AA 4YS3C 5F99D 3LELC 2NQBA 4KGCA 3REIB 1TZYC 5B33A 3A6NA 3MGRD 4H9PB 3VH6W 2LY8A 3V9RA 1KX5A 1P3FB 3MGQD 2NZDA 5B1MD 4J8VA 5B32D 3WKJC 3AZMD 4XZQA 5AVBA 5CPJB 1P3OC 3AZHA 3REHC 4YM6C 3REJB 1U35A 1P3AC 1M18D 1F66A 4QLCB 1H3OA 5GXQC 4H9NA 1M1AC 3AZIB 5JRGA 3A6ND 1HTAA 3AZEC 2FJ7C 3B6FA 5CPIB 4J8XB 4KUDA 3KUYB 1B6WA 1P3BA 3WAAD 3LJAA 2NZDD 3AV2A 3WTPC 4J8VD 4NE3A 3UTAC 4XZQD 4Z5TC 3AZGA 5B0YA 1P3PD 5DNNA 1ID3A 1P3MA 5AV5D 5AV6C 5B0ZD 3AFAC 4G91B 5JRGD 1P3GB 3C1BA 4YS3B 1BH8B 4H9OB 5B40D 3MGRC 4ZBJC 4Z2MH 3AV2D 3B0BA 5BNVA 5AVCA 5B2IA 3REID 2L5AA 5B0YD 3AZMC 4JJNB 3WKJB 5GSUD 4HGAC
chains in the Genus database with same CATH superfamily
1M18C 2F8NH 3REHB 4YM6B 5E5AC 1P3AB 3AZLD 5GXQB 4KGCC 2BYMA 1M1AB 3A6NC 5B33C 2F8NG 3AZEB 2FJ7B 2IO5C 1P3OB 1ID3D 3P5JB 2Y2LA 1KX5C 3AZID 5B2ID 2NZDC 4J8VC 4WU8A 3WTPB 3KXBD 4WU9A 4XZQC 5CPID 3AZHC 2UWXA 1U35C 1P3PC 1ZLAD 2AROA 3X1VA 3R45B 4H9SC 5AV5C 5JRGC 5AV6B 4UPKA 3AZJA 3AFAB 3VH6T 4X23D 4KUDC 4NFTA 1P3BC 3AYWA 1WWSA 3F6TA 5B40C 3LJAC 3AV2C 3MGRB 3TU4A 4ZBJB 4LD9A 5BNXB 3LELD 5BO0B 5B0YC 3X1SA 1TZYD 5B32B 3AZMB 3X1VD 5DNNC 1ID3C 1TAFB 1P3MC 4HGAB 5GT0D 3MNND 4G92B 3AZJD 3C1BC 1M18B 5E5AB 3AZLC 5CPKD 3C1CA 1P34A 1PZRA 3B6GA 3A6NB 5B33B 3X1UA 3TU4D 3UTBA 3RELD 1AOID 1KU5A 3LZ0A 2IO5B 5GXQD 4XUJD 5B2IC 5AVCC 1KX5B 3EPKA 2NZDB 2Y2PA 3X1SD 4J8VB 4XZQB 3AZHB 1ZLAC 1U35B 1P3PB 1H3OB 1HQ3D 3WTPD 3AZNA 3B0CT 1N1JA 3UTAD 3FDDA 4H9NB 1P34D 5AV5B 5BT1C 5JRGB 4Z5TD 4UUZB 4J8UA 3AZFA 3LZ0D 4KUDB 3KFUG 5B40B 4CSRA 3MGSA 3AV2B 4WU8C 1P3IA 4WU9C 2RIQA 5B24A 2G5IC 4J8WA 3W99A 5B0YB 2AROC 3X1VC 5B31A 4AWLC 5DNNB 4DQYB 5GSUB 1ID3B 5GT0C 4H9QB 3MNNC 1KX3A 3AZJC 3W96A 3AZLB 5CPKC 2ZM5A 2JSSA 2YFVA 3LZ1A 3AYWC 2J8PA 3TU4C 5B1LD 1AOIC 5E5AD 3RELC 2PYOA 4Z66A 2Y2MA 2YFWA 4LD9C 4XUJC 2NQBD 4KGCD 5AVCB 5B2IB 3X1SC 3W99D 5B33D 3KSYA 3KXBB 1S32A 2XD5A 1KX5D 1ZLAB 2CV5A 5DNMA 1HQ3C 3C1CC 1P34C 5AVBD 5B31G 2DQNC 2BYMB 5G49B 4R8PA 3LZ1D 3AZHD 3X1UC 1U35D 3EPLA 3KWQA 3REKA 4X23B 1F66D 1BFMA 3LZ0C 5B2JA 2F8NA 4CAYA 1Q9CA 4WU9B 1EQZA 3WA9A 3B6FD 4KUDD 3LELB 3VH5A 1P3BD 3A1IA 1JFIA 3LJAD 1TZYB 3VH5W 4AWLB 3AZNC 3X1VB 5AY8A 5CP6A 3AZKA 1P3KA 5GT0B 3MNNB 3AZJB 5BS7A 3AZFC 4J8UC 3AZGD 4Z2MG 3KWQD 3REKD 5CPKB 3W97A 5DNND 2F8ND 1P3MD 4H9PA 3MGSC 5B1LC 3C1BD 3TU4B 5JA4A 1AOIB 5B24C 3RELB 4LD9B 2NQBC 4XUJB 4J8WC 3W99C 3X1SB 5B31C 2ZY4A 3REJA 1P3KD 5FUGA 1KX3C 3W96C 5AVCD 1HQ3B 3NQJA 3C1CB 3UTAB 5AVBC 3LZ1C 1P34B 4Z5TB 1F66C 3X1UB 4J8XA 2PYOC 2Y2GA 3LZ0B 1R4VA 2F8NK 3W98A 5BT1D 1S32C 3B6FC 2XD1A 2HIOA 3MGPA 4WU8D 4WU9D 2W8SA 5GT3A 2Y2HA 1N1JB 4R8PC 4NE5A 3AZGC 3KWQC 1BH9A 4J8UB 2AROD 3REKC 4YS3A 5B2JC 3O62A 5AV8A 1T3UA 2ZY5A 3EPJA 4CSRB 5B1LB 1EQZC 5B24B 3WA9C 2NQBB 3AN2A 4KGCB 4J8WB 3AYWD 4JJNA 3W99B 3NQUA 5AY8C 5CP6C 3AZKC 5GT3D 1P3KC 4LD9D 3V9RB 4YM6A 1KX3B 3W96B 5BS7C 4KHAA 4H9RA 3W97C 2CWEA 5AVBB 2YFVB 3LZ1B 3AZEA 5AV9A 1P3LA 2FJ7A 1F66B 2PYOB 2YFWB 3C1CD 3AN2D 3VH5T 3B6GD 3X1UD 3UTBD 1S32B 3B6FB 1KX4A 1P3BB 4NE6A 3X1TA 3LJAB 3AV1A 4E44A 1W2EA 3AZGB 5AV9D 4J8XC 1P3LD 5F99A 3KWQB 3REKB 5B2JB 3AZND 3W98C 2F8NB 1P3MB 4CAYB 3C1BB 3AZFD 4J8UD 1EQZB 5BO0A 1KX4D 3MGQA 5B1MA 5B32A 2HIOC 3X1TD 3MGSD 3MGPC 2JCHA 1F1EA 5KDMA 3AV1D 1P3ID 5AY8B 5GT3C 5CP6B 5B24D 3AZKB 5BNVB 1P3KB 4J8WD 3H0MC 1ULYA 5B31D 3W97B 3O62C 5AV8C 1M19A 3VH6A 1KX3D 3W96D 2RVQD 2Y2JA 5JA4B 3WAAA 3A1KA 3AN2C 4M6BA 4WNNA 4JJNC 3B6GC 3UTBC 3UT9A 3B0DC 2PYOD 4Z66D 3MVDA 2HUEC 1P3PA 5FUGB 2BYKA 4H9SA 5B32G 4WU8B 3NQJB 4ZUXA 5AV5A 5B0ZA 1S32D 1M19D 1A7WA 4UUZA 2Y2OA 5AV9C 1P3LC 2CV5D 5DNMD 2AROB 3W98B 2JE5A 5B40A 2FFFB 4R8PD 3UT9D 3REIA 1KX4C 5B2JD 3MVDD 3AYWB 3X1TC 2F2AC 2HIOB 3AV1C 1P3IC 5GSUA 3MGPB 4H9QA 4ZUXD 1EQZD 5GT3B 3WA9D 1P3FA 3AZLA 5F99C 1BH9B 5CPJA 3B0CW 5AY8D 5CP6D 3O62B 3AZKD 5AV8B 4QLCA 2RVQC 4WZSB 3AZIA 3W97D 3MGQC 5B1MC 3AN2B 5B32C 3KXBA 3B6GB 5CPIA 3NQUB 3KUYA 4G92C 4Z66C 3UTBB 3B0DB 1ZLAA 2HUEB 1P3FD 5C3IC 4KHAB 4H9RB 5CPJD 5G49A 1M19C 3REJD 4WV4B 4X23A 4QLCD 2CV5C 5DNMC 5AV9B 1P3LB 3WAAC 3AZNB 1P3GA 3AZFB 4J8XD 3UT9C 1BH8A 3LELA 3KUYD 3MVDC 1KX4B 3W98D 4H9OA 2Y2QA 1TZYA 4EO5C 3X1TB 3MGSB 3AV1B 4ZUXC 1P3IB 5GT0A 5B0ZC 3MNNA 3WKJA 5CPKA 2HIOD 5F99B 5B31B 3MGPD 1P3OA 3REHA 1B67A 1P3GD 1P3AA 1Z2CB 1AOIA 3RELA 4YS3D 5GXQA 4XUJA 3REIC 1M1AA 3O62D 3MGQB 5B1MB 5AV8D 4DRBA 5GSUC 3IP4C 5KDMB 3EPHA 4Z66B 1P3FC 5C3IB 1HQ3A 3WTPA 4JJND 3WKJD 3UTAA 5CPJC 1P3OD 2Y2NA 3REJC 4Z5TA 1M19B 3REHD 4YM6D 4QLCC 1P3AD 2ZY2A 3R45A 2CV5B 5DNMB 2Y2IA 1WWIA 3AZIC 3WAAB 4DRAA 5AV6A 1M1AD 3AFAA 3WTPE 4WNNB 3KXBC 4R8PB 3AZED 5CPIC 2ZY3A 2FJ7D 3KUYC 4WJ3C 3UT9B 3MVDB 3MGRA 2BYKB 4EO5B 5CHLB 5BNXA 4ZUXB 3AL0C 5B0ZB 3WA9B 4X23C 1JFIB 3AZMA 4E45A 1TAFA 2G5HC 4G91C 5AV6D 1P3GC 1M18A 5B1LA 3AFAD 5E5AA 2VQRA 4YS3C 5F99D 3LELC 2BG1A 2NQBA 3EG5B 4KGCA 3REIB 1TZYC 5B33A 3A6NA 3MGRD 4H9PB 3VH6W 2LY8A 3V9RA 3H0RC 1KX5A 1P3FB 3MGQD 2NZDA 5B1MD 4J8VA 5B32D 3WKJC 3AZMD 4XZQA 5AVBA 5CPJB 1P3OC 3AZHA 3REHC 4YM6C 3REJB 1U35A 1P3AC 1M18D 1F66A 4QLCB 1H3OA 5GXQC 4H9NA 1M1AC 3AZIB 5JRGA 3A6ND 1HTAA 3AZEC 2FJ7C 3B6FA 5CPIB 4J8XB 4KUDA 3KUYB 1B6WA 1P3BA 3WAAD 3LJAA 2NZDD 3AV2A 3WTPC 4J8VD 4NE3A 3UTAC 4XZQD 4Z5TC 3AZGA 5B0YA 1P3PD 2Y2KA 5DNNA 1ID3A 1P3MA 5AV5D 5AV6C 5B0ZD 3AFAC 4G91B 5JRGD 1P3GB 3C1BA 4YS3B 1BH8B 4H9OB 5B40D 3MGRC 3H0LC 4ZBJC 4Z2MH 3AV2D 3B0BA 5BNVA 5AVCA 5B2IA 3REID 2L5AA 5B0YD 2DF4C 4JJNB 3AZMC 3WKJB 5GSUD 4HGAC
chains in the Genus database with same CATH topology
1M18C 2F8NH 3REHB 4YM6B 5E5AC 1P3AB 3AZLD 5GXQB 4KGCC 2BYMA 1M1AB 3A6NC 5B33C 2F8NG 3AZEB 2FJ7B 2IO5C 1P3OB 1ID3D 3P5JB 2Y2LA 1KX5C 3AZID 5B2ID 2NZDC 4J8VC 4WU8A 3WTPB 3KXBD 4WU9A 4XZQC 5CPID 3AZHC 2UWXA 1U35C 1P3PC 1ZLAD 2AROA 3X1VA 3R45B 4H9SC 5AV5C 5JRGC 5AV6B 4UPKA 3AZJA 3AFAB 3VH6T 4X23D 4KUDC 4NFTA 1P3BC 3AYWA 1WWSA 3F6TA 5B40C 3LJAC 3AV2C 3MGRB 3TU4A 4ZBJB 4LD9A 5BNXB 3LELD 5BO0B 5B0YC 3X1SA 1TZYD 5B32B 3AZMB 3X1VD 5DNNC 1ID3C 1TAFB 1P3MC 4HGAB 5GT0D 3MNND 4G92B 3AZJD 3C1BC 1M18B 5E5AB 3AZLC 5CPKD 3C1CA 1P34A 1PZRA 3B6GA 3A6NB 5B33B 3X1UA 3TU4D 3UTBA 3RELD 1AOID 1KU5A 3LZ0A 2IO5B 5GXQD 4XUJD 5B2IC 5AVCC 1KX5B 3EPKA 2NZDB 2Y2PA 3X1SD 4J8VB 4XZQB 3AZHB 1ZLAC 1U35B 1P3PB 1H3OB 1HQ3D 3WTPD 3AZNA 3B0CT 1N1JA 3UTAD 3FDDA 4H9NB 1P34D 5AV5B 5BT1C 5JRGB 4Z5TD 4UUZB 4J8UA 3AZFA 3LZ0D 4KUDB 3KFUG 5B40B 4CSRA 3MGSA 3AV2B 4WU8C 1P3IA 4WU9C 2RIQA 5B24A 2G5IC 4J8WA 3W99A 5B0YB 2AROC 3X1VC 5B31A 4AWLC 5DNNB 4DQYB 5GSUB 1ID3B 5GT0C 4H9QB 3MNNC 1KX3A 3AZJC 3W96A 3AZLB 5CPKC 2ZM5A 2JSSA 2YFVA 3LZ1A 3AYWC 2J8PA 3TU4C 5B1LD 1AOIC 5E5AD 3RELC 2PYOA 4Z66A 2Y2MA 2YFWA 4LD9C 4XUJC 2NQBD 4KGCD 5AVCB 5B2IB 3X1SC 3W99D 5B33D 3KSYA 3KXBB 1S32A 2XD5A 1KX5D 1ZLAB 2CV5A 5DNMA 1HQ3C 3C1CC 1P34C 5AVBD 5B31G 2DQNC 2BYMB 5G49B 4R8PA 3LZ1D 3AZHD 3X1UC 1U35D 3EPLA 3KWQA 3REKA 4X23B 1F66D 1BFMA 3LZ0C 5B2JA 2F8NA 4CAYA 1Q9CA 4WU9B 1EQZA 3WA9A 3B6FD 4KUDD 3LELB 3VH5A 1P3BD 3A1IA 1JFIA 3LJAD 1TZYB 3VH5W 4AWLB 3AZNC 3X1VB 5AY8A 5CP6A 3AZKA 1P3KA 5GT0B 3MNNB 3AZJB 5BS7A 3AZFC 4J8UC 3AZGD 4Z2MG 3KWQD 3REKD 5CPKB 3W97A 5DNND 2F8ND 1P3MD 4H9PA 3MGSC 5B1LC 3C1BD 3TU4B 5JA4A 1AOIB 5B24C 3RELB 4LD9B 2NQBC 4XUJB 4J8WC 3W99C 3X1SB 5B31C 2ZY4A 3REJA 1P3KD 5FUGA 1KX3C 3W96C 5AVCD 1HQ3B 3NQJA 3C1CB 3UTAB 5AVBC 3LZ1C 1P34B 4Z5TB 1F66C 3X1UB 4J8XA 2PYOC 2Y2GA 3LZ0B 1R4VA 2F8NK 3W98A 5BT1D 1S32C 3B6FC 2XD1A 2HIOA 3MGPA 4WU8D 4WU9D 2W8SA 5GT3A 2Y2HA 1N1JB 4R8PC 4NE5A 3AZGC 3KWQC 1BH9A 4J8UB 2AROD 3REKC 4YS3A 5B2JC 3O62A 5AV8A 1T3UA 2ZY5A 3EPJA 4CSRB 5B1LB 1EQZC 5B24B 3WA9C 2NQBB 3AN2A 4KGCB 4J8WB 3AYWD 4JJNA 3W99B 3NQUA 5AY8C 5CP6C 3AZKC 5GT3D 1P3KC 4LD9D 3V9RB 4YM6A 1KX3B 3W96B 5BS7C 4KHAA 4H9RA 3W97C 2CWEA 5AVBB 2YFVB 3LZ1B 3AZEA 5AV9A 1P3LA 2FJ7A 1F66B 2PYOB 2YFWB 3C1CD 3AN2D 3VH5T 3B6GD 3X1UD 3UTBD 1S32B 3B6FB 1KX4A 1P3BB 4NE6A 3X1TA 3LJAB 3AV1A 4E44A 1W2EA 3AZGB 5AV9D 4J8XC 1P3LD 5F99A 3KWQB 3REKB 5B2JB 3AZND 3W98C 2F8NB 1P3MB 4CAYB 3C1BB 3AZFD 4J8UD 1EQZB 5BO0A 1KX4D 3MGQA 5B1MA 5B32A 2HIOC 3X1TD 3MGSD 3MGPC 2JCHA 1F1EA 5KDMA 3AV1D 1P3ID 5AY8B 5GT3C 5CP6B 5B24D 3AZKB 5BNVB 1P3KB 4J8WD 3H0MC 1ULYA 5B31D 3W97B 3O62C 5AV8C 1M19A 3VH6A 1KX3D 3W96D 2RVQD 2Y2JA 5JA4B 3WAAA 3A1KA 3AN2C 4M6BA 4WNNA 4JJNC 3B6GC 3UTBC 3UT9A 3B0DC 2PYOD 4Z66D 3MVDA 2HUEC 1P3PA 5FUGB 2BYKA 4H9SA 5B32G 4WU8B 3NQJB 4ZUXA 5AV5A 5B0ZA 1S32D 1M19D 1A7WA 4UUZA 2Y2OA 5AV9C 1P3LC 2CV5D 5DNMD 2AROB 3W98B 2JE5A 5B40A 2FFFB 4R8PD 3UT9D 3REIA 1KX4C 5B2JD 3MVDD 3AYWB 3X1TC 2F2AC 2HIOB 3AV1C 1P3IC 5GSUA 3MGPB 4H9QA 4ZUXD 1EQZD 5GT3B 3WA9D 1P3FA 3AZLA 5F99C 1BH9B 5CPJA 3B0CW 5AY8D 5CP6D 3O62B 3AZKD 5AV8B 4QLCA 2RVQC 4WZSB 3AZIA 3W97D 3MGQC 5B1MC 3AN2B 5B32C 3KXBA 3B6GB 5CPIA 3NQUB 3KUYA 4G92C 4Z66C 3UTBB 3B0DB 1ZLAA 2HUEB 1P3FD 5C3IC 4KHAB 4H9RB 5CPJD 5G49A 1M19C 3REJD 4WV4B 4X23A 4QLCD 2CV5C 5DNMC 5AV9B 1P3LB 3WAAC 3AZNB 1P3GA 3AZFB 4J8XD 3UT9C 1BH8A 3LELA 3KUYD 3MVDC 1KX4B 3W98D 4H9OA 2Y2QA 1TZYA 4EO5C 3X1TB 3MGSB 3AV1B 4ZUXC 1P3IB 5GT0A 5B0ZC 3MNNA 3WKJA 5CPKA 2HIOD 5F99B 5B31B 3MGPD 1P3OA 3REHA 1B67A 1P3GD 1P3AA 1Z2CB 1AOIA 3RELA 4YS3D 5GXQA 4XUJA 3REIC 1M1AA 3O62D 3MGQB 5B1MB 5AV8D 4DRBA 5GSUC 3IP4C 5KDMB 3EPHA 4Z66B 1P3FC 5C3IB 1HQ3A 3WTPA 4JJND 3WKJD 3UTAA 5CPJC 1P3OD 2Y2NA 3REJC 4Z5TA 1M19B 3REHD 4YM6D 4QLCC 1P3AD 2ZY2A 3R45A 2CV5B 5DNMB 2Y2IA 1WWIA 3AZIC 3WAAB 4DRAA 5AV6A 1M1AD 3AFAA 3WTPE 4WNNB 3KXBC 4R8PB 3AZED 5CPIC 2ZY3A 2FJ7D 3KUYC 4WJ3C 3UT9B 3MVDB 3MGRA 2BYKB 4EO5B 5CHLB 5BNXA 4ZUXB 3AL0C 5B0ZB 3WA9B 4X23C 1JFIB 3AZMA 4E45A 1TAFA 2G5HC 4G91C 5AV6D 1P3GC 1M18A 5B1LA 3AFAD 5E5AA 2VQRA 4YS3C 5F99D 3LELC 2BG1A 2NQBA 3EG5B 4KGCA 3REIB 1TZYC 5B33A 3A6NA 3MGRD 4H9PB 3VH6W 2LY8A 3V9RA 3H0RC 1KX5A 1P3FB 3MGQD 2NZDA 5B1MD 4J8VA 5B32D 3WKJC 3AZMD 4XZQA 5AVBA 5CPJB 1P3OC 3AZHA 3REHC 4YM6C 3REJB 1U35A 1P3AC 1M18D 1F66A 4QLCB 1H3OA 5GXQC 4H9NA 1M1AC 3AZIB 5JRGA 3A6ND 1HTAA 3AZEC 2FJ7C 3B6FA 5CPIB 4J8XB 4KUDA 3KUYB 1B6WA 1P3BA 3WAAD 3LJAA 2NZDD 3AV2A 3WTPC 4J8VD 4NE3A 3UTAC 4XZQD 4Z5TC 3AZGA 5B0YA 1P3PD 2Y2KA 5DNNA 1ID3A 1P3MA 5AV5D 5AV6C 5B0ZD 3AFAC 4G91B 5JRGD 1P3GB 3C1BA 4YS3B 1BH8B 4H9OB 5B40D 3MGRC 3H0LC 4ZBJC 4Z2MH 3AV2D 3B0BA 5BNVA 5AVCA 5B2IA 3REID 2L5AA 5B0YD 2DF4C 4JJNB 3AZMC 3WKJB 5GSUD 4HGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 C;  2F8N H;  3REH B;  4YM6 B;  5E5A C;  1P3A B;  3AZL D;  5GXQ B;  4KGC C;  2BYM A;  1M1A B;  3A6N C;  5B33 C;  2F8N G;  3AZE B;  2FJ7 B;  2IO5 C;  1P3O B;  1ID3 D;  1KX5 C;  3AZI D;  5B2I D;  2NZD C;  4J8V C;  4WU8 A;  3WTP B;  3KXB D;  4WU9 A;  4XZQ C;  5CPI D;  3AZH C;  1U35 C;  1P3P C;  1ZLA D;  2ARO A;  3X1V A;  3R45 B;  4H9S C;  5AV5 C;  5JRG C;  5AV6 B;  3AZJ A;  3AFA B;  3VH6 T;  4X23 D;  4KUD C;  4NFT A;  1P3B C;  3AYW A;  1WWS A;  5B40 C;  3LJA C;  3AV2 C;  3MGR B;  3TU4 A;  4ZBJ B;  4LD9 A;  5BNX B;  3LEL D;  5BO0 B;  5B0Y C;  3X1S A;  1TZY D;  5B32 B;  3AZM B;  3X1V D;  5DNN C;  1ID3 C;  1TAF B;  1P3M C;  4HGA B;  5GT0 D;  3MNN D;  4G92 B;  3AZJ D;  3C1B C;  1M18 B;  5E5A B;  3AZL C;  5CPK D;  3C1C A;  1P34 A;  3B6G A;  3A6N B;  5B33 B;  3X1U A;  3TU4 D;  3UTB A;  3REL D;  1AOI D;  1KU5 A;  3LZ0 A;  2IO5 B;  5GXQ D;  4XUJ D;  5B2I C;  5AVC C;  1KX5 B;  2NZD B;  3X1S D;  4J8V B;  4XZQ B;  3AZH B;  1ZLA C;  1U35 B;  1P3P B;  1H3O B;  1HQ3 D;  3WTP D;  3AZN A;  3B0C T;  1N1J A;  3UTA D;  4H9N B;  1P34 D;  5AV5 B;  5BT1 C;  5JRG B;  4Z5T D;  4UUZ B;  4J8U A;  3AZF A;  3LZ0 D;  4KUD B;  5B40 B;  4CSR A;  3MGS A;  3AV2 B;  4WU8 C;  1P3I A;  4WU9 C;  5B24 A;  4J8W A;  3W99 A;  5B0Y B;  2ARO C;  3X1V C;  5B31 A;  4AWL C;  5DNN B;  5GSU B;  1ID3 B;  5GT0 C;  4H9Q B;  3MNN C;  1KX3 A;  3AZJ C;  3W96 A;  3AZL B;  5CPK C;  2JSS A;  2YFV A;  3LZ1 A;  3AYW C;  3TU4 C;  5B1L D;  1AOI C;  5E5A D;  3REL C;  2PYO A;  4Z66 A;  2YFW A;  4LD9 C;  4XUJ C;  2NQB D;  4KGC D;  5AVC B;  5B2I B;  3X1S C;  3W99 D;  5B33 D;  3KSY A;  3KXB B;  1S32 A;  1KX5 D;  1ZLA B;  2CV5 A;  5DNM A;  1HQ3 C;  3C1C C;  1P34 C;  5AVB D;  5B31 G;  3LZ1 D;  2BYM B;  5G49 B;  4R8P A;  3AZH D;  3X1U C;  1U35 D;  3KWQ A;  3REK A;  4X23 B;  1F66 D;  1BFM A;  3LZ0 C;  5B2J A;  2F8N A;  4CAY A;  1Q9C A;  4WU9 B;  1EQZ A;  3WA9 A;  3B6F D;  4KUD D;  3LEL B;  3VH5 A;  1P3B D;  1JFI A;  3LJA D;  1TZY B;  3VH5 W;  4AWL B;  3AZN C;  3X1V B;  5AY8 A;  5CP6 A;  3AZK A;  1P3K A;  5GT0 B;  3MNN B;  3AZJ B;  5BS7 A;  3AZF C;  4J8U C;  3AZG D;  4Z2M G;  3KWQ D;  3REK D;  5CPK B;  3W97 A;  5DNN D;  2F8N D;  1P3M D;  4H9P A;  3MGS C;  5B1L C;  3C1B D;  3TU4 B;  5JA4 A;  1AOI B;  5B24 C;  3REL B;  4LD9 B;  2NQB C;  4XUJ B;  4J8W C;  3W99 C;  3X1S B;  5B31 C;  3REJ A;  1P3K D;  5FUG A;  1KX3 C;  3W96 C;  5AVC D;  1HQ3 B;  3NQJ A;  3C1C B;  3UTA B;  5AVB C;  3LZ1 C;  1P34 B;  4Z5T B;  1F66 C;  3X1U B;  4J8X A;  2PYO C;  3LZ0 B;  1R4V A;  2F8N K;  3W98 A;  5BT1 D;  1S32 C;  3B6F C;  2HIO A;  3MGP A;  4WU8 D;  4WU9 D;  5GT3 A;  1N1J B;  4R8P C;  4NE5 A;  3AZG C;  3KWQ C;  1BH9 A;  4J8U B;  2ARO D;  3REK C;  4YS3 A;  5B2J C;  3O62 A;  5AV8 A;  4CSR B;  5B1L B;  1EQZ C;  5B24 B;  3WA9 C;  2NQB B;  3AN2 A;  4KGC B;  4J8W B;  3AYW D;  4JJN A;  3W99 B;  3NQU A;  5AY8 C;  5CP6 C;  3AZK C;  5GT3 D;  1P3K C;  4LD9 D;  3V9R B;  4YM6 A;  1KX3 B;  3W96 B;  5BS7 C;  4KHA A;  4H9R A;  3W97 C;  2CWE A;  5AVB B;  2YFV B;  3LZ1 B;  3AZE A;  5AV9 A;  1P3L A;  2FJ7 A;  1F66 B;  2PYO B;  2YFW B;  3C1C D;  3AN2 D;  3VH5 T;  3B6G D;  3X1U D;  3UTB D;  1S32 B;  3B6F B;  1KX4 A;  1P3B B;  4NE6 A;  3X1T A;  3LJA B;  3AV1 A;  4E44 A;  3AZG B;  5AV9 D;  4J8X C;  1P3L D;  5F99 A;  3KWQ B;  3REK B;  5B2J B;  3AZN D;  3W98 C;  2F8N B;  1P3M B;  4CAY B;  3C1B B;  3AZF D;  4J8U D;  1EQZ B;  5BO0 A;  1KX4 D;  3MGQ A;  5B1M A;  5B32 A;  2HIO C;  3X1T D;  3MGS D;  3MGP C;  3AV1 D;  1F1E A;  5KDM A;  1P3I D;  5AY8 B;  5GT3 C;  5CP6 B;  5B24 D;  3AZK B;  5BNV B;  1P3K B;  4J8W D;  1ULY A;  5B31 D;  3W97 B;  3O62 C;  5AV8 C;  1M19 A;  3VH6 A;  1KX3 D;  3W96 D;  2RVQ D;  5JA4 B;  3WAA A;  3AN2 C;  4M6B A;  4WNN A;  4JJN C;  3B6G C;  3UTB C;  3UT9 A;  3B0D C;  2PYO D;  4Z66 D;  3MVD A;  2HUE C;  1P3P A;  5FUG B;  2BYK A;  4H9S A;  5B32 G;  4WU8 B;  3NQJ B;  4ZUX A;  5AV5 A;  5B0Z A;  1S32 D;  1M19 D;  1A7W A;  4UUZ A;  5AV9 C;  1P3L C;  2CV5 D;  5DNM D;  2ARO B;  3W98 B;  5B40 A;  4R8P D;  3UT9 D;  3REI A;  1KX4 C;  5B2J D;  3MVD D;  3AYW B;  3X1T C;  2HIO B;  3AV1 C;  1P3I C;  5GSU A;  3MGP B;  4H9Q A;  4ZUX D;  1EQZ D;  5GT3 B;  3WA9 D;  1P3F A;  3AZL A;  5F99 C;  1BH9 B;  5CPJ A;  3B0C W;  5AY8 D;  5CP6 D;  3O62 B;  3AZK D;  5AV8 B;  4QLC A;  2RVQ C;  4WZS B;  3AZI A;  3W97 D;  3MGQ C;  5B1M C;  3AN2 B;  5B32 C;  3KXB A;  3B6G B;  5CPI A;  3NQU B;  3KUY A;  4G92 C;  4Z66 C;  3UTB B;  3B0D B;  1ZLA A;  2HUE B;  1P3F D;  5C3I C;  4KHA B;  4H9R B;  5CPJ D;  5G49 A;  1M19 C;  3REJ D;  4WV4 B;  4X23 A;  4QLC D;  2CV5 C;  5DNM C;  5AV9 B;  1P3L B;  3WAA C;  3AZN B;  1P3G A;  3AZF B;  4J8X D;  3UT9 C;  1BH8 A;  3LEL A;  3KUY D;  3MVD C;  1KX4 B;  3W98 D;  4H9O A;  1TZY A;  4EO5 C;  3X1T B;  3MGS B;  3AV1 B;  4ZUX C;  1P3I B;  5GT0 A;  5B0Z C;  3MNN A;  3WKJ A;  5CPK A;  2HIO D;  5F99 B;  5B31 B;  3MGP D;  1P3O A;  3REH A;  1B67 A;  1P3G D;  1P3A A;  1AOI A;  3REL A;  4YS3 D;  5GXQ A;  4XUJ A;  3REI C;  1M1A A;  3O62 D;  3MGQ B;  5B1M B;  5AV8 D;  4DRB A;  5GSU C;  5KDM B;  4Z66 B;  1P3F C;  5C3I B;  1HQ3 A;  3WTP A;  4JJN D;  3WKJ D;  3UTA A;  5CPJ C;  1P3O D;  3REJ C;  4Z5T A;  1M19 B;  3REH D;  4YM6 D;  4QLC C;  1P3A D;  3R45 A;  2CV5 B;  5DNM B;  1WWI A;  3AZI C;  3WAA B;  4DRA A;  5AV6 A;  1M1A D;  3AFA A;  3WTP E;  4WNN B;  3KXB C;  4R8P B;  3AZE D;  5CPI C;  2FJ7 D;  3KUY C;  3UT9 B;  3MVD B;  3MGR A;  2BYK B;  4EO5 B;  5CHL B;  5BNX A;  4ZUX B;  5B0Z B;  3WA9 B;  4X23 C;  1JFI B;  3AZM A;  4E45 A;  1TAF A;  4G91 C;  5AV6 D;  1P3G C;  1M18 A;  5B1L A;  3AFA D;  5E5A A;  4YS3 C;  5F99 D;  3LEL C;  2NQB A;  4KGC A;  3REI B;  1TZY C;  5B33 A;  3A6N A;  3MGR D;  4H9P B;  3VH6 W;  2LY8 A;  3V9R A;  1KX5 A;  1P3F B;  3MGQ D;  2NZD A;  5B1M D;  4J8V A;  5B32 D;  3WKJ C;  3AZM D;  4XZQ A;  5AVB A;  5CPJ B;  1P3O C;  3AZH A;  3REH C;  4YM6 C;  3REJ B;  1U35 A;  1P3A C;  1M18 D;  1F66 A;  4QLC B;  1H3O A;  5GXQ C;  4H9N A;  1M1A C;  3AZI B;  5JRG A;  3A6N D;  1HTA A;  3AZE C;  2FJ7 C;  3B6F A;  5CPI B;  4J8X B;  4KUD A;  3KUY B;  1B6W A;  1P3B A;  3WAA D;  3LJA A;  2NZD D;  3AV2 A;  3WTP C;  4J8V D;  4NE3 A;  3UTA C;  4XZQ D;  4Z5T C;  3AZG A;  5B0Y A;  1P3P D;  5DNN A;  1ID3 A;  1P3M A;  5AV5 D;  5AV6 C;  5B0Z D;  3AFA C;  4G91 B;  5JRG D;  1P3G B;  3C1B A;  4YS3 B;  1BH8 B;  4H9O B;  5B40 D;  3MGR C;  4ZBJ C;  4Z2M H;  3AV2 D;  3B0B A;  5BNV A;  5AVC A;  5B2I A;  3REI D;  2L5A A;  5B0Y D;  3AZM C;  4JJN B;  3WKJ B;  5GSU D;  4HGA C; 
#chains in the Genus database with same CATH topology
 1M18 C;  2F8N H;  3REH B;  4YM6 B;  5E5A C;  1P3A B;  3AZL D;  5GXQ B;  4KGC C;  2BYM A;  1M1A B;  3A6N C;  5B33 C;  2F8N G;  3AZE B;  2FJ7 B;  2IO5 C;  1P3O B;  1ID3 D;  3P5J B;  2Y2L A;  1KX5 C;  3AZI D;  5B2I D;  2NZD C;  4J8V C;  4WU8 A;  3WTP B;  3KXB D;  4WU9 A;  4XZQ C;  5CPI D;  3AZH C;  2UWX A;  1U35 C;  1P3P C;  1ZLA D;  2ARO A;  3X1V A;  3R45 B;  4H9S C;  5AV5 C;  5JRG C;  5AV6 B;  4UPK A;  3AZJ A;  3AFA B;  3VH6 T;  4X23 D;  4KUD C;  4NFT A;  1P3B C;  3AYW A;  1WWS A;  3F6T A;  5B40 C;  3LJA C;  3AV2 C;  3MGR B;  3TU4 A;  4ZBJ B;  4LD9 A;  5BNX B;  3LEL D;  5BO0 B;  5B0Y C;  3X1S A;  1TZY D;  5B32 B;  3AZM B;  3X1V D;  5DNN C;  1ID3 C;  1TAF B;  1P3M C;  4HGA B;  5GT0 D;  3MNN D;  4G92 B;  3AZJ D;  3C1B C;  1M18 B;  5E5A B;  3AZL C;  5CPK D;  3C1C A;  1P34 A;  1PZR A;  3B6G A;  3A6N B;  5B33 B;  3X1U A;  3TU4 D;  3UTB A;  3REL D;  1AOI D;  1KU5 A;  3LZ0 A;  2IO5 B;  5GXQ D;  4XUJ D;  5B2I C;  5AVC C;  1KX5 B;  3EPK A;  2NZD B;  2Y2P A;  3X1S D;  4J8V B;  4XZQ B;  3AZH B;  1ZLA C;  1U35 B;  1P3P B;  1H3O B;  1HQ3 D;  3WTP D;  3AZN A;  3B0C T;  1N1J A;  3UTA D;  3FDD A;  4H9N B;  1P34 D;  5AV5 B;  5BT1 C;  5JRG B;  4Z5T D;  4UUZ B;  4J8U A;  3AZF A;  3LZ0 D;  4KUD B;  3KFU G;  5B40 B;  4CSR A;  3MGS A;  3AV2 B;  4WU8 C;  1P3I A;  4WU9 C;  2RIQ A;  5B24 A;  2G5I C;  4J8W A;  3W99 A;  5B0Y B;  2ARO C;  3X1V C;  5B31 A;  4AWL C;  5DNN B;  4DQY B;  5GSU B;  1ID3 B;  5GT0 C;  4H9Q B;  3MNN C;  1KX3 A;  3AZJ C;  3W96 A;  3AZL B;  5CPK C;  2ZM5 A;  2JSS A;  2YFV A;  3LZ1 A;  3AYW C;  2J8P A;  3TU4 C;  5B1L D;  1AOI C;  5E5A D;  3REL C;  2PYO A;  4Z66 A;  2Y2M A;  2YFW A;  4LD9 C;  4XUJ C;  2NQB D;  4KGC D;  5AVC B;  5B2I B;  3X1S C;  3W99 D;  5B33 D;  3KSY A;  3KXB B;  1S32 A;  2XD5 A;  1KX5 D;  1ZLA B;  2CV5 A;  5DNM A;  1HQ3 C;  3C1C C;  1P34 C;  5AVB D;  5B31 G;  2DQN C;  2BYM B;  5G49 B;  4R8P A;  3LZ1 D;  3AZH D;  3X1U C;  1U35 D;  3EPL A;  3KWQ A;  3REK A;  4X23 B;  1F66 D;  1BFM A;  3LZ0 C;  5B2J A;  2F8N A;  4CAY A;  1Q9C A;  4WU9 B;  1EQZ A;  3WA9 A;  3B6F D;  4KUD D;  3LEL B;  3VH5 A;  1P3B D;  3A1I A;  1JFI A;  3LJA D;  1TZY B;  3VH5 W;  4AWL B;  3AZN C;  3X1V B;  5AY8 A;  5CP6 A;  3AZK A;  1P3K A;  5GT0 B;  3MNN B;  3AZJ B;  5BS7 A;  3AZF C;  4J8U C;  3AZG D;  4Z2M G;  3KWQ D;  3REK D;  5CPK B;  3W97 A;  5DNN D;  2F8N D;  1P3M D;  4H9P A;  3MGS C;  5B1L C;  3C1B D;  3TU4 B;  5JA4 A;  1AOI B;  5B24 C;  3REL B;  4LD9 B;  2NQB C;  4XUJ B;  4J8W C;  3W99 C;  3X1S B;  5B31 C;  2ZY4 A;  3REJ A;  1P3K D;  5FUG A;  1KX3 C;  3W96 C;  5AVC D;  1HQ3 B;  3NQJ A;  3C1C B;  3UTA B;  5AVB C;  3LZ1 C;  1P34 B;  4Z5T B;  1F66 C;  3X1U B;  4J8X A;  2PYO C;  2Y2G A;  3LZ0 B;  1R4V A;  2F8N K;  3W98 A;  5BT1 D;  1S32 C;  3B6F C;  2XD1 A;  2HIO A;  3MGP A;  4WU8 D;  4WU9 D;  2W8S A;  5GT3 A;  2Y2H A;  1N1J B;  4R8P C;  4NE5 A;  3AZG C;  3KWQ C;  1BH9 A;  4J8U B;  2ARO D;  3REK C;  4YS3 A;  5B2J C;  3O62 A;  5AV8 A;  1T3U A;  2ZY5 A;  3EPJ A;  4CSR B;  5B1L B;  1EQZ C;  5B24 B;  3WA9 C;  2NQB B;  3AN2 A;  4KGC B;  4J8W B;  3AYW D;  4JJN A;  3W99 B;  3NQU A;  5AY8 C;  5CP6 C;  3AZK C;  5GT3 D;  1P3K C;  4LD9 D;  3V9R B;  4YM6 A;  1KX3 B;  3W96 B;  5BS7 C;  4KHA A;  4H9R A;  3W97 C;  2CWE A;  5AVB B;  2YFV B;  3LZ1 B;  3AZE A;  5AV9 A;  1P3L A;  2FJ7 A;  1F66 B;  2PYO B;  2YFW B;  3C1C D;  3AN2 D;  3VH5 T;  3B6G D;  3X1U D;  3UTB D;  1S32 B;  3B6F B;  1KX4 A;  1P3B B;  4NE6 A;  3X1T A;  3LJA B;  3AV1 A;  4E44 A;  1W2E A;  3AZG B;  5AV9 D;  4J8X C;  1P3L D;  5F99 A;  3KWQ B;  3REK B;  5B2J B;  3AZN D;  3W98 C;  2F8N B;  1P3M B;  4CAY B;  3C1B B;  3AZF D;  4J8U D;  1EQZ B;  5BO0 A;  1KX4 D;  3MGQ A;  5B1M A;  5B32 A;  2HIO C;  3X1T D;  3MGS D;  3MGP C;  2JCH A;  1F1E A;  5KDM A;  3AV1 D;  1P3I D;  5AY8 B;  5GT3 C;  5CP6 B;  5B24 D;  3AZK B;  5BNV B;  1P3K B;  4J8W D;  3H0M C;  1ULY A;  5B31 D;  3W97 B;  3O62 C;  5AV8 C;  1M19 A;  3VH6 A;  1KX3 D;  3W96 D;  2RVQ D;  2Y2J A;  5JA4 B;  3WAA A;  3A1K A;  3AN2 C;  4M6B A;  4WNN A;  4JJN C;  3B6G C;  3UTB C;  3UT9 A;  3B0D C;  2PYO D;  4Z66 D;  3MVD A;  2HUE C;  1P3P A;  5FUG B;  2BYK A;  4H9S A;  5B32 G;  4WU8 B;  3NQJ B;  4ZUX A;  5AV5 A;  5B0Z A;  1S32 D;  1M19 D;  1A7W A;  4UUZ A;  2Y2O A;  5AV9 C;  1P3L C;  2CV5 D;  5DNM D;  2ARO B;  3W98 B;  2JE5 A;  5B40 A;  2FFF B;  4R8P D;  3UT9 D;  3REI A;  1KX4 C;  5B2J D;  3MVD D;  3AYW B;  3X1T C;  2F2A C;  2HIO B;  3AV1 C;  1P3I C;  5GSU A;  3MGP B;  4H9Q A;  4ZUX D;  1EQZ D;  5GT3 B;  3WA9 D;  1P3F A;  3AZL A;  5F99 C;  1BH9 B;  5CPJ A;  3B0C W;  5AY8 D;  5CP6 D;  3O62 B;  3AZK D;  5AV8 B;  4QLC A;  2RVQ C;  4WZS B;  3AZI A;  3W97 D;  3MGQ C;  5B1M C;  3AN2 B;  5B32 C;  3KXB A;  3B6G B;  5CPI A;  3NQU B;  3KUY A;  4G92 C;  4Z66 C;  3UTB B;  3B0D B;  1ZLA A;  2HUE B;  1P3F D;  5C3I C;  4KHA B;  4H9R B;  5CPJ D;  5G49 A;  1M19 C;  3REJ D;  4WV4 B;  4X23 A;  4QLC D;  2CV5 C;  5DNM C;  5AV9 B;  1P3L B;  3WAA C;  3AZN B;  1P3G A;  3AZF B;  4J8X D;  3UT9 C;  1BH8 A;  3LEL A;  3KUY D;  3MVD C;  1KX4 B;  3W98 D;  4H9O A;  2Y2Q A;  1TZY A;  4EO5 C;  3X1T B;  3MGS B;  3AV1 B;  4ZUX C;  1P3I B;  5GT0 A;  5B0Z C;  3MNN A;  3WKJ A;  5CPK A;  2HIO D;  5F99 B;  5B31 B;  3MGP D;  1P3O A;  3REH A;  1B67 A;  1P3G D;  1P3A A;  1Z2C B;  1AOI A;  3REL A;  4YS3 D;  5GXQ A;  4XUJ A;  3REI C;  1M1A A;  3O62 D;  3MGQ B;  5B1M B;  5AV8 D;  4DRB A;  5GSU C;  3IP4 C;  5KDM B;  3EPH A;  4Z66 B;  1P3F C;  5C3I B;  1HQ3 A;  3WTP A;  4JJN D;  3WKJ D;  3UTA A;  5CPJ C;  1P3O D;  2Y2N A;  3REJ C;  4Z5T A;  1M19 B;  3REH D;  4YM6 D;  4QLC C;  1P3A D;  2ZY2 A;  3R45 A;  2CV5 B;  5DNM B;  2Y2I A;  1WWI A;  3AZI C;  3WAA B;  4DRA A;  5AV6 A;  1M1A D;  3AFA A;  3WTP E;  4WNN B;  3KXB C;  4R8P B;  3AZE D;  5CPI C;  2ZY3 A;  2FJ7 D;  3KUY C;  4WJ3 C;  3UT9 B;  3MVD B;  3MGR A;  2BYK B;  4EO5 B;  5CHL B;  5BNX A;  4ZUX B;  3AL0 C;  5B0Z B;  3WA9 B;  4X23 C;  1JFI B;  3AZM A;  4E45 A;  1TAF A;  2G5H C;  4G91 C;  5AV6 D;  1P3G C;  1M18 A;  5B1L A;  3AFA D;  5E5A A;  2VQR A;  4YS3 C;  5F99 D;  3LEL C;  2BG1 A;  2NQB A;  3EG5 B;  4KGC A;  3REI B;  1TZY C;  5B33 A;  3A6N A;  3MGR D;  4H9P B;  3VH6 W;  2LY8 A;  3V9R A;  3H0R C;  1KX5 A;  1P3F B;  3MGQ D;  2NZD A;  5B1M D;  4J8V A;  5B32 D;  3WKJ C;  3AZM D;  4XZQ A;  5AVB A;  5CPJ B;  1P3O C;  3AZH A;  3REH C;  4YM6 C;  3REJ B;  1U35 A;  1P3A C;  1M18 D;  1F66 A;  4QLC B;  1H3O A;  5GXQ C;  4H9N A;  1M1A C;  3AZI B;  5JRG A;  3A6N D;  1HTA A;  3AZE C;  2FJ7 C;  3B6F A;  5CPI B;  4J8X B;  4KUD A;  3KUY B;  1B6W A;  1P3B A;  3WAA D;  3LJA A;  2NZD D;  3AV2 A;  3WTP C;  4J8V D;  4NE3 A;  3UTA C;  4XZQ D;  4Z5T C;  3AZG A;  5B0Y A;  1P3P D;  2Y2K A;  5DNN A;  1ID3 A;  1P3M A;  5AV5 D;  5AV6 C;  5B0Z D;  3AFA C;  4G91 B;  5JRG D;  1P3G B;  3C1B A;  4YS3 B;  1BH8 B;  4H9O B;  5B40 D;  3MGR C;  3H0L C;  4ZBJ C;  4Z2M H;  3AV2 D;  3B0B A;  5BNV A;  5AVC A;  5B2I A;  3REI D;  2L5A A;  5B0Y D;  2DF4 C;  4JJN B;  3AZM C;  3WKJ B;  5GSU D;  4HGA C; 
#chains in the Genus database with same CATH homology
 1M18 C;  2F8N H;  3REH B;  4YM6 B;  5E5A C;  1P3A B;  3AZL D;  5GXQ B;  4KGC C;  2BYM A;  1M1A B;  3A6N C;  5B33 C;  2F8N G;  3AZE B;  2FJ7 B;  2IO5 C;  1P3O B;  1ID3 D;  3P5J B;  2Y2L A;  1KX5 C;  3AZI D;  5B2I D;  2NZD C;  4J8V C;  4WU8 A;  3WTP B;  3KXB D;  4WU9 A;  4XZQ C;  5CPI D;  3AZH C;  2UWX A;  1U35 C;  1P3P C;  1ZLA D;  2ARO A;  3X1V A;  3R45 B;  4H9S C;  5AV5 C;  5JRG C;  5AV6 B;  4UPK A;  3AZJ A;  3AFA B;  3VH6 T;  4X23 D;  4KUD C;  4NFT A;  1P3B C;  3AYW A;  1WWS A;  3F6T A;  5B40 C;  3LJA C;  3AV2 C;  3MGR B;  3TU4 A;  4ZBJ B;  4LD9 A;  5BNX B;  3LEL D;  5BO0 B;  5B0Y C;  3X1S A;  1TZY D;  5B32 B;  3AZM B;  3X1V D;  5DNN C;  1ID3 C;  1TAF B;  1P3M C;  4HGA B;  5GT0 D;  3MNN D;  4G92 B;  3AZJ D;  3C1B C;  1M18 B;  5E5A B;  3AZL C;  5CPK D;  3C1C A;  1P34 A;  1PZR A;  3B6G A;  3A6N B;  5B33 B;  3X1U A;  3TU4 D;  3UTB A;  3REL D;  1AOI D;  1KU5 A;  3LZ0 A;  2IO5 B;  5GXQ D;  4XUJ D;  5B2I C;  5AVC C;  1KX5 B;  3EPK A;  2NZD B;  2Y2P A;  3X1S D;  4J8V B;  4XZQ B;  3AZH B;  1ZLA C;  1U35 B;  1P3P B;  1H3O B;  1HQ3 D;  3WTP D;  3AZN A;  3B0C T;  1N1J A;  3UTA D;  3FDD A;  4H9N B;  1P34 D;  5AV5 B;  5BT1 C;  5JRG B;  4Z5T D;  4UUZ B;  4J8U A;  3AZF A;  3LZ0 D;  4KUD B;  3KFU G;  5B40 B;  4CSR A;  3MGS A;  3AV2 B;  4WU8 C;  1P3I A;  4WU9 C;  2RIQ A;  5B24 A;  2G5I C;  4J8W A;  3W99 A;  5B0Y B;  2ARO C;  3X1V C;  5B31 A;  4AWL C;  5DNN B;  4DQY B;  5GSU B;  1ID3 B;  5GT0 C;  4H9Q B;  3MNN C;  1KX3 A;  3AZJ C;  3W96 A;  3AZL B;  5CPK C;  2ZM5 A;  2JSS A;  2YFV A;  3LZ1 A;  3AYW C;  2J8P A;  3TU4 C;  5B1L D;  1AOI C;  5E5A D;  3REL C;  2PYO A;  4Z66 A;  2Y2M A;  2YFW A;  4LD9 C;  4XUJ C;  2NQB D;  4KGC D;  5AVC B;  5B2I B;  3X1S C;  3W99 D;  5B33 D;  3KSY A;  3KXB B;  1S32 A;  2XD5 A;  1KX5 D;  1ZLA B;  2CV5 A;  5DNM A;  1HQ3 C;  3C1C C;  1P34 C;  5AVB D;  5B31 G;  2DQN C;  2BYM B;  5G49 B;  4R8P A;  3LZ1 D;  3AZH D;  3X1U C;  1U35 D;  3EPL A;  3KWQ A;  3REK A;  4X23 B;  1F66 D;  1BFM A;  3LZ0 C;  5B2J A;  2F8N A;  4CAY A;  1Q9C A;  4WU9 B;  1EQZ A;  3WA9 A;  3B6F D;  4KUD D;  3LEL B;  3VH5 A;  1P3B D;  3A1I A;  1JFI A;  3LJA D;  1TZY B;  3VH5 W;  4AWL B;  3AZN C;  3X1V B;  5AY8 A;  5CP6 A;  3AZK A;  1P3K A;  5GT0 B;  3MNN B;  3AZJ B;  5BS7 A;  3AZF C;  4J8U C;  3AZG D;  4Z2M G;  3KWQ D;  3REK D;  5CPK B;  3W97 A;  5DNN D;  2F8N D;  1P3M D;  4H9P A;  3MGS C;  5B1L C;  3C1B D;  3TU4 B;  5JA4 A;  1AOI B;  5B24 C;  3REL B;  4LD9 B;  2NQB C;  4XUJ B;  4J8W C;  3W99 C;  3X1S B;  5B31 C;  2ZY4 A;  3REJ A;  1P3K D;  5FUG A;  1KX3 C;  3W96 C;  5AVC D;  1HQ3 B;  3NQJ A;  3C1C B;  3UTA B;  5AVB C;  3LZ1 C;  1P34 B;  4Z5T B;  1F66 C;  3X1U B;  4J8X A;  2PYO C;  2Y2G A;  3LZ0 B;  1R4V A;  2F8N K;  3W98 A;  5BT1 D;  1S32 C;  3B6F C;  2XD1 A;  2HIO A;  3MGP A;  4WU8 D;  4WU9 D;  2W8S A;  5GT3 A;  2Y2H A;  1N1J B;  4R8P C;  4NE5 A;  3AZG C;  3KWQ C;  1BH9 A;  4J8U B;  2ARO D;  3REK C;  4YS3 A;  5B2J C;  3O62 A;  5AV8 A;  1T3U A;  2ZY5 A;  3EPJ A;  4CSR B;  5B1L B;  1EQZ C;  5B24 B;  3WA9 C;  2NQB B;  3AN2 A;  4KGC B;  4J8W B;  3AYW D;  4JJN A;  3W99 B;  3NQU A;  5AY8 C;  5CP6 C;  3AZK C;  5GT3 D;  1P3K C;  4LD9 D;  3V9R B;  4YM6 A;  1KX3 B;  3W96 B;  5BS7 C;  4KHA A;  4H9R A;  3W97 C;  2CWE A;  5AVB B;  2YFV B;  3LZ1 B;  3AZE A;  5AV9 A;  1P3L A;  2FJ7 A;  1F66 B;  2PYO B;  2YFW B;  3C1C D;  3AN2 D;  3VH5 T;  3B6G D;  3X1U D;  3UTB D;  1S32 B;  3B6F B;  1KX4 A;  1P3B B;  4NE6 A;  3X1T A;  3LJA B;  3AV1 A;  4E44 A;  1W2E A;  3AZG B;  5AV9 D;  4J8X C;  1P3L D;  5F99 A;  3KWQ B;  3REK B;  5B2J B;  3AZN D;  3W98 C;  2F8N B;  1P3M B;  4CAY B;  3C1B B;  3AZF D;  4J8U D;  1EQZ B;  5BO0 A;  1KX4 D;  3MGQ A;  5B1M A;  5B32 A;  2HIO C;  3X1T D;  3MGS D;  3MGP C;  2JCH A;  1F1E A;  5KDM A;  3AV1 D;  1P3I D;  5AY8 B;  5GT3 C;  5CP6 B;  5B24 D;  3AZK B;  5BNV B;  1P3K B;  4J8W D;  3H0M C;  1ULY A;  5B31 D;  3W97 B;  3O62 C;  5AV8 C;  1M19 A;  3VH6 A;  1KX3 D;  3W96 D;  2RVQ D;  2Y2J A;  5JA4 B;  3WAA A;  3A1K A;  3AN2 C;  4M6B A;  4WNN A;  4JJN C;  3B6G C;  3UTB C;  3UT9 A;  3B0D C;  2PYO D;  4Z66 D;  3MVD A;  2HUE C;  1P3P A;  5FUG B;  2BYK A;  4H9S A;  5B32 G;  4WU8 B;  3NQJ B;  4ZUX A;  5AV5 A;  5B0Z A;  1S32 D;  1M19 D;  1A7W A;  4UUZ A;  2Y2O A;  5AV9 C;  1P3L C;  2CV5 D;  5DNM D;  2ARO B;  3W98 B;  2JE5 A;  5B40 A;  2FFF B;  4R8P D;  3UT9 D;  3REI A;  1KX4 C;  5B2J D;  3MVD D;  3AYW B;  3X1T C;  2F2A C;  2HIO B;  3AV1 C;  1P3I C;  5GSU A;  3MGP B;  4H9Q A;  4ZUX D;  1EQZ D;  5GT3 B;  3WA9 D;  1P3F A;  3AZL A;  5F99 C;  1BH9 B;  5CPJ A;  3B0C W;  5AY8 D;  5CP6 D;  3O62 B;  3AZK D;  5AV8 B;  4QLC A;  2RVQ C;  4WZS B;  3AZI A;  3W97 D;  3MGQ C;  5B1M C;  3AN2 B;  5B32 C;  3KXB A;  3B6G B;  5CPI A;  3NQU B;  3KUY A;  4G92 C;  4Z66 C;  3UTB B;  3B0D B;  1ZLA A;  2HUE B;  1P3F D;  5C3I C;  4KHA B;  4H9R B;  5CPJ D;  5G49 A;  1M19 C;  3REJ D;  4WV4 B;  4X23 A;  4QLC D;  2CV5 C;  5DNM C;  5AV9 B;  1P3L B;  3WAA C;  3AZN B;  1P3G A;  3AZF B;  4J8X D;  3UT9 C;  1BH8 A;  3LEL A;  3KUY D;  3MVD C;  1KX4 B;  3W98 D;  4H9O A;  2Y2Q A;  1TZY A;  4EO5 C;  3X1T B;  3MGS B;  3AV1 B;  4ZUX C;  1P3I B;  5GT0 A;  5B0Z C;  3MNN A;  3WKJ A;  5CPK A;  2HIO D;  5F99 B;  5B31 B;  3MGP D;  1P3O A;  3REH A;  1B67 A;  1P3G D;  1P3A A;  1Z2C B;  1AOI A;  3REL A;  4YS3 D;  5GXQ A;  4XUJ A;  3REI C;  1M1A A;  3O62 D;  3MGQ B;  5B1M B;  5AV8 D;  4DRB A;  5GSU C;  3IP4 C;  5KDM B;  3EPH A;  4Z66 B;  1P3F C;  5C3I B;  1HQ3 A;  3WTP A;  4JJN D;  3WKJ D;  3UTA A;  5CPJ C;  1P3O D;  2Y2N A;  3REJ C;  4Z5T A;  1M19 B;  3REH D;  4YM6 D;  4QLC C;  1P3A D;  2ZY2 A;  3R45 A;  2CV5 B;  5DNM B;  2Y2I A;  1WWI A;  3AZI C;  3WAA B;  4DRA A;  5AV6 A;  1M1A D;  3AFA A;  3WTP E;  4WNN B;  3KXB C;  4R8P B;  3AZE D;  5CPI C;  2ZY3 A;  2FJ7 D;  3KUY C;  4WJ3 C;  3UT9 B;  3MVD B;  3MGR A;  2BYK B;  4EO5 B;  5CHL B;  5BNX A;  4ZUX B;  3AL0 C;  5B0Z B;  3WA9 B;  4X23 C;  1JFI B;  3AZM A;  4E45 A;  1TAF A;  2G5H C;  4G91 C;  5AV6 D;  1P3G C;  1M18 A;  5B1L A;  3AFA D;  5E5A A;  2VQR A;  4YS3 C;  5F99 D;  3LEL C;  2BG1 A;  2NQB A;  3EG5 B;  4KGC A;  3REI B;  1TZY C;  5B33 A;  3A6N A;  3MGR D;  4H9P B;  3VH6 W;  2LY8 A;  3V9R A;  3H0R C;  1KX5 A;  1P3F B;  3MGQ D;  2NZD A;  5B1M D;  4J8V A;  5B32 D;  3WKJ C;  3AZM D;  4XZQ A;  5AVB A;  5CPJ B;  1P3O C;  3AZH A;  3REH C;  4YM6 C;  3REJ B;  1U35 A;  1P3A C;  1M18 D;  1F66 A;  4QLC B;  1H3O A;  5GXQ C;  4H9N A;  1M1A C;  3AZI B;  5JRG A;  3A6N D;  1HTA A;  3AZE C;  2FJ7 C;  3B6F A;  5CPI B;  4J8X B;  4KUD A;  3KUY B;  1B6W A;  1P3B A;  3WAA D;  3LJA A;  2NZD D;  3AV2 A;  3WTP C;  4J8V D;  4NE3 A;  3UTA C;  4XZQ D;  4Z5T C;  3AZG A;  5B0Y A;  1P3P D;  2Y2K A;  5DNN A;  1ID3 A;  1P3M A;  5AV5 D;  5AV6 C;  5B0Z D;  3AFA C;  4G91 B;  5JRG D;  1P3G B;  3C1B A;  4YS3 B;  1BH8 B;  4H9O B;  5B40 D;  3MGR C;  3H0L C;  4ZBJ C;  4Z2M H;  3AV2 D;  3B0B A;  5BNV A;  5AVC A;  5B2I A;  3REI D;  2L5A A;  5B0Y D;  2DF4 C;  4JJN B;  3AZM C;  3WKJ B;  5GSU D;  4HGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...