3REIB

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiB00
3AV2B 3AN2B 5KDMB 3AZJC 5G49B 3W96C 4E44A 5BS7C 3B0CW 3MVDB 3C1CB 3AZLA 5AV8B 3X1UB 3AZFA 3KUYC 5JRGC 3MGQD 3KWQA 3MGPC 3AZJA 3AZID 3AFAD 3AZFC 5CPKC 3WAAA 3A6NC 1U35C 3AN2A 4YM6B 3VH5A 3AZLB 5AV8A 3X1UA 3REJA 2RVQC 3VH6T 4H9PA 3MGSB 5B1LB 5AV8C 3LZ1D 1ID3B 1F66D 4YM6A 5B0ZA 3VH5T 3X1VC 3O62D 3AZIB 5B1LA 5AV9A 3AV2D 3WA9D 2IO5B 4J8UA 3AZNA 1M19A 3AZMD 2RVQD 3W97C 5GSUA 1P3OA 5B0ZB 3LELB 4EO5C 1P3MB 1EQZC 3WTPD 1KX4D 4XZQD 2FJ7C 5AVCD 4XUJD 5GSUC 5AV9B 3AV2C 5CPJA 4J8UB 5AVBA 1ULYA 4AWLB 3KUYD 3C1CC 1EQZA 4ZBJC 3X1VB 3NQJB 3W97D 1P3OB 1TZYB 2FJ7A 1KX5A 1P3MA 4NE5A 4DRBA 4J8WC 3W97B 3LZ1B 4H9OA 5B31G 3AN2D 3B6GD 2HIOC 5CPJB 1KX5C 5AVBB 4YS3D 3AZLC 4H9SC 1EQZB 1P3GC 5B32A 3REHD 1HQ3A 4J8XD 2FJ7B 4ZUXC 4H9QB 3X1SD 4J8WA 3AV1D 4R8PD 3LJAD 5F99D 2NQBD 3C1BA 3LZ1A 1F66A 3REID 5AY8D 5B33B 5AV5C 3AZGC 1U35B 1P3KD 2CWEA 1HQ3B 1ZLAB 1S32D 3LZ1C 3AYWC 5BNVB 5B1LD 4Z2MG 5GT3A 5B31A 3C1BB 1F66B 4QLCB 5B33A 4LD9D 3AYWA 1U35A 5E5AC 4EO5B 3NQUA 3UTBD 5B40B 5BNVA 4XUJA 5B32D 5GT3B 3WTPA 4AWLC 4QLCA 4J8VD 3AZKD 3WKJD 1TZYC 4Z66C 1BH9A 3NQUB 4KUDB 3X1TD 3W98A 4M6BA 4XUJB 2AROB 5B0YB 1P3KA 2HIOB 5CPJC 3MVDD 1P3MD 4Z66A 4KHAA 5E5AD 3MGRD 5B40C 4R8PA 1P3OC 4KUDA 3B6FD 3W98B 3REHA 1BH8A 5B0YA 1B6WA 4H9NA 4Z66B 5F99C 3AZED 3TU4A 4NFTA 4KHAB 5G49A 1HQ3C 3VH6W 4WU9D 5B0YC 5B2JB 3KSYA 1H3OB 1P34C 3AZJB 1AOID 3W96B 3WAAB 3LZ0D 3TU4B 5AV5B 3AZGB 2L5AA 4YM6D 4CAYB 3REJB 5B32C 1ZLAC 5CPKB 4G91C 4H9PB 1A7WA 3W96A 5BS7A 1P34D 5CP6A 5GXQB 1P3BD 1F66C 3AZND 5B0YD 3KXBC 5AV5A 3AZGA 4CAYA 1KX3D 5E5AB 4Z5TC 3WAAC 5CPKA 3AZIA 3B0BA 3WA9C 3WTPC 2F8ND 5GT3C 5B24A 3REJC 1R4VA 1M19B 5AY8C 5BT1C 5DNNC 5B40D 3MGRC 4JJND 3AZIC 3WA9A 5E5AA 3W98C 4J8UD 5GSUD 4XUJC 4XZQB 3LZ0B 3TU4D 5B24B 5B0ZC 2CV5C 1JFIA 3X1VA 5GT0C 4KGCB 3REKD 1TZYA 5AV9C 1HQ3D 1P3GD 1P34B 1AOIA 4J8UC 1M19C 2F8NG 3MNND 4X23B 3LJAA 3W97A 4ZBJB 3LZ0A 3B6GC 3UT9B 3TU4C 5BO0A 3UTAB 2YFVB 4E45A 4J8VC 4DRAA 5B32B 1P3FD 4H9QA 4J8WB 3LZ0C 3B0DB 4J8XB 5B2JC 4G92C 3B6GA 4WZSB 1P34A 2CV5B 1AOIB 5AVBC 4X23D 3W96D 5CPID 5CPJD 1P3GB 5BO0B 4ZUXB 2YFVA 3WTPE 2BYKA 1ZLAA 1S32B 5B2JD 2F8NA 4G91B 5CP6C 3WKJB 5B31B 1P3GA 5AY8B 5JA4B 5GXQC 5DNND 4ZUXA 5B2IB 3AYWB 5B1MC 5AV8D 3MGRB 3AZKA 3UTBC 3C1BC 2HIOD 5C3IB 4UUZA 5B24C 3REIA 3UTBA 3WTPB 5AY8A 5JA4A 1P3IC 5B2IA 5B0ZD 3MGRA 3AZKB 3AZMC 1BH9B 5DNNB 5B31C 5DNMD 1M18A 3AZHD 1M1AC 4UUZB 5JRGD 4KUDD 5B2IC 3RELB 3UT9C 2NZDC 3AZMA 3REIB 3UTBB 3MNNC 4J8VB 4WNNA 3VH5W 1P3LC 3W99D 3MGQA 4R8PB 4KGCC 5DNNA 3X1SB 4LD9C 3AFAA 1P3IB 1BH8B 1P3AD 1P3PB 3RELA 1P3LA 5AVBD 4X23C 3AZMB 4H9NB 4QLCD 4J8VA 4WU9C 4WNNB 3UTAC 4HGAB 3MGQB 3AZLD 4YS3C 3RELC 2NZDB 5B2JA 3UT9D 5F99B 3AFAB 3WKJC 1H3OA 1AOIC 1ZLAD 1P3PA 1P3LB 3LJAC 4YS3A 4R8PC 5CP6D 1F1EA 2NQBB 5FUGB 1P3PC 3R45B 4NE3A 3KXBD 5AV6A 5F99A 1S32C 2FJ7D 1KX4C 2LY8A 4Z5TD 5CP6B 5GXQA 2PYOD 4YS3B 1P3OD 4JJNB 1P3AA 5B1MB 5FUGA 1KX4A 5BT1D 3R45A 5B2ID 1P3BA 1BFMA 1WWIA 5GT3D 5B31D 5DNMC 2F8NH 3KXBB 2HUEC 1KX5D 1P3AB 1P3PD 4Z5TB 4NE6A 5B1MA 3X1SC 3AZKC 1KX4B 4LD9B 3WA9B 3W99C 3REKA 1P3BB 5GT0D 1P3LD 4XZQA 3KXBA 1JFIB 3RELD 3MGQC 5AV5D 4Z5TA 3AZGD 1ID3D 4KGCA 5B33D 3AZHB 4XZQC 3X1TA 4LD9A 3REKB 3AFAC 1P3FA 3C1CD 1KX3C 4X23A 3LJAB 5B24D 5GT0B 3UT9A 3UTAA 3W99B 5BNXA 4WU9B 3MGSD 1P3ID 4HGAC 3AN2C 4J8XA 3B6GB 4J8WD 3AV1A 1P3FB 2CV5A 3X1UC 3V9RB 5B32G 3B6FB 3W98D 5GT0A 5AV6D 4JJNC 4WU8B 4J8XC 3O62C 3B0DC 4G92B 3MVDA 5BNXB 3X1VD 4WU9A 3AZFB 2BYKB 2NQBC 2PYOC 4YM6C 1S32A 5DNMB 2F8NB 4KGCD 3O62A 3V9RA 3X1UD 3WKJA 3B6FA 3LELD 1P3AC 4WU8A 3MGSC 5B1LC 3AZFD 3AYWD 3AZNC 1P3BC 3KWQD 3B6FC 5DNMA 3MGSA 4WU8C 3O62B 3A6ND 3WAAD 2NZDD 1ID3A 5C3IC 3REJD 3AZHC 2IO5C 3VH6A 4CSRA 1M18B 1KX3B 4H9RA 3LELC 3AZNB 4ZUXD 1M18D 1Q9CA 1M1AB 5GSUB 1KU5A 3X1TC 2BYMA 3UTAD 3LELA 4CSRB 2CV5D 3X1SA 3REIC 2YFWA 3MNNB 1KX3A 1P3IA 4H9RB 1B67A 1M19D 4WV4B 1M1AA 1M18C 3NQJA 2BYMB 1KX5B 2NZDA 3AZEC 3MGPA 2YFWB 5AVCA 3MNNA 1P3FC 2F8NK 4H9OB 5CPIC 2NQBA 1HTAA 5B33C 4WU8D 2PYOB 3MGPB 5AV6B 5CPIA 5AVCB 3AV1C 3KWQC 4JJNA 3A6NA 2AROD 3MVDC 4QLCC 5GXQD 1N1JB 2PYOA 1U35D 5CPIB 3C1BD 5CPKD 1P3KC 3A6NB 5AV6C 5B40A 1N1JA 5CHLB 2HUEB 4KUDC 1M1AD 2JSSA 3REHC 2AROC 1ID3C 3AZJD 4Z66D 3AZEB 3AZHA 3X1TB 1TZYD 4Z2MH 2AROA 1P3KB 3KUYB 1TAFB 1WWSA 2HIOA 5JRGB 3MGPD 5AV9D 4H9SA 3AV2A 5KDMA 3REKC 3W99A 3C1CA 5B1MD 3AZEA 5AVCC 3AV1B 3KWQB 1P3MC 3REHB 3KUYA 1TAFA 1EQZD 3B0CT 5JRGA
chains in the Genus database with same CATH superfamily
2Y2JA 3AV2B 3AN2B 5KDMB 3AZJC 5G49B 3W96C 4E44A 5BS7C 3B0CW 3MVDB 3C1CB 3AZLA 5AV8B 3X1UB 3AZFA 3KUYC 5JRGC 3MGQD 3KWQA 3MGPC 2XD1A 3AZJA 3AZID 3AFAD 3AZFC 5CPKC 3WAAA 3A6NC 1U35C 3AN2A 4YM6B 3VH5A 3AZLB 5AV8A 3X1UA 3REJA 2RVQC 3IP4C 3VH6T 4H9PA 3MGSB 5B1LB 5AV8C 3LZ1D 1ID3B 1F66D 4YM6A 5B0ZA 3VH5T 3X1VC 3O62D 3AZIB 5B1LA 5AV9A 3AV2D 3WA9D 2IO5B 4J8UA 3AZNA 1M19A 3AZMD 2RVQD 3W97C 5GSUA 1P3OA 5B0ZB 3LELB 4DQYB 4EO5C 1P3MB 1EQZC 3WTPD 1KX4D 4XZQD 2FJ7C 5AVCD 4XUJD 5GSUC 5AV9B 3AV2C 5CPJA 2Y2LA 4J8UB 5AVBA 1ULYA 4AWLB 3KUYD 3C1CC 1EQZA 4ZBJC 3X1VB 3NQJB 3W97D 1P3OB 1TZYB 2FJ7A 1KX5A 1P3MA 4NE5A 4DRBA 4J8WC 3W97B 2JE5A 3LZ1B 4H9OA 5B31G 3AN2D 3B6GD 2HIOC 5CPJB 1KX5C 5AVBB 4YS3D 3AZLC 4H9SC 1EQZB 1P3GC 5B32A 3REHD 1HQ3A 4J8XD 2FJ7B 4ZUXC 4H9QB 2Y2QA 3X1SD 4J8WA 3AV1D 4R8PD 3LJAD 5F99D 2NQBD 3C1BA 3LZ1A 1F66A 3REID 3P5JB 5AY8D 5B33B 5AV5C 3AZGC 1U35B 1P3KD 2CWEA 1HQ3B 1ZLAB 1S32D 3LZ1C 3AYWC 5BNVB 5B1LD 4Z2MG 5GT3A 5B31A 3C1BB 1F66B 4QLCB 2F2AC 5B33A 4LD9D 3AYWA 1U35A 5E5AC 4EO5B 3NQUA 3UTBD 5B40B 5BNVA 4XUJA 5B32D 2ZY5A 5GT3B 3WTPA 4AWLC 4QLCA 4J8VD 3AZKD 3WKJD 1TZYC 4Z66C 1BH9A 3NQUB 4KUDB 3X1TD 3W98A 4M6BA 4XUJB 2AROB 5B0YB 1P3KA 2HIOB 5CPJC 3MVDD 1P3MD 4Z66A 4KHAA 5E5AD 3MGRD 5B40C 4R8PA 1P3OC 4KUDA 3B6FD 3W98B 3REHA 1BH8A 5B0YA 1B6WA 4H9NA 4Z66B 5F99C 3AZED 3TU4A 4NFTA 4KHAB 5G49A 1HQ3C 3VH6W 4WU9D 5B0YC 5B2JB 2Y2MA 3KSYA 1H3OB 1P34C 3AZJB 1AOID 3W96B 3H0MC 3WAAB 3LZ0D 3TU4B 5AV5B 3AZGB 2L5AA 4YM6D 4CAYB 3REJB 5B32C 1ZLAC 5CPKB 4G91C 4H9PB 1A7WA 3W96A 5BS7A 1P34D 5CP6A 5GXQB 2Y2GA 1P3BD 1F66C 3AZND 5B0YD 3KXBC 2RIQA 5AV5A 3AZGA 4CAYA 1KX3D 5E5AB 4Z5TC 3WAAC 5CPKA 3AZIA 3B0BA 2ZM5A 3WTPC 2F8ND 3WA9C 5GT3C 5B24A 3REJC 1R4VA 1M19B 5AY8C 5BT1C 5DNNC 5B40D 3MGRC 4JJND 3AZIC 3WA9A 5E5AA 3W98C 4J8UD 5GSUD 4XUJC 4XZQB 3LZ0B 3TU4D 5B24B 5B0ZC 2CV5C 1JFIA 3X1VA 5GT0C 4KGCB 3REKD 1TZYA 5AV9C 1HQ3D 2Y2KA 1P3GD 1P34B 1AOIA 4J8UC 1M19C 2F8NG 3MNND 3H0RC 4X23B 3W97A 3LJAA 4ZBJB 3LZ0A 3B6GC 3UT9B 3TU4C 5BO0A 3UTAB 2YFVB 4E45A 4J8VC 4DRAA 5B32B 1P3FD 4H9QA 4J8WB 3LZ0C 3B0DB 4J8XB 5B2JC 4G92C 3B6GA 4WZSB 1P34A 2CV5B 3A1KA 5AVBC 4X23D 1AOIB 3W96D 5CPID 5CPJD 1P3GB 5BO0B 4ZUXB 2YFVA 3WTPE 2BYKA 1ZLAA 1Z2CB 1S32B 5B2JD 2F8NA 4G91B 5CP6C 3WKJB 5B31B 1P3GA 5AY8B 5JA4B 5GXQC 5DNND 4ZUXA 5B2IB 3AYWB 5B1MC 5AV8D 3MGRB 3AZKA 3UTBC 3C1BC 2HIOD 2G5HC 5C3IB 4UUZA 3EPLA 5B24C 3REIA 3UTBA 3WTPB 5AY8A 5JA4A 1P3IC 5B2IA 5B0ZD 3MGRA 3AZKB 3AZMC 1BH9B 5DNNB 5B31C 5DNMD 1M18A 3AZHD 1M1AC 4UUZB 5JRGD 4KUDD 5B2IC 3RELB 3UT9C 2NZDC 2ZY2A 3AZMA 3REIB 3UTBB 3MNNC 4J8VB 4WNNA 3VH5W 1P3LC 3W99D 3MGQA 4R8PB 4KGCC 5DNNA 4UPKA 3X1SB 4LD9C 3AFAA 1P3IB 1BH8B 1P3AD 1P3PB 3RELA 1P3LA 5AVBD 4X23C 3AZMB 4H9NB 4QLCD 4J8VA 4WU9C 4WNNB 3UTAC 4HGAB 1W2EA 3MGQB 3AZLD 4YS3C 3RELC 2NZDB 5B2JA 3FDDA 3UT9D 5F99B 3AFAB 3WKJC 1H3OA 1AOIC 1ZLAD 1P3PA 1P3LB 3LJAC 4YS3A 4R8PC 5CP6D 1F1EA 2NQBB 3EG5B 5FUGB 1P3PC 3R45B 4NE3A 3KXBD 5AV6A 5F99A 1S32C 2FJ7D 1KX4C 2LY8A 4Z5TD 2DF4C 5CP6B 5GXQA 2PYOD 4YS3B 1T3UA 1P3OD 4JJNB 1P3AA 5B1MB 5FUGA 1KX4A 5BT1D 3R45A 5B2ID 1P3BA 1BFMA 1WWIA 3A1IA 5GT3D 5B31D 5DNMC 2F8NH 3KXBB 2HUEC 1KX5D 1P3AB 1P3PD 4Z5TB 4NE6A 5B1MA 3X1SC 2ZY3A 3AZKC 1KX4B 4LD9B 3WA9B 3W99C 3REKA 1P3BB 5GT0D 1P3LD 2J8PA 4XZQA 3KXBA 2Y2OA 1JFIB 3RELD 3MGQC 5AV5D 4Z5TA 3AZGD 1ID3D 2Y2PA 4KGCA 5B33D 3EPKA 4XZQC 3AZHB 3X1TA 4LD9A 3REKB 3AFAC 1P3FA 3C1CD 2UWXA 1KX3C 4X23A 3LJAB 5B24D 5GT0B 3UT9A 3UTAA 3W99B 5BNXA 4WU9B 3MGSD 1P3ID 4HGAC 2Y2IA 3AN2C 4J8XA 3B6GB 4J8WD 3AV1A 1P3FB 2BG1A 2CV5A 3X1UC 3V9RB 3AL0C 5B32G 3B6FB 3W98D 5GT0A 5AV6D 4JJNC 4WU8B 4J8XC 3O62C 3B0DC 4G92B 3MVDA 5BNXB 3X1VD 4WU9A 3AZFB 2BYKB 2NQBC 2PYOC 4YM6C 1S32A 5DNMB 3KFUG 2F8NB 4KGCD 3O62A 3V9RA 3X1UD 3H0LC 3WKJA 3B6FA 3LELD 1P3AC 4WU8A 3MGSC 5B1LC 3AZFD 3AYWD 3AZNC 1P3BC 2DQNC 3KWQD 3B6FC 5DNMA 3MGSA 4WU8C 3O62B 3A6ND 3WAAD 2NZDD 1ID3A 5C3IC 3REJD 3AZHC 2IO5C 3VH6A 4CSRA 1M18B 1KX3B 4H9RA 3LELC 3AZNB 2VQRA 4ZUXD 1Q9CA 1M18D 1M1AB 5GSUB 1KU5A 3X1TC 2BYMA 3UTAD 3LELA 4CSRB 2CV5D 3X1SA 3REIC 2YFWA 3MNNB 1KX3A 1P3IA 4H9RB 1B67A 1M19D 2ZY4A 4WV4B 2JCHA 1M1AA 1M18C 3NQJA 2BYMB 1KX5B 4WJ3C 2NZDA 3AZEC 3MGPA 2YFWB 5AVCA 3MNNA 1P3FC 2F8NK 4H9OB 5CPIC 2NQBA 1HTAA 5B33C 4WU8D 2PYOB 3MGPB 5AV6B 2W8SA 2XD5A 5CPIA 5AVCB 3AV1C 3KWQC 1PZRA 4JJNA 3A6NA 2AROD 3MVDC 4QLCC 5GXQD 1N1JB 2PYOA 1U35D 5CPIB 3C1BD 5CPKD 2FFFB 1P3KC 3A6NB 5AV6C 2Y2NA 5B40A 1N1JA 5CHLB 2Y2HA 2HUEB 4KUDC 1M1AD 2JSSA 3REHC 2AROC 1ID3C 3AZJD 4Z66D 3AZEB 3AZHA 3X1TB 1TZYD 4Z2MH 2AROA 1P3KB 3KUYB 1TAFB 3F6TA 1WWSA 3EPJA 2G5IC 2HIOA 5JRGB 3MGPD 5AV9D 4H9SA 3AV2A 5KDMA 3REKC 3W99A 3C1CA 5B1MD 3AZEA 5AVCC 3AV1B 3KWQB 1P3MC 3REHB 3EPHA 3KUYA 1TAFA 1EQZD 3B0CT 5JRGA
chains in the Genus database with same CATH topology
2Y2JA 3AV2B 3AN2B 5KDMB 3AZJC 5G49B 3W96C 4E44A 5BS7C 3B0CW 3MVDB 3C1CB 3AZLA 5AV8B 3X1UB 3AZFA 3KUYC 5JRGC 3MGQD 3KWQA 3MGPC 2XD1A 3AZJA 3AZID 3AFAD 3AZFC 5CPKC 3WAAA 3A6NC 1U35C 3AN2A 4YM6B 3VH5A 3AZLB 5AV8A 3X1UA 3REJA 2RVQC 3IP4C 3VH6T 4H9PA 3MGSB 5B1LB 5AV8C 3LZ1D 1ID3B 1F66D 4YM6A 5B0ZA 3VH5T 3X1VC 3O62D 3AZIB 5B1LA 5AV9A 3AV2D 3WA9D 2IO5B 4J8UA 3AZNA 1M19A 3AZMD 2RVQD 3W97C 5GSUA 1P3OA 5B0ZB 3LELB 4DQYB 4EO5C 1P3MB 1EQZC 3WTPD 1KX4D 4XZQD 2FJ7C 5AVCD 4XUJD 5GSUC 5AV9B 3AV2C 5CPJA 2Y2LA 4J8UB 5AVBA 1ULYA 4AWLB 3KUYD 3C1CC 1EQZA 4ZBJC 3X1VB 3NQJB 3W97D 1P3OB 1TZYB 2FJ7A 1KX5A 1P3MA 4NE5A 4DRBA 4J8WC 3W97B 2JE5A 3LZ1B 4H9OA 5B31G 3AN2D 3B6GD 2HIOC 5CPJB 1KX5C 5AVBB 4YS3D 3AZLC 4H9SC 1EQZB 1P3GC 5B32A 3REHD 1HQ3A 4J8XD 2FJ7B 4ZUXC 4H9QB 2Y2QA 3X1SD 4J8WA 3AV1D 4R8PD 3LJAD 5F99D 2NQBD 3C1BA 3LZ1A 1F66A 3REID 3P5JB 5AY8D 5B33B 5AV5C 3AZGC 1U35B 1P3KD 2CWEA 1HQ3B 1ZLAB 1S32D 3LZ1C 3AYWC 5BNVB 5B1LD 4Z2MG 5GT3A 5B31A 3C1BB 1F66B 4QLCB 2F2AC 5B33A 4LD9D 3AYWA 1U35A 5E5AC 4EO5B 3NQUA 3UTBD 5B40B 5BNVA 4XUJA 5B32D 2ZY5A 5GT3B 3WTPA 4AWLC 4QLCA 4J8VD 3AZKD 3WKJD 1TZYC 4Z66C 1BH9A 3NQUB 4KUDB 3X1TD 3W98A 4M6BA 4XUJB 2AROB 5B0YB 1P3KA 2HIOB 5CPJC 3MVDD 1P3MD 4Z66A 4KHAA 5E5AD 3MGRD 5B40C 4R8PA 1P3OC 4KUDA 3B6FD 3W98B 3REHA 1BH8A 5B0YA 1B6WA 4H9NA 4Z66B 5F99C 3AZED 3TU4A 4NFTA 4KHAB 5G49A 1HQ3C 3VH6W 4WU9D 5B0YC 5B2JB 2Y2MA 3KSYA 1H3OB 1P34C 3AZJB 1AOID 3W96B 3H0MC 3WAAB 3LZ0D 3TU4B 5AV5B 3AZGB 2L5AA 4YM6D 4CAYB 3REJB 5B32C 1ZLAC 5CPKB 4G91C 4H9PB 1A7WA 3W96A 5BS7A 1P34D 5CP6A 5GXQB 2Y2GA 1P3BD 1F66C 3AZND 5B0YD 3KXBC 2RIQA 5AV5A 3AZGA 4CAYA 1KX3D 5E5AB 4Z5TC 3WAAC 5CPKA 3AZIA 3B0BA 2ZM5A 3WTPC 2F8ND 3WA9C 5GT3C 5B24A 3REJC 1R4VA 1M19B 5AY8C 5BT1C 5DNNC 5B40D 3MGRC 4JJND 3AZIC 3WA9A 5E5AA 3W98C 4J8UD 5GSUD 4XUJC 4XZQB 3LZ0B 3TU4D 5B24B 5B0ZC 2CV5C 1JFIA 3X1VA 5GT0C 4KGCB 3REKD 1TZYA 5AV9C 1HQ3D 2Y2KA 1P3GD 1P34B 1AOIA 4J8UC 1M19C 2F8NG 3MNND 3H0RC 4X23B 3W97A 3LJAA 4ZBJB 3LZ0A 3B6GC 3UT9B 3TU4C 5BO0A 3UTAB 2YFVB 4E45A 4J8VC 4DRAA 5B32B 1P3FD 4H9QA 4J8WB 3LZ0C 3B0DB 4J8XB 5B2JC 4G92C 3B6GA 4WZSB 1P34A 2CV5B 3A1KA 5AVBC 4X23D 1AOIB 3W96D 5CPID 5CPJD 1P3GB 5BO0B 4ZUXB 2YFVA 3WTPE 2BYKA 1ZLAA 1Z2CB 1S32B 5B2JD 2F8NA 4G91B 5CP6C 3WKJB 5B31B 1P3GA 5AY8B 5JA4B 5GXQC 5DNND 4ZUXA 5B2IB 3AYWB 5B1MC 5AV8D 3MGRB 3AZKA 3UTBC 3C1BC 2HIOD 2G5HC 5C3IB 4UUZA 3EPLA 5B24C 3REIA 3UTBA 3WTPB 5AY8A 5JA4A 1P3IC 5B2IA 5B0ZD 3MGRA 3AZKB 3AZMC 1BH9B 5DNNB 5B31C 5DNMD 1M18A 3AZHD 1M1AC 4UUZB 5JRGD 4KUDD 5B2IC 3RELB 3UT9C 2NZDC 2ZY2A 3AZMA 3REIB 3UTBB 3MNNC 4J8VB 4WNNA 3VH5W 1P3LC 3W99D 3MGQA 4R8PB 4KGCC 5DNNA 4UPKA 3X1SB 4LD9C 3AFAA 1P3IB 1BH8B 1P3AD 1P3PB 3RELA 1P3LA 5AVBD 4X23C 3AZMB 4H9NB 4QLCD 4J8VA 4WU9C 4WNNB 3UTAC 4HGAB 1W2EA 3MGQB 3AZLD 4YS3C 3RELC 2NZDB 5B2JA 3FDDA 3UT9D 5F99B 3AFAB 3WKJC 1H3OA 1AOIC 1ZLAD 1P3PA 1P3LB 3LJAC 4YS3A 4R8PC 5CP6D 1F1EA 2NQBB 3EG5B 5FUGB 1P3PC 3R45B 4NE3A 3KXBD 5AV6A 5F99A 1S32C 2FJ7D 1KX4C 2LY8A 4Z5TD 2DF4C 5CP6B 5GXQA 2PYOD 4YS3B 1T3UA 1P3OD 4JJNB 1P3AA 5B1MB 5FUGA 1KX4A 5BT1D 3R45A 5B2ID 1P3BA 1BFMA 1WWIA 3A1IA 5GT3D 5B31D 5DNMC 2F8NH 3KXBB 2HUEC 1KX5D 1P3AB 1P3PD 4Z5TB 4NE6A 5B1MA 3X1SC 2ZY3A 3AZKC 1KX4B 4LD9B 3WA9B 3W99C 3REKA 1P3BB 5GT0D 1P3LD 2J8PA 4XZQA 3KXBA 2Y2OA 1JFIB 3RELD 3MGQC 5AV5D 4Z5TA 3AZGD 1ID3D 2Y2PA 4KGCA 5B33D 3EPKA 4XZQC 3AZHB 3X1TA 4LD9A 3REKB 3AFAC 1P3FA 3C1CD 2UWXA 1KX3C 4X23A 3LJAB 5B24D 5GT0B 3UT9A 3UTAA 3W99B 5BNXA 4WU9B 3MGSD 1P3ID 4HGAC 2Y2IA 3AN2C 4J8XA 3B6GB 4J8WD 3AV1A 1P3FB 2BG1A 2CV5A 3X1UC 3V9RB 3AL0C 5B32G 3B6FB 3W98D 5GT0A 5AV6D 4JJNC 4WU8B 4J8XC 3O62C 3B0DC 4G92B 3MVDA 5BNXB 3X1VD 4WU9A 3AZFB 2BYKB 2NQBC 2PYOC 4YM6C 1S32A 5DNMB 3KFUG 2F8NB 4KGCD 3O62A 3V9RA 3X1UD 3H0LC 3WKJA 3B6FA 3LELD 1P3AC 4WU8A 3MGSC 5B1LC 3AZFD 3AYWD 3AZNC 1P3BC 2DQNC 3KWQD 3B6FC 5DNMA 3MGSA 4WU8C 3O62B 3A6ND 3WAAD 2NZDD 1ID3A 5C3IC 3REJD 3AZHC 2IO5C 3VH6A 4CSRA 1M18B 1KX3B 4H9RA 3LELC 3AZNB 2VQRA 4ZUXD 1Q9CA 1M18D 1M1AB 5GSUB 1KU5A 3X1TC 2BYMA 3UTAD 3LELA 4CSRB 2CV5D 3X1SA 3REIC 2YFWA 3MNNB 1KX3A 1P3IA 4H9RB 1B67A 1M19D 2ZY4A 4WV4B 2JCHA 1M1AA 1M18C 3NQJA 2BYMB 1KX5B 4WJ3C 2NZDA 3AZEC 3MGPA 2YFWB 5AVCA 3MNNA 1P3FC 2F8NK 4H9OB 5CPIC 2NQBA 1HTAA 5B33C 4WU8D 2PYOB 3MGPB 5AV6B 2W8SA 2XD5A 5CPIA 5AVCB 3AV1C 3KWQC 1PZRA 4JJNA 3A6NA 2AROD 3MVDC 4QLCC 5GXQD 1N1JB 2PYOA 1U35D 5CPIB 3C1BD 5CPKD 2FFFB 1P3KC 3A6NB 5AV6C 2Y2NA 5B40A 1N1JA 5CHLB 2Y2HA 2HUEB 4KUDC 1M1AD 2JSSA 3REHC 2AROC 1ID3C 3AZJD 4Z66D 3AZEB 3AZHA 3X1TB 1TZYD 4Z2MH 2AROA 1P3KB 3KUYB 1TAFB 3F6TA 1WWSA 3EPJA 2G5IC 2HIOA 5JRGB 3MGPD 5AV9D 4H9SA 3AV2A 5KDMA 3REKC 3W99A 3C1CA 5B1MD 3AZEA 5AVCC 3AV1B 3KWQB 1P3MC 3REHB 3EPHA 3KUYA 1TAFA 1EQZD 3B0CT 5JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 B;  3AN2 B;  5KDM B;  3AZJ C;  5G49 B;  3W96 C;  4E44 A;  5BS7 C;  3B0C W;  3MVD B;  3C1C B;  3AZL A;  5AV8 B;  3X1U B;  3AZF A;  3KUY C;  5JRG C;  3MGQ D;  3KWQ A;  3MGP C;  3AZJ A;  3AZI D;  3AFA D;  3AZF C;  5CPK C;  3WAA A;  3A6N C;  1U35 C;  3AN2 A;  4YM6 B;  3VH5 A;  3AZL B;  5AV8 A;  3X1U A;  3REJ A;  2RVQ C;  3VH6 T;  4H9P A;  3MGS B;  5B1L B;  5AV8 C;  3LZ1 D;  1ID3 B;  1F66 D;  4YM6 A;  5B0Z A;  3VH5 T;  3X1V C;  3O62 D;  3AZI B;  5B1L A;  5AV9 A;  3AV2 D;  3WA9 D;  2IO5 B;  4J8U A;  3AZN A;  1M19 A;  3AZM D;  2RVQ D;  3W97 C;  5GSU A;  1P3O A;  5B0Z B;  3LEL B;  4EO5 C;  1P3M B;  1EQZ C;  3WTP D;  1KX4 D;  4XZQ D;  2FJ7 C;  5AVC D;  4XUJ D;  5GSU C;  5AV9 B;  3AV2 C;  5CPJ A;  4J8U B;  5AVB A;  1ULY A;  4AWL B;  3KUY D;  3C1C C;  1EQZ A;  4ZBJ C;  3X1V B;  3NQJ B;  3W97 D;  1P3O B;  1TZY B;  2FJ7 A;  1KX5 A;  1P3M A;  4NE5 A;  4DRB A;  4J8W C;  3W97 B;  3LZ1 B;  4H9O A;  5B31 G;  3AN2 D;  3B6G D;  2HIO C;  5CPJ B;  1KX5 C;  5AVB B;  4YS3 D;  3AZL C;  4H9S C;  1EQZ B;  1P3G C;  5B32 A;  3REH D;  1HQ3 A;  4J8X D;  2FJ7 B;  4ZUX C;  4H9Q B;  3X1S D;  4J8W A;  3AV1 D;  4R8P D;  3LJA D;  5F99 D;  2NQB D;  3C1B A;  3LZ1 A;  1F66 A;  3REI D;  5AY8 D;  5B33 B;  5AV5 C;  3AZG C;  1U35 B;  1P3K D;  2CWE A;  1HQ3 B;  1ZLA B;  1S32 D;  3LZ1 C;  3AYW C;  5BNV B;  5B1L D;  4Z2M G;  5GT3 A;  5B31 A;  3C1B B;  1F66 B;  4QLC B;  5B33 A;  4LD9 D;  3AYW A;  1U35 A;  5E5A C;  4EO5 B;  3NQU A;  3UTB D;  5B40 B;  5BNV A;  4XUJ A;  5B32 D;  5GT3 B;  3WTP A;  4AWL C;  4QLC A;  4J8V D;  3AZK D;  3WKJ D;  1TZY C;  4Z66 C;  1BH9 A;  3NQU B;  4KUD B;  3X1T D;  3W98 A;  4M6B A;  4XUJ B;  2ARO B;  5B0Y B;  1P3K A;  2HIO B;  5CPJ C;  3MVD D;  1P3M D;  4Z66 A;  4KHA A;  5E5A D;  3MGR D;  5B40 C;  4R8P A;  1P3O C;  4KUD A;  3B6F D;  3W98 B;  3REH A;  1BH8 A;  5B0Y A;  1B6W A;  4H9N A;  4Z66 B;  5F99 C;  3AZE D;  3TU4 A;  4NFT A;  4KHA B;  5G49 A;  1HQ3 C;  3VH6 W;  4WU9 D;  5B0Y C;  5B2J B;  3KSY A;  1H3O B;  1P34 C;  3AZJ B;  1AOI D;  3W96 B;  3WAA B;  3LZ0 D;  3TU4 B;  5AV5 B;  3AZG B;  2L5A A;  4YM6 D;  4CAY B;  3REJ B;  5B32 C;  1ZLA C;  5CPK B;  4G91 C;  4H9P B;  1A7W A;  3W96 A;  5BS7 A;  1P34 D;  5CP6 A;  5GXQ B;  1P3B D;  1F66 C;  3AZN D;  5B0Y D;  3KXB C;  5AV5 A;  3AZG A;  4CAY A;  1KX3 D;  5E5A B;  4Z5T C;  3WAA C;  5CPK A;  3AZI A;  3B0B A;  3WA9 C;  3WTP C;  2F8N D;  5GT3 C;  5B24 A;  3REJ C;  1R4V A;  1M19 B;  5AY8 C;  5BT1 C;  5DNN C;  5B40 D;  3MGR C;  4JJN D;  3AZI C;  3WA9 A;  5E5A A;  3W98 C;  4J8U D;  5GSU D;  4XUJ C;  4XZQ B;  3LZ0 B;  3TU4 D;  5B24 B;  5B0Z C;  2CV5 C;  1JFI A;  3X1V A;  5GT0 C;  4KGC B;  3REK D;  1TZY A;  5AV9 C;  1HQ3 D;  1P3G D;  1P34 B;  1AOI A;  4J8U C;  1M19 C;  2F8N G;  3MNN D;  4X23 B;  3LJA A;  3W97 A;  4ZBJ B;  3LZ0 A;  3B6G C;  3UT9 B;  3TU4 C;  5BO0 A;  3UTA B;  2YFV B;  4E45 A;  4J8V C;  4DRA A;  5B32 B;  1P3F D;  4H9Q A;  4J8W B;  3LZ0 C;  3B0D B;  4J8X B;  5B2J C;  4G92 C;  3B6G A;  4WZS B;  1P34 A;  2CV5 B;  1AOI B;  5AVB C;  4X23 D;  3W96 D;  5CPI D;  5CPJ D;  1P3G B;  5BO0 B;  4ZUX B;  2YFV A;  3WTP E;  2BYK A;  1ZLA A;  1S32 B;  5B2J D;  2F8N A;  4G91 B;  5CP6 C;  3WKJ B;  5B31 B;  1P3G A;  5AY8 B;  5JA4 B;  5GXQ C;  5DNN D;  4ZUX A;  5B2I B;  3AYW B;  5B1M C;  5AV8 D;  3MGR B;  3AZK A;  3UTB C;  3C1B C;  2HIO D;  5C3I B;  4UUZ A;  5B24 C;  3REI A;  3UTB A;  3WTP B;  5AY8 A;  5JA4 A;  1P3I C;  5B2I A;  5B0Z D;  3MGR A;  3AZK B;  3AZM C;  1BH9 B;  5DNN B;  5B31 C;  5DNM D;  1M18 A;  3AZH D;  1M1A C;  4UUZ B;  5JRG D;  4KUD D;  5B2I C;  3REL B;  3UT9 C;  2NZD C;  3AZM A;  3REI B;  3UTB B;  3MNN C;  4J8V B;  4WNN A;  3VH5 W;  1P3L C;  3W99 D;  3MGQ A;  4R8P B;  4KGC C;  5DNN A;  3X1S B;  4LD9 C;  3AFA A;  1P3I B;  1BH8 B;  1P3A D;  1P3P B;  3REL A;  1P3L A;  5AVB D;  4X23 C;  3AZM B;  4H9N B;  4QLC D;  4J8V A;  4WU9 C;  4WNN B;  3UTA C;  4HGA B;  3MGQ B;  3AZL D;  4YS3 C;  3REL C;  2NZD B;  5B2J A;  3UT9 D;  5F99 B;  3AFA B;  3WKJ C;  1H3O A;  1AOI C;  1ZLA D;  1P3P A;  1P3L B;  3LJA C;  4YS3 A;  4R8P C;  5CP6 D;  1F1E A;  2NQB B;  5FUG B;  1P3P C;  3R45 B;  4NE3 A;  3KXB D;  5AV6 A;  5F99 A;  1S32 C;  2FJ7 D;  1KX4 C;  2LY8 A;  4Z5T D;  5CP6 B;  5GXQ A;  2PYO D;  4YS3 B;  1P3O D;  4JJN B;  1P3A A;  5B1M B;  5FUG A;  1KX4 A;  5BT1 D;  3R45 A;  5B2I D;  1P3B A;  1BFM A;  1WWI A;  5GT3 D;  5B31 D;  5DNM C;  2F8N H;  3KXB B;  2HUE C;  1KX5 D;  1P3A B;  1P3P D;  4Z5T B;  4NE6 A;  5B1M A;  3X1S C;  3AZK C;  1KX4 B;  4LD9 B;  3WA9 B;  3W99 C;  3REK A;  1P3B B;  5GT0 D;  1P3L D;  4XZQ A;  3KXB A;  1JFI B;  3REL D;  3MGQ C;  5AV5 D;  4Z5T A;  3AZG D;  1ID3 D;  4KGC A;  5B33 D;  3AZH B;  4XZQ C;  3X1T A;  4LD9 A;  3REK B;  3AFA C;  1P3F A;  3C1C D;  1KX3 C;  4X23 A;  3LJA B;  5B24 D;  5GT0 B;  3UT9 A;  3UTA A;  3W99 B;  5BNX A;  4WU9 B;  3MGS D;  1P3I D;  4HGA C;  3AN2 C;  4J8X A;  3B6G B;  4J8W D;  3AV1 A;  1P3F B;  2CV5 A;  3X1U C;  3V9R B;  5B32 G;  3B6F B;  3W98 D;  5GT0 A;  5AV6 D;  4JJN C;  4WU8 B;  4J8X C;  3O62 C;  3B0D C;  4G92 B;  3MVD A;  5BNX B;  3X1V D;  4WU9 A;  3AZF B;  2BYK B;  2NQB C;  2PYO C;  4YM6 C;  1S32 A;  5DNM B;  2F8N B;  4KGC D;  3O62 A;  3V9R A;  3X1U D;  3WKJ A;  3B6F A;  3LEL D;  1P3A C;  4WU8 A;  3MGS C;  5B1L C;  3AZF D;  3AYW D;  3AZN C;  1P3B C;  3KWQ D;  3B6F C;  5DNM A;  3MGS A;  4WU8 C;  3O62 B;  3A6N D;  3WAA D;  2NZD D;  1ID3 A;  5C3I C;  3REJ D;  3AZH C;  2IO5 C;  3VH6 A;  4CSR A;  1M18 B;  1KX3 B;  4H9R A;  3LEL C;  3AZN B;  4ZUX D;  1M18 D;  1Q9C A;  1M1A B;  5GSU B;  1KU5 A;  3X1T C;  2BYM A;  3UTA D;  3LEL A;  4CSR B;  2CV5 D;  3X1S A;  3REI C;  2YFW A;  3MNN B;  1KX3 A;  1P3I A;  4H9R B;  1B67 A;  1M19 D;  4WV4 B;  1M1A A;  1M18 C;  3NQJ A;  2BYM B;  1KX5 B;  2NZD A;  3AZE C;  3MGP A;  2YFW B;  5AVC A;  3MNN A;  1P3F C;  2F8N K;  4H9O B;  5CPI C;  2NQB A;  1HTA A;  5B33 C;  4WU8 D;  2PYO B;  3MGP B;  5AV6 B;  5CPI A;  5AVC B;  3AV1 C;  3KWQ C;  4JJN A;  3A6N A;  2ARO D;  3MVD C;  4QLC C;  5GXQ D;  1N1J B;  2PYO A;  1U35 D;  5CPI B;  3C1B D;  5CPK D;  1P3K C;  3A6N B;  5AV6 C;  5B40 A;  1N1J A;  5CHL B;  2HUE B;  4KUD C;  1M1A D;  2JSS A;  3REH C;  2ARO C;  1ID3 C;  3AZJ D;  4Z66 D;  3AZE B;  3AZH A;  3X1T B;  1TZY D;  4Z2M H;  2ARO A;  1P3K B;  3KUY B;  1TAF B;  1WWS A;  2HIO A;  5JRG B;  3MGP D;  5AV9 D;  4H9S A;  3AV2 A;  5KDM A;  3REK C;  3W99 A;  3C1C A;  5B1M D;  3AZE A;  5AVC C;  3AV1 B;  3KWQ B;  1P3M C;  3REH B;  3KUY A;  1TAF A;  1EQZ D;  3B0C T;  5JRG A; 
#chains in the Genus database with same CATH topology
 2Y2J A;  3AV2 B;  3AN2 B;  5KDM B;  3AZJ C;  5G49 B;  3W96 C;  4E44 A;  5BS7 C;  3B0C W;  3MVD B;  3C1C B;  3AZL A;  5AV8 B;  3X1U B;  3AZF A;  3KUY C;  5JRG C;  3MGQ D;  3KWQ A;  3MGP C;  2XD1 A;  3AZJ A;  3AZI D;  3AFA D;  3AZF C;  5CPK C;  3WAA A;  3A6N C;  1U35 C;  3AN2 A;  4YM6 B;  3VH5 A;  3AZL B;  5AV8 A;  3X1U A;  3REJ A;  2RVQ C;  3IP4 C;  3VH6 T;  4H9P A;  3MGS B;  5B1L B;  5AV8 C;  3LZ1 D;  1ID3 B;  1F66 D;  4YM6 A;  5B0Z A;  3VH5 T;  3X1V C;  3O62 D;  3AZI B;  5B1L A;  5AV9 A;  3AV2 D;  3WA9 D;  2IO5 B;  4J8U A;  3AZN A;  1M19 A;  3AZM D;  2RVQ D;  3W97 C;  5GSU A;  1P3O A;  5B0Z B;  3LEL B;  4DQY B;  4EO5 C;  1P3M B;  1EQZ C;  3WTP D;  1KX4 D;  4XZQ D;  2FJ7 C;  5AVC D;  4XUJ D;  5GSU C;  5AV9 B;  3AV2 C;  5CPJ A;  2Y2L A;  4J8U B;  5AVB A;  1ULY A;  4AWL B;  3KUY D;  3C1C C;  1EQZ A;  4ZBJ C;  3X1V B;  3NQJ B;  3W97 D;  1P3O B;  1TZY B;  2FJ7 A;  1KX5 A;  1P3M A;  4NE5 A;  4DRB A;  4J8W C;  3W97 B;  2JE5 A;  3LZ1 B;  4H9O A;  5B31 G;  3AN2 D;  3B6G D;  2HIO C;  5CPJ B;  1KX5 C;  5AVB B;  4YS3 D;  3AZL C;  4H9S C;  1EQZ B;  1P3G C;  5B32 A;  3REH D;  1HQ3 A;  4J8X D;  2FJ7 B;  4ZUX C;  4H9Q B;  2Y2Q A;  3X1S D;  4J8W A;  3AV1 D;  4R8P D;  3LJA D;  5F99 D;  2NQB D;  3C1B A;  3LZ1 A;  1F66 A;  3REI D;  3P5J B;  5AY8 D;  5B33 B;  5AV5 C;  3AZG C;  1U35 B;  1P3K D;  2CWE A;  1HQ3 B;  1ZLA B;  1S32 D;  3LZ1 C;  3AYW C;  5BNV B;  5B1L D;  4Z2M G;  5GT3 A;  5B31 A;  3C1B B;  1F66 B;  4QLC B;  2F2A C;  5B33 A;  4LD9 D;  3AYW A;  1U35 A;  5E5A C;  4EO5 B;  3NQU A;  3UTB D;  5B40 B;  5BNV A;  4XUJ A;  5B32 D;  2ZY5 A;  5GT3 B;  3WTP A;  4AWL C;  4QLC A;  4J8V D;  3AZK D;  3WKJ D;  1TZY C;  4Z66 C;  1BH9 A;  3NQU B;  4KUD B;  3X1T D;  3W98 A;  4M6B A;  4XUJ B;  2ARO B;  5B0Y B;  1P3K A;  2HIO B;  5CPJ C;  3MVD D;  1P3M D;  4Z66 A;  4KHA A;  5E5A D;  3MGR D;  5B40 C;  4R8P A;  1P3O C;  4KUD A;  3B6F D;  3W98 B;  3REH A;  1BH8 A;  5B0Y A;  1B6W A;  4H9N A;  4Z66 B;  5F99 C;  3AZE D;  3TU4 A;  4NFT A;  4KHA B;  5G49 A;  1HQ3 C;  3VH6 W;  4WU9 D;  5B0Y C;  5B2J B;  2Y2M A;  3KSY A;  1H3O B;  1P34 C;  3AZJ B;  1AOI D;  3W96 B;  3H0M C;  3WAA B;  3LZ0 D;  3TU4 B;  5AV5 B;  3AZG B;  2L5A A;  4YM6 D;  4CAY B;  3REJ B;  5B32 C;  1ZLA C;  5CPK B;  4G91 C;  4H9P B;  1A7W A;  3W96 A;  5BS7 A;  1P34 D;  5CP6 A;  5GXQ B;  2Y2G A;  1P3B D;  1F66 C;  3AZN D;  5B0Y D;  3KXB C;  2RIQ A;  5AV5 A;  3AZG A;  4CAY A;  1KX3 D;  5E5A B;  4Z5T C;  3WAA C;  5CPK A;  3AZI A;  3B0B A;  2ZM5 A;  3WTP C;  2F8N D;  3WA9 C;  5GT3 C;  5B24 A;  3REJ C;  1R4V A;  1M19 B;  5AY8 C;  5BT1 C;  5DNN C;  5B40 D;  3MGR C;  4JJN D;  3AZI C;  3WA9 A;  5E5A A;  3W98 C;  4J8U D;  5GSU D;  4XUJ C;  4XZQ B;  3LZ0 B;  3TU4 D;  5B24 B;  5B0Z C;  2CV5 C;  1JFI A;  3X1V A;  5GT0 C;  4KGC B;  3REK D;  1TZY A;  5AV9 C;  1HQ3 D;  2Y2K A;  1P3G D;  1P34 B;  1AOI A;  4J8U C;  1M19 C;  2F8N G;  3MNN D;  3H0R C;  4X23 B;  3W97 A;  3LJA A;  4ZBJ B;  3LZ0 A;  3B6G C;  3UT9 B;  3TU4 C;  5BO0 A;  3UTA B;  2YFV B;  4E45 A;  4J8V C;  4DRA A;  5B32 B;  1P3F D;  4H9Q A;  4J8W B;  3LZ0 C;  3B0D B;  4J8X B;  5B2J C;  4G92 C;  3B6G A;  4WZS B;  1P34 A;  2CV5 B;  3A1K A;  5AVB C;  4X23 D;  1AOI B;  3W96 D;  5CPI D;  5CPJ D;  1P3G B;  5BO0 B;  4ZUX B;  2YFV A;  3WTP E;  2BYK A;  1ZLA A;  1Z2C B;  1S32 B;  5B2J D;  2F8N A;  4G91 B;  5CP6 C;  3WKJ B;  5B31 B;  1P3G A;  5AY8 B;  5JA4 B;  5GXQ C;  5DNN D;  4ZUX A;  5B2I B;  3AYW B;  5B1M C;  5AV8 D;  3MGR B;  3AZK A;  3UTB C;  3C1B C;  2HIO D;  2G5H C;  5C3I B;  4UUZ A;  3EPL A;  5B24 C;  3REI A;  3UTB A;  3WTP B;  5AY8 A;  5JA4 A;  1P3I C;  5B2I A;  5B0Z D;  3MGR A;  3AZK B;  3AZM C;  1BH9 B;  5DNN B;  5B31 C;  5DNM D;  1M18 A;  3AZH D;  1M1A C;  4UUZ B;  5JRG D;  4KUD D;  5B2I C;  3REL B;  3UT9 C;  2NZD C;  2ZY2 A;  3AZM A;  3REI B;  3UTB B;  3MNN C;  4J8V B;  4WNN A;  3VH5 W;  1P3L C;  3W99 D;  3MGQ A;  4R8P B;  4KGC C;  5DNN A;  4UPK A;  3X1S B;  4LD9 C;  3AFA A;  1P3I B;  1BH8 B;  1P3A D;  1P3P B;  3REL A;  1P3L A;  5AVB D;  4X23 C;  3AZM B;  4H9N B;  4QLC D;  4J8V A;  4WU9 C;  4WNN B;  3UTA C;  4HGA B;  1W2E A;  3MGQ B;  3AZL D;  4YS3 C;  3REL C;  2NZD B;  5B2J A;  3FDD A;  3UT9 D;  5F99 B;  3AFA B;  3WKJ C;  1H3O A;  1AOI C;  1ZLA D;  1P3P A;  1P3L B;  3LJA C;  4YS3 A;  4R8P C;  5CP6 D;  1F1E A;  2NQB B;  3EG5 B;  5FUG B;  1P3P C;  3R45 B;  4NE3 A;  3KXB D;  5AV6 A;  5F99 A;  1S32 C;  2FJ7 D;  1KX4 C;  2LY8 A;  4Z5T D;  2DF4 C;  5CP6 B;  5GXQ A;  2PYO D;  4YS3 B;  1T3U A;  1P3O D;  4JJN B;  1P3A A;  5B1M B;  5FUG A;  1KX4 A;  5BT1 D;  3R45 A;  5B2I D;  1P3B A;  1BFM A;  1WWI A;  3A1I A;  5GT3 D;  5B31 D;  5DNM C;  2F8N H;  3KXB B;  2HUE C;  1KX5 D;  1P3A B;  1P3P D;  4Z5T B;  4NE6 A;  5B1M A;  3X1S C;  2ZY3 A;  3AZK C;  1KX4 B;  4LD9 B;  3WA9 B;  3W99 C;  3REK A;  1P3B B;  5GT0 D;  1P3L D;  2J8P A;  4XZQ A;  3KXB A;  2Y2O A;  1JFI B;  3REL D;  3MGQ C;  5AV5 D;  4Z5T A;  3AZG D;  1ID3 D;  2Y2P A;  4KGC A;  5B33 D;  3EPK A;  4XZQ C;  3AZH B;  3X1T A;  4LD9 A;  3REK B;  3AFA C;  1P3F A;  3C1C D;  2UWX A;  1KX3 C;  4X23 A;  3LJA B;  5B24 D;  5GT0 B;  3UT9 A;  3UTA A;  3W99 B;  5BNX A;  4WU9 B;  3MGS D;  1P3I D;  4HGA C;  2Y2I A;  3AN2 C;  4J8X A;  3B6G B;  4J8W D;  3AV1 A;  1P3F B;  2BG1 A;  2CV5 A;  3X1U C;  3V9R B;  3AL0 C;  5B32 G;  3B6F B;  3W98 D;  5GT0 A;  5AV6 D;  4JJN C;  4WU8 B;  4J8X C;  3O62 C;  3B0D C;  4G92 B;  3MVD A;  5BNX B;  3X1V D;  4WU9 A;  3AZF B;  2BYK B;  2NQB C;  2PYO C;  4YM6 C;  1S32 A;  5DNM B;  3KFU G;  2F8N B;  4KGC D;  3O62 A;  3V9R A;  3X1U D;  3H0L C;  3WKJ A;  3B6F A;  3LEL D;  1P3A C;  4WU8 A;  3MGS C;  5B1L C;  3AZF D;  3AYW D;  3AZN C;  1P3B C;  2DQN C;  3KWQ D;  3B6F C;  5DNM A;  3MGS A;  4WU8 C;  3O62 B;  3A6N D;  3WAA D;  2NZD D;  1ID3 A;  5C3I C;  3REJ D;  3AZH C;  2IO5 C;  3VH6 A;  4CSR A;  1M18 B;  1KX3 B;  4H9R A;  3LEL C;  3AZN B;  2VQR A;  4ZUX D;  1Q9C A;  1M18 D;  1M1A B;  5GSU B;  1KU5 A;  3X1T C;  2BYM A;  3UTA D;  3LEL A;  4CSR B;  2CV5 D;  3X1S A;  3REI C;  2YFW A;  3MNN B;  1KX3 A;  1P3I A;  4H9R B;  1B67 A;  1M19 D;  2ZY4 A;  4WV4 B;  2JCH A;  1M1A A;  1M18 C;  3NQJ A;  2BYM B;  1KX5 B;  4WJ3 C;  2NZD A;  3AZE C;  3MGP A;  2YFW B;  5AVC A;  3MNN A;  1P3F C;  2F8N K;  4H9O B;  5CPI C;  2NQB A;  1HTA A;  5B33 C;  4WU8 D;  2PYO B;  3MGP B;  5AV6 B;  2W8S A;  2XD5 A;  5CPI A;  5AVC B;  3AV1 C;  3KWQ C;  1PZR A;  4JJN A;  3A6N A;  2ARO D;  3MVD C;  4QLC C;  5GXQ D;  1N1J B;  2PYO A;  1U35 D;  5CPI B;  3C1B D;  5CPK D;  2FFF B;  1P3K C;  3A6N B;  5AV6 C;  2Y2N A;  5B40 A;  1N1J A;  5CHL B;  2Y2H A;  2HUE B;  4KUD C;  1M1A D;  2JSS A;  3REH C;  2ARO C;  1ID3 C;  3AZJ D;  4Z66 D;  3AZE B;  3AZH A;  3X1T B;  1TZY D;  4Z2M H;  2ARO A;  1P3K B;  3KUY B;  1TAF B;  3F6T A;  1WWS A;  3EPJ A;  2G5I C;  2HIO A;  5JRG B;  3MGP D;  5AV9 D;  4H9S A;  3AV2 A;  5KDM A;  3REK C;  3W99 A;  3C1C A;  5B1M D;  3AZE A;  5AVC C;  3AV1 B;  3KWQ B;  1P3M C;  3REH B;  3EPH A;  3KUY A;  1TAF A;  1EQZ D;  3B0C T;  5JRG A; 
#chains in the Genus database with same CATH homology
 2Y2J A;  3AV2 B;  3AN2 B;  5KDM B;  3AZJ C;  5G49 B;  3W96 C;  4E44 A;  5BS7 C;  3B0C W;  3MVD B;  3C1C B;  3AZL A;  5AV8 B;  3X1U B;  3AZF A;  3KUY C;  5JRG C;  3MGQ D;  3KWQ A;  3MGP C;  2XD1 A;  3AZJ A;  3AZI D;  3AFA D;  3AZF C;  5CPK C;  3WAA A;  3A6N C;  1U35 C;  3AN2 A;  4YM6 B;  3VH5 A;  3AZL B;  5AV8 A;  3X1U A;  3REJ A;  2RVQ C;  3IP4 C;  3VH6 T;  4H9P A;  3MGS B;  5B1L B;  5AV8 C;  3LZ1 D;  1ID3 B;  1F66 D;  4YM6 A;  5B0Z A;  3VH5 T;  3X1V C;  3O62 D;  3AZI B;  5B1L A;  5AV9 A;  3AV2 D;  3WA9 D;  2IO5 B;  4J8U A;  3AZN A;  1M19 A;  3AZM D;  2RVQ D;  3W97 C;  5GSU A;  1P3O A;  5B0Z B;  3LEL B;  4DQY B;  4EO5 C;  1P3M B;  1EQZ C;  3WTP D;  1KX4 D;  4XZQ D;  2FJ7 C;  5AVC D;  4XUJ D;  5GSU C;  5AV9 B;  3AV2 C;  5CPJ A;  2Y2L A;  4J8U B;  5AVB A;  1ULY A;  4AWL B;  3KUY D;  3C1C C;  1EQZ A;  4ZBJ C;  3X1V B;  3NQJ B;  3W97 D;  1P3O B;  1TZY B;  2FJ7 A;  1KX5 A;  1P3M A;  4NE5 A;  4DRB A;  4J8W C;  3W97 B;  2JE5 A;  3LZ1 B;  4H9O A;  5B31 G;  3AN2 D;  3B6G D;  2HIO C;  5CPJ B;  1KX5 C;  5AVB B;  4YS3 D;  3AZL C;  4H9S C;  1EQZ B;  1P3G C;  5B32 A;  3REH D;  1HQ3 A;  4J8X D;  2FJ7 B;  4ZUX C;  4H9Q B;  2Y2Q A;  3X1S D;  4J8W A;  3AV1 D;  4R8P D;  3LJA D;  5F99 D;  2NQB D;  3C1B A;  3LZ1 A;  1F66 A;  3REI D;  3P5J B;  5AY8 D;  5B33 B;  5AV5 C;  3AZG C;  1U35 B;  1P3K D;  2CWE A;  1HQ3 B;  1ZLA B;  1S32 D;  3LZ1 C;  3AYW C;  5BNV B;  5B1L D;  4Z2M G;  5GT3 A;  5B31 A;  3C1B B;  1F66 B;  4QLC B;  2F2A C;  5B33 A;  4LD9 D;  3AYW A;  1U35 A;  5E5A C;  4EO5 B;  3NQU A;  3UTB D;  5B40 B;  5BNV A;  4XUJ A;  5B32 D;  2ZY5 A;  5GT3 B;  3WTP A;  4AWL C;  4QLC A;  4J8V D;  3AZK D;  3WKJ D;  1TZY C;  4Z66 C;  1BH9 A;  3NQU B;  4KUD B;  3X1T D;  3W98 A;  4M6B A;  4XUJ B;  2ARO B;  5B0Y B;  1P3K A;  2HIO B;  5CPJ C;  3MVD D;  1P3M D;  4Z66 A;  4KHA A;  5E5A D;  3MGR D;  5B40 C;  4R8P A;  1P3O C;  4KUD A;  3B6F D;  3W98 B;  3REH A;  1BH8 A;  5B0Y A;  1B6W A;  4H9N A;  4Z66 B;  5F99 C;  3AZE D;  3TU4 A;  4NFT A;  4KHA B;  5G49 A;  1HQ3 C;  3VH6 W;  4WU9 D;  5B0Y C;  5B2J B;  2Y2M A;  3KSY A;  1H3O B;  1P34 C;  3AZJ B;  1AOI D;  3W96 B;  3H0M C;  3WAA B;  3LZ0 D;  3TU4 B;  5AV5 B;  3AZG B;  2L5A A;  4YM6 D;  4CAY B;  3REJ B;  5B32 C;  1ZLA C;  5CPK B;  4G91 C;  4H9P B;  1A7W A;  3W96 A;  5BS7 A;  1P34 D;  5CP6 A;  5GXQ B;  2Y2G A;  1P3B D;  1F66 C;  3AZN D;  5B0Y D;  3KXB C;  2RIQ A;  5AV5 A;  3AZG A;  4CAY A;  1KX3 D;  5E5A B;  4Z5T C;  3WAA C;  5CPK A;  3AZI A;  3B0B A;  2ZM5 A;  3WTP C;  2F8N D;  3WA9 C;  5GT3 C;  5B24 A;  3REJ C;  1R4V A;  1M19 B;  5AY8 C;  5BT1 C;  5DNN C;  5B40 D;  3MGR C;  4JJN D;  3AZI C;  3WA9 A;  5E5A A;  3W98 C;  4J8U D;  5GSU D;  4XUJ C;  4XZQ B;  3LZ0 B;  3TU4 D;  5B24 B;  5B0Z C;  2CV5 C;  1JFI A;  3X1V A;  5GT0 C;  4KGC B;  3REK D;  1TZY A;  5AV9 C;  1HQ3 D;  2Y2K A;  1P3G D;  1P34 B;  1AOI A;  4J8U C;  1M19 C;  2F8N G;  3MNN D;  3H0R C;  4X23 B;  3W97 A;  3LJA A;  4ZBJ B;  3LZ0 A;  3B6G C;  3UT9 B;  3TU4 C;  5BO0 A;  3UTA B;  2YFV B;  4E45 A;  4J8V C;  4DRA A;  5B32 B;  1P3F D;  4H9Q A;  4J8W B;  3LZ0 C;  3B0D B;  4J8X B;  5B2J C;  4G92 C;  3B6G A;  4WZS B;  1P34 A;  2CV5 B;  3A1K A;  5AVB C;  4X23 D;  1AOI B;  3W96 D;  5CPI D;  5CPJ D;  1P3G B;  5BO0 B;  4ZUX B;  2YFV A;  3WTP E;  2BYK A;  1ZLA A;  1Z2C B;  1S32 B;  5B2J D;  2F8N A;  4G91 B;  5CP6 C;  3WKJ B;  5B31 B;  1P3G A;  5AY8 B;  5JA4 B;  5GXQ C;  5DNN D;  4ZUX A;  5B2I B;  3AYW B;  5B1M C;  5AV8 D;  3MGR B;  3AZK A;  3UTB C;  3C1B C;  2HIO D;  2G5H C;  5C3I B;  4UUZ A;  3EPL A;  5B24 C;  3REI A;  3UTB A;  3WTP B;  5AY8 A;  5JA4 A;  1P3I C;  5B2I A;  5B0Z D;  3MGR A;  3AZK B;  3AZM C;  1BH9 B;  5DNN B;  5B31 C;  5DNM D;  1M18 A;  3AZH D;  1M1A C;  4UUZ B;  5JRG D;  4KUD D;  5B2I C;  3REL B;  3UT9 C;  2NZD C;  2ZY2 A;  3AZM A;  3REI B;  3UTB B;  3MNN C;  4J8V B;  4WNN A;  3VH5 W;  1P3L C;  3W99 D;  3MGQ A;  4R8P B;  4KGC C;  5DNN A;  4UPK A;  3X1S B;  4LD9 C;  3AFA A;  1P3I B;  1BH8 B;  1P3A D;  1P3P B;  3REL A;  1P3L A;  5AVB D;  4X23 C;  3AZM B;  4H9N B;  4QLC D;  4J8V A;  4WU9 C;  4WNN B;  3UTA C;  4HGA B;  1W2E A;  3MGQ B;  3AZL D;  4YS3 C;  3REL C;  2NZD B;  5B2J A;  3FDD A;  3UT9 D;  5F99 B;  3AFA B;  3WKJ C;  1H3O A;  1AOI C;  1ZLA D;  1P3P A;  1P3L B;  3LJA C;  4YS3 A;  4R8P C;  5CP6 D;  1F1E A;  2NQB B;  3EG5 B;  5FUG B;  1P3P C;  3R45 B;  4NE3 A;  3KXB D;  5AV6 A;  5F99 A;  1S32 C;  2FJ7 D;  1KX4 C;  2LY8 A;  4Z5T D;  2DF4 C;  5CP6 B;  5GXQ A;  2PYO D;  4YS3 B;  1T3U A;  1P3O D;  4JJN B;  1P3A A;  5B1M B;  5FUG A;  1KX4 A;  5BT1 D;  3R45 A;  5B2I D;  1P3B A;  1BFM A;  1WWI A;  3A1I A;  5GT3 D;  5B31 D;  5DNM C;  2F8N H;  3KXB B;  2HUE C;  1KX5 D;  1P3A B;  1P3P D;  4Z5T B;  4NE6 A;  5B1M A;  3X1S C;  2ZY3 A;  3AZK C;  1KX4 B;  4LD9 B;  3WA9 B;  3W99 C;  3REK A;  1P3B B;  5GT0 D;  1P3L D;  2J8P A;  4XZQ A;  3KXB A;  2Y2O A;  1JFI B;  3REL D;  3MGQ C;  5AV5 D;  4Z5T A;  3AZG D;  1ID3 D;  2Y2P A;  4KGC A;  5B33 D;  3EPK A;  4XZQ C;  3AZH B;  3X1T A;  4LD9 A;  3REK B;  3AFA C;  1P3F A;  3C1C D;  2UWX A;  1KX3 C;  4X23 A;  3LJA B;  5B24 D;  5GT0 B;  3UT9 A;  3UTA A;  3W99 B;  5BNX A;  4WU9 B;  3MGS D;  1P3I D;  4HGA C;  2Y2I A;  3AN2 C;  4J8X A;  3B6G B;  4J8W D;  3AV1 A;  1P3F B;  2BG1 A;  2CV5 A;  3X1U C;  3V9R B;  3AL0 C;  5B32 G;  3B6F B;  3W98 D;  5GT0 A;  5AV6 D;  4JJN C;  4WU8 B;  4J8X C;  3O62 C;  3B0D C;  4G92 B;  3MVD A;  5BNX B;  3X1V D;  4WU9 A;  3AZF B;  2BYK B;  2NQB C;  2PYO C;  4YM6 C;  1S32 A;  5DNM B;  3KFU G;  2F8N B;  4KGC D;  3O62 A;  3V9R A;  3X1U D;  3H0L C;  3WKJ A;  3B6F A;  3LEL D;  1P3A C;  4WU8 A;  3MGS C;  5B1L C;  3AZF D;  3AYW D;  3AZN C;  1P3B C;  2DQN C;  3KWQ D;  3B6F C;  5DNM A;  3MGS A;  4WU8 C;  3O62 B;  3A6N D;  3WAA D;  2NZD D;  1ID3 A;  5C3I C;  3REJ D;  3AZH C;  2IO5 C;  3VH6 A;  4CSR A;  1M18 B;  1KX3 B;  4H9R A;  3LEL C;  3AZN B;  2VQR A;  4ZUX D;  1Q9C A;  1M18 D;  1M1A B;  5GSU B;  1KU5 A;  3X1T C;  2BYM A;  3UTA D;  3LEL A;  4CSR B;  2CV5 D;  3X1S A;  3REI C;  2YFW A;  3MNN B;  1KX3 A;  1P3I A;  4H9R B;  1B67 A;  1M19 D;  2ZY4 A;  4WV4 B;  2JCH A;  1M1A A;  1M18 C;  3NQJ A;  2BYM B;  1KX5 B;  4WJ3 C;  2NZD A;  3AZE C;  3MGP A;  2YFW B;  5AVC A;  3MNN A;  1P3F C;  2F8N K;  4H9O B;  5CPI C;  2NQB A;  1HTA A;  5B33 C;  4WU8 D;  2PYO B;  3MGP B;  5AV6 B;  2W8S A;  2XD5 A;  5CPI A;  5AVC B;  3AV1 C;  3KWQ C;  1PZR A;  4JJN A;  3A6N A;  2ARO D;  3MVD C;  4QLC C;  5GXQ D;  1N1J B;  2PYO A;  1U35 D;  5CPI B;  3C1B D;  5CPK D;  2FFF B;  1P3K C;  3A6N B;  5AV6 C;  2Y2N A;  5B40 A;  1N1J A;  5CHL B;  2Y2H A;  2HUE B;  4KUD C;  1M1A D;  2JSS A;  3REH C;  2ARO C;  1ID3 C;  3AZJ D;  4Z66 D;  3AZE B;  3AZH A;  3X1T B;  1TZY D;  4Z2M H;  2ARO A;  1P3K B;  3KUY B;  1TAF B;  3F6T A;  1WWS A;  3EPJ A;  2G5I C;  2HIO A;  5JRG B;  3MGP D;  5AV9 D;  4H9S A;  3AV2 A;  5KDM A;  3REK C;  3W99 A;  3C1C A;  5B1M D;  3AZE A;  5AVC C;  3AV1 B;  3KWQ B;  1P3M C;  3REH B;  3EPH A;  3KUY A;  1TAF A;  1EQZ D;  3B0C T;  5JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...