4H9QA

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9qA00
4EO5C 3AN2C 4ZBJC 5CPIA 5B1MB 3A6NB 4KUDD 3REIB 3MNNC 2HUEB 1B67A 1KX4D 4H9SA 1S32B 3C1CD 4YM6D 1M1AD 4LD9D 1BH9B 3AZLC 3X1SC 3B6FA 5CPKC 5BNXB 4AWLB 5GT3C 3WA9C 5AY8A 4XUJB 3MNND 4J8XB 1M18C 1F66A 3W99B 3AZIC 3KUYD 5B31B 1P3PB 1KX3B 3AZHB 2NQBD 3X1UC 1P34B 5AVCA 1P3MC 1P3GA 1EQZA 3AZLD 3X1SD 4WU8D 5GT3D 3W99C 3X1VC 4E45A 3C1BC 3AZHC 3WKJA 3MGSC 4J8UD 2RVQC 5G49B 3MGRC 3X1UD 3B0CT 4NE3A 3REHA 4KGCB 3UTAA 3UT9A 3AZJA 3WTPE 2YFVB 5DNNA 5BNVA 2YFWA 4H9OB 5CP6A 3C1BD 1AOIA 3VH5W 4Z66D 5AV8D 4WV4B 3MVDC 1JFIB 2RVQD 1M19C 3MGRD 4H9RA 3REKB 5C3IB 1BH8A 1U35B 1P3ID 1R4VA 3UTBA 3W98A 1TAFB 4CSRB 5B40C 2CV5C 3LJAC 3REKC 3AV1C 1Q9CA 1M19D 5GT0B 1WWIA 4DRAA 5B2IA 5F99B 3AZMB 4NE6A 2CV5D 2FJ7D 1P3BB 5B1MA 3A6NA 3AZFB 5B32D 3REIA 4XZQD 3KXBC 2L5AA 3TU4C 1S32A 5AV5B 3AZKB 3B6GC 4Z5TB 3VH6A 5BNXA 3X1TC 5B2JC 2LY8A 4XUJA 1ZLAB 4J8XA 3LZ0D 4X23B 3AZGD 5B31A 3AZKC 1P3PA 1KX3A 3LZ1D 5E5AD 4G92C 1P34A 2JSSA 5B33C 2BYMB 2NZDB 1P3AC 1ID3B 3MGPD 5BS7A 1P3OB 2HIOC 4JJNA 3AZEC 5DNMB 1P3LB 1P3KB 3W97A 5B24C 5G49A 5FUGB 3AZNC 4QLCB 1HQ3C 4KGCA 1P3OC 5JRGC 5GSUD 3NQJA 1P3KC 4H9OA 3RELB 5KDMA 2IO5C 3LELB 5B0YB 3AV2B 5B1LB 1P3FC 4R8PD 4H9PB 3AFAB 5AV9D 3REJD 1U35A 4H9NB 3KWQC 1H3OA 5CPID 4CSRA 5BO0B 5JRGD 4E44A 1TZYB 5B0ZB 1KX5C 3W96B 5BT1D 3VH6W 5GT0A 4YS3B 5F99A 4YM6B 1M1AB 4EO5B 3AZMA 2PYOC 4KUDC 3B0DB 4ZBJB 4UUZB 1P3BA 1KX5D 1KX4C 1F66D 3MNNB 3AZFA 3C1CC 1M1AC 3VH5A 4LD9C 1P3GD 3B0DC 5AVCD 4WZSB 1EQZD 5AV5A 2PYOD 3AZLB 3X1SB 5AV6A 5CPKB 5GT3B 4Z5TA 3WA9B 3KUYC 3WKJD 1M18B 3AZIB 1ZLAA 2NQBC 4H9QA 4WU8C 3UTAD 3X1UB 3UT9D 2AROA 3AZJD 1P3MB 2F8ND 3UTBC 5DNND 4J8WC 5CP6D 2BYMA 3B0BA 3X1VB 1AOID 4J8UC 2NZDA 1ID3A 3C1BB 3MGSB 5AVBA 1N1JB 5CPJA 1P3LA 3MGRB 4KHAB 5FUGA 3UTBD 4QLCA 4J8WD 4Z66C 5AV8C 3AYWA 3WAAC 3B0CW 3RELA 3MVDB 1P3IC 1M19B 3LELA 3AV2A 5B1LA 5B2ID 3AFAA 4H9PA 4HGAB 3WTPC 4H9NA 5B40B 2CV5B 3WAAD 5BO0A 5B1MD 3A6ND 3LJAB 3AV1B 3REID 1TZYA 5B0ZA 4HGAC 3W96A 1S32D 3WTPD 2FJ7C 4YS3A 4YM6A 3AN2A 5B32C 4XZQC 3O62C 4XUJD 4J8XD 3MNNA 3KXBB 3MGQC 3TU4B 1P3PD 1KX3D 1BFMA 5E5AB 4NFTA 3B6GB 3AZLA 3X1SA 3O62D 5CPKA 3X1TB 5GT3A 5B2JB 3LZ0C 3WA9A 3AZGC 3MGQD 4JJND 3LZ1C 5E5AC 1M18A 3AZIA 3W97D 4Z2MG 1BH9A 4G92B 4KGCD 3X1UA 1P3MA 5B33B 3MGPC 3NQUB 1P3AB 3W99A 4WU9C 3X1VA 3C1BA 3AZHA 2HIOB 4J8VC 3MGSA 3AZEB 2F8NG 1N1JA 4ZUXC 5B24B 3MGRA 4KHAA 5AV9B 3AZNB 1HQ3B 5GSUC 4WU9D 5JRGB 5GXQC 4R8PC 2IO5B 4J8VD 5AV9C 3MVDA 3REJC 4ZUXD 1M19A 1P3FB 5F99D 3V9RB 2YFVA 4G91B 5CPIC 3KWQB 3AZMD 5B40A 5GXQD 2CV5A 1JFIA 1A7WA 5BT1C 3LJAA 4H9SC 3REKA 3AV1A 1KX5B 4G91C 3KSYA 3B6FC 1TAFA 5AV5D 1P3GB 1EQZB 5AV6D 5AY8C 2PYOB 4KUDB 4Z5TD 1B6WA 1F66C 1KX4B 3C1CB 1ZLAD 1P3GC 5CHLB 5AVCC 1EQZC 3KXBA 3B6FD 4LD9B 1WWSA 3TU4A 2AROD 2F8NB 5AY8D 3B6GA 3WKJC 5BNVB 2YFWB 3X1TA 3KUYB 3AYWC 5B2JA 3REHC 4DRBA 5AVBD 5CPJD 3UTAC 3UT9C 3AZJC 1P3LD 2NQBB 4H9RB 4WU8B 1BH8B 3AZKA 5DNNC 5B32G 4QLCD 5CP6C 3UTBB 1AOIC 5B33A 4J8WB 3NQUA 3AYWD 1P3AA 4J8UB 3REHD 4X23A 3LELD 3AV2D 5B1LD 2HIOA 3AZEA 3W98C 5B24A 1HTAA 3AZNA 1HQ3A 4Z66B 1P3OA 5AV8B 3WAAB 5JRGA 1P3KA 1TZYD 5DNMA 5B0ZD 5B2IC 4Z2MH 1P3IB 3W98D 3W96D 4CAYB 1P3FA 3WTPB 4YS3D 3V9RA 3KWQA 5B1MC 3A6NC 3AN2D 3REIC 2HUEC 5B0YA 1S32C 2F8NH 1KX5A 2FJ7B 4AWLC 2BYKB 5CPKD 4XUJC 2PYOA 5B32B 4KUDA 4XZQB 3O62B 4J8XC 3WA9D 5JA4B 5B31C 1P3PC 3R45B 1KX3C 1M18D 1KX4A 3C1CA 3MGQB 4JJNB 3AZID 1P34C 1M1AA 3W97B 4LD9A 1P3MD 4UUZA 2F8NA 5BS7C 3REJA 3W99D 4JJNC 3X1VD 3NQJB 5B31D 3LZ0B 3W97C 5KDMB 3KUYA 3AZHD 3AZGB 3MGSD 3LZ1B 1P34D 3VH5T 4KGCC 2NQBA 4M6BA 4WU8A 1H3OB 3MGPB 4J8WA 4WU9B 4J8UA 3MVDD 5C3IC 1U35C 4J8VB 2CWEA 4ZUXB 5GSUB 5B40D 4Z66A 4WNNB 5AV8A 3LJAD 5GXQB 5GT0C 3REKD 3AV1D 3WAAA 1U35D 4R8PB 5F99C 3REJB 1P3IA 4CAYA 3AZMC 5CPIB 3WTPA 1P3BC 5AV6B 3AZFC 5GT0D 3KXBD 5AV5C 3TU4D 4H9QB 3B6FB 5AV6C 2AROB 4NE5A 4Z5TC 2FJ7A 1P3BD 3B6GD 5AY8B 2BYKA 3AZFD 1F66B 5B32A 3X1TD 1ZLAC 1F1EA 5B2JD 4XZQA 3O62A 2F8NK 5JA4A 4X23C 2AROC 3R45A 5AVCB 5AVBB 3MGQA 5CPJB 3AZKD 2NZDC 1ID3C 5B33D 3WKJB 1P3AD 5AVBC 3AYWB 4X23D 5CPJC 1P3LC 5DNMC 3LZ0A 3REHB 3AZGA 3UTAB 2HIOD 3UT9B 3AZED 3LZ1A 5E5AA 3AZJB 4QLCC 5B24D 5DNNB 2NZDD 3AZND 1HQ3D 5CP6B 1ID3D 1AOIB 1P3OD 5B31G 3RELC 3MGPA 1P3KD 3LELC 5DNMD 5B0YC 3AV2C 5B1LC 4WU9A 3AFAC 4J8VA 3W98B 1P3FD 3VH6T 4ZUXA 1KU5A 3KWQD 3RELD 1ULYA 5GSUA 1TZYC 5B0ZC 3AN2B 5B0YD 4WNNA 3W96C 3AFAD 5GXQA 5B2IB 4R8PA 4YS3C 5AV9A 4YM6C
chains in the Genus database with same CATH superfamily
4EO5C 3AN2C 4ZBJC 5CPIA 5B1MB 3A6NB 4KUDD 3REIB 3MNNC 2HUEB 1B67A 1KX4D 4H9SA 1S32B 3C1CD 4YM6D 1M1AD 4LD9D 1BH9B 3AZLC 3X1SC 3B6FA 5CPKC 5BNXB 4AWLB 5GT3C 3WA9C 5AY8A 4XUJB 3MNND 4J8XB 1M18C 1F66A 3W99B 3AZIC 3KUYD 5B31B 1P3PB 1KX3B 3AZHB 2NQBD 3X1UC 1P34B 5AVCA 1P3MC 1P3GA 1EQZA 3AZLD 3X1SD 4WU8D 2ZY4A 3P5JB 5GT3D 3W99C 3X1VC 4E45A 3C1BC 3AZHC 3WKJA 3MGSC 4J8UD 2DQNC 2RVQC 5G49B 3MGRC 3X1UD 3B0CT 4NE3A 3REHA 4KGCB 3UTAA 3UT9A 3AZJA 3WTPE 2BG1A 2YFVB 5DNNA 5BNVA 2YFWA 4H9OB 5CP6A 3C1BD 1AOIA 3VH5W 4Z66D 5AV8D 4WV4B 3MVDC 1JFIB 2RVQD 1M19C 3MGRD 4H9RA 3REKB 5C3IB 1BH8A 1U35B 1P3ID 1R4VA 3UTBA 3W98A 1TAFB 4CSRB 3IP4C 5B40C 2CV5C 3LJAC 3REKC 3AV1C 1Q9CA 1M19D 5GT0B 1WWIA 4DRAA 5B2IA 5F99B 3AZMB 4NE6A 1W2EA 2CV5D 2FJ7D 1P3BB 5B1MA 3A6NA 3AZFB 5B32D 2Y2GA 3REIA 4XZQD 3KXBC 2L5AA 3TU4C 1S32A 5AV5B 3AZKB 2DF4C 3B6GC 2XD1A 4Z5TB 3VH6A 5BNXA 3X1TC 5B2JC 2LY8A 4XUJA 1ZLAB 4J8XA 3LZ0D 4X23B 2Y2IA 3AZGD 5B31A 3AZKC 1P3PA 1KX3A 3LZ1D 5E5AD 4G92C 1P34A 2JSSA 5B33C 2BYMB 2NZDB 1P3AC 1ID3B 3MGPD 5BS7A 1P3OB 2HIOC 4JJNA 3AZEC 5DNMB 1P3LB 1P3KB 2Y2HA 3W97A 5B24C 5G49A 5FUGB 3AZNC 4QLCB 1HQ3C 2JCHA 4KGCA 1P3OC 5JRGC 5GSUD 3NQJA 1P3KC 4H9OA 3RELB 5KDMA 2IO5C 3LELB 5B0YB 3AV2B 5B1LB 1P3FC 4R8PD 4H9PB 3AFAB 5AV9D 3REJD 1U35A 4H9NB 3KWQC 1H3OA 5CPID 4CSRA 5BO0B 5JRGD 4E44A 1TZYB 5B0ZB 2ZY5A 1KX5C 3EG5B 3W96B 5BT1D 3VH6W 5GT0A 4YS3B 5F99A 4YM6B 1M1AB 4EO5B 3AZMA 2PYOC 4KUDC 3B0DB 4ZBJB 4UUZB 1P3BA 1KX5D 1KX4C 1F66D 3MNNB 3F6TA 3AZFA 3C1CC 1M1AC 3H0RC 3VH5A 4LD9C 1P3GD 3B0DC 5AVCD 4WZSB 1EQZD 2UWXA 5AV5A 2ZY2A 2PYOD 3AZLB 3X1SB 5AV6A 5CPKB 5GT3B 4Z5TA 3WA9B 3KUYC 3WKJD 1M18B 3AZIB 1ZLAA 2NQBC 4H9QA 4WU8C 2Y2PA 3UTAD 3X1UB 3UT9D 2AROA 3AZJD 1P3MB 2F8ND 3UTBC 5DNND 4J8WC 5CP6D 2BYMA 3B0BA 3X1VB 1AOID 4J8UC 2NZDA 1ID3A 3C1BB 3MGSB 5AVBA 1N1JB 5CPJA 1P3LA 3MGRB 4KHAB 5FUGA 3UTBD 4UPKA 4QLCA 4J8WD 4Z66C 2Y2KA 5AV8C 3AYWA 3WAAC 3B0CW 3RELA 3MVDB 1P3IC 1M19B 3LELA 3AV2A 5B1LA 5B2ID 3AFAA 4H9PA 4HGAB 3WTPC 4H9NA 3H0LC 5B40B 2CV5B 3WAAD 5BO0A 5B1MD 3A6ND 3LJAB 3AV1B 3REID 5B0ZA 1TZYA 4HGAC 3W96A 1S32D 3WTPD 2FJ7C 4YS3A 4YM6A 3AN2A 5B32C 4XZQC 3O62C 4XUJD 4J8XD 3MNNA 3KXBB 3MGQC 3TU4B 1P3PD 1KX3D 1BFMA 2JE5A 5E5AB 4NFTA 3B6GB 3AZLA 3X1SA 3O62D 5CPKA 3X1TB 5GT3A 5B2JB 2RIQA 3LZ0C 3WA9A 3AZGC 3MGQD 4JJND 3LZ1C 5E5AC 1M18A 3AZIA 3W97D 4Z2MG 1BH9A 4G92B 4KGCD 3X1UA 1P3MA 3A1IA 5B33B 3MGPC 3NQUB 1P3AB 3W99A 4WU9C 3X1VA 3C1BA 3AZHA 2HIOB 4J8VC 3MGSA 3AZEB 3A1KA 2F8NG 1N1JA 4ZUXC 5B24B 3MGRA 2F2AC 4KHAA 5AV9B 3AZNB 1HQ3B 5GSUC 2ZM5A 1Z2CB 4WU9D 5JRGB 5GXQC 4R8PC 2IO5B 4J8VD 5AV9C 3MVDA 3REJC 4ZUXD 1M19A 1P3FB 5F99D 3V9RB 2YFVA 4G91B 5CPIC 3KWQB 3AZMD 2ZY3A 5B40A 5GXQD 2CV5A 1JFIA 1A7WA 5BT1C 3LJAA 4H9SC 3REKA 3AV1A 1KX5B 4G91C 2Y2QA 3KSYA 3B6FC 1TAFA 5AV5D 1P3GB 1EQZB 5AV6D 5AY8C 2PYOB 4KUDB 4Z5TD 1B6WA 1F66C 1KX4B 3C1CB 1ZLAD 1P3GC 5CHLB 5AVCC 1EQZC 3KXBA 3B6FD 4LD9B 1WWSA 3TU4A 2AROD 2F8NB 5AY8D 3B6GA 3WKJC 5BNVB 2YFWB 3X1TA 3KUYB 3AYWC 5B2JA 3REHC 4DRBA 5AVBD 5CPJD 3UTAC 3UT9C 3AZJC 1P3LD 2NQBB 4H9RB 4WU8B 1BH8B 3AZKA 5DNNC 5B32G 4QLCD 5CP6C 3UTBB 1AOIC 5B33A 4J8WB 3NQUA 3AYWD 1P3AA 4J8UB 3REHD 4X23A 3LELD 3EPLA 3AV2D 2FFFB 2HIOA 5B1LD 3AZEA 3W98C 5B24A 1PZRA 1HTAA 3AZNA 1HQ3A 4Z66B 1P3OA 5AV8B 3WAAB 5JRGA 1P3KA 1TZYD 5DNMA 5B0ZD 3KFUG 5B2IC 4Z2MH 1P3IB 3W98D 3W96D 4CAYB 1P3FA 3WTPB 4YS3D 2VQRA 3V9RA 3KWQA 5B1MC 3A6NC 3AN2D 3REIC 2HUEC 5B0YA 1S32C 2F8NH 1KX5A 3H0MC 2FJ7B 4AWLC 2BYKB 4WJ3C 5CPKD 4XUJC 2PYOA 5B32B 2XD5A 4KUDA 4XZQB 3O62B 4J8XC 3WA9D 5JA4B 5B31C 1P3PC 3R45B 1KX3C 1M18D 1KX4A 3C1CA 3MGQB 4JJNB 3AZID 1P34C 1M1AA 3W97B 3EPHA 4LD9A 1P3MD 4UUZA 2F8NA 5BS7C 3REJA 3W99D 2Y2LA 4JJNC 3X1VD 3NQJB 5B31D 3LZ0B 3W97C 2G5HC 5KDMB 3KUYA 3AZHD 3AZGB 3MGSD 3LZ1B 1P34D 3VH5T 4KGCC 2NQBA 4M6BA 4WU8A 1H3OB 3MGPB 2G5IC 4J8WA 4WU9B 2Y2OA 4J8UA 3MVDD 5C3IC 1U35C 4J8VB 2CWEA 4ZUXB 5GSUB 5B40D 4Z66A 4WNNB 5AV8A 3LJAD 5GXQB 5GT0C 3REKD 3AV1D 3WAAA 1U35D 4R8PB 3EPJA 2W8SA 5F99C 3REJB 1P3IA 4CAYA 3AZMC 5CPIB 3WTPA 1P3BC 5AV6B 3AZFC 5GT0D 1T3UA 3KXBD 2Y2MA 5AV5C 3TU4D 4H9QB 2J8PA 3B6FB 5AV6C 2AROB 4NE5A 4Z5TC 2FJ7A 1P3BD 3B6GD 5AY8B 2BYKA 3AZFD 1F66B 5B32A 3X1TD 1ZLAC 1F1EA 5B2JD 4XZQA 3O62A 2F8NK 5JA4A 4X23C 2Y2NA 2AROC 2Y2JA 3R45A 5AVCB 5AVBB 4DQYB 3MGQA 5CPJB 3AZKD 3AL0C 2NZDC 1ID3C 5B33D 3WKJB 1P3AD 5AVBC 3AYWB 4X23D 5CPJC 1P3LC 5DNMC 3LZ0A 3REHB 3AZGA 3UTAB 2HIOD 3UT9B 3AZED 3LZ1A 5E5AA 3AZJB 4QLCC 5B24D 5DNNB 2NZDD 3AZND 1HQ3D 5CP6B 1ID3D 1AOIB 1P3OD 5B31G 3RELC 3MGPA 1P3KD 3LELC 5DNMD 5B0YC 3AV2C 5B1LC 4WU9A 3AFAC 4J8VA 3W98B 1P3FD 3VH6T 4ZUXA 1KU5A 3KWQD 3RELD 1ULYA 5GSUA 1TZYC 5B0ZC 3AN2B 3EPKA 5B0YD 4WNNA 3W96C 3AFAD 5GXQA 5B2IB 4R8PA 3FDDA 4YS3C 5AV9A 4YM6C
chains in the Genus database with same CATH topology
4EO5C 3AN2C 4ZBJC 5CPIA 5B1MB 3A6NB 4KUDD 3REIB 3MNNC 2HUEB 1B67A 1KX4D 4H9SA 1S32B 3C1CD 4YM6D 1M1AD 4LD9D 1BH9B 3AZLC 3X1SC 3B6FA 5CPKC 5BNXB 4AWLB 5GT3C 3WA9C 5AY8A 4XUJB 3MNND 4J8XB 1M18C 1F66A 3W99B 3AZIC 3KUYD 5B31B 1P3PB 1KX3B 3AZHB 2NQBD 3X1UC 1P34B 5AVCA 1P3MC 1P3GA 1EQZA 3AZLD 3X1SD 4WU8D 2ZY4A 3P5JB 5GT3D 3W99C 3X1VC 4E45A 3C1BC 3AZHC 3WKJA 3MGSC 4J8UD 2DQNC 2RVQC 5G49B 3MGRC 3X1UD 3B0CT 4NE3A 3REHA 4KGCB 3UTAA 3UT9A 3AZJA 3WTPE 2BG1A 2YFVB 5DNNA 5BNVA 2YFWA 4H9OB 5CP6A 3C1BD 1AOIA 3VH5W 4Z66D 5AV8D 4WV4B 3MVDC 1JFIB 2RVQD 1M19C 3MGRD 4H9RA 3REKB 5C3IB 1BH8A 1U35B 1P3ID 1R4VA 3UTBA 3W98A 1TAFB 4CSRB 3IP4C 5B40C 2CV5C 3LJAC 3REKC 3AV1C 1Q9CA 1M19D 5GT0B 1WWIA 4DRAA 5B2IA 5F99B 3AZMB 4NE6A 1W2EA 2CV5D 2FJ7D 1P3BB 5B1MA 3A6NA 3AZFB 5B32D 2Y2GA 3REIA 4XZQD 3KXBC 2L5AA 3TU4C 1S32A 5AV5B 3AZKB 2DF4C 3B6GC 2XD1A 4Z5TB 3VH6A 5BNXA 3X1TC 5B2JC 2LY8A 4XUJA 1ZLAB 4J8XA 3LZ0D 4X23B 2Y2IA 3AZGD 5B31A 3AZKC 1P3PA 1KX3A 3LZ1D 5E5AD 4G92C 1P34A 2JSSA 5B33C 2BYMB 2NZDB 1P3AC 1ID3B 3MGPD 5BS7A 1P3OB 2HIOC 4JJNA 3AZEC 5DNMB 1P3LB 1P3KB 2Y2HA 3W97A 5B24C 5G49A 5FUGB 3AZNC 4QLCB 1HQ3C 2JCHA 4KGCA 1P3OC 5JRGC 5GSUD 3NQJA 1P3KC 4H9OA 3RELB 5KDMA 2IO5C 3LELB 5B0YB 3AV2B 5B1LB 1P3FC 4R8PD 4H9PB 3AFAB 5AV9D 3REJD 1U35A 4H9NB 3KWQC 1H3OA 5CPID 4CSRA 5BO0B 5JRGD 4E44A 1TZYB 5B0ZB 2ZY5A 1KX5C 3EG5B 3W96B 5BT1D 3VH6W 5GT0A 4YS3B 5F99A 4YM6B 1M1AB 4EO5B 3AZMA 2PYOC 4KUDC 3B0DB 4ZBJB 4UUZB 1P3BA 1KX5D 1KX4C 1F66D 3MNNB 3F6TA 3AZFA 3C1CC 1M1AC 3H0RC 3VH5A 4LD9C 1P3GD 3B0DC 5AVCD 4WZSB 1EQZD 2UWXA 5AV5A 2ZY2A 2PYOD 3AZLB 3X1SB 5AV6A 5CPKB 5GT3B 4Z5TA 3WA9B 3KUYC 3WKJD 1M18B 3AZIB 1ZLAA 2NQBC 4H9QA 4WU8C 2Y2PA 3UTAD 3X1UB 3UT9D 2AROA 3AZJD 1P3MB 2F8ND 3UTBC 5DNND 4J8WC 5CP6D 2BYMA 3B0BA 3X1VB 1AOID 4J8UC 2NZDA 1ID3A 3C1BB 3MGSB 5AVBA 1N1JB 5CPJA 1P3LA 3MGRB 4KHAB 5FUGA 3UTBD 4UPKA 4QLCA 4J8WD 4Z66C 2Y2KA 5AV8C 3AYWA 3WAAC 3B0CW 3RELA 3MVDB 1P3IC 1M19B 3LELA 3AV2A 5B1LA 5B2ID 3AFAA 4H9PA 4HGAB 3WTPC 4H9NA 3H0LC 5B40B 2CV5B 3WAAD 5BO0A 5B1MD 3A6ND 3LJAB 3AV1B 3REID 5B0ZA 1TZYA 4HGAC 3W96A 1S32D 3WTPD 2FJ7C 4YS3A 4YM6A 3AN2A 5B32C 4XZQC 3O62C 4XUJD 4J8XD 3MNNA 3KXBB 3MGQC 3TU4B 1P3PD 1KX3D 1BFMA 2JE5A 5E5AB 4NFTA 3B6GB 3AZLA 3X1SA 3O62D 5CPKA 3X1TB 5GT3A 5B2JB 2RIQA 3LZ0C 3WA9A 3AZGC 3MGQD 4JJND 3LZ1C 5E5AC 1M18A 3AZIA 3W97D 4Z2MG 1BH9A 4G92B 4KGCD 3X1UA 1P3MA 3A1IA 5B33B 3MGPC 3NQUB 1P3AB 3W99A 4WU9C 3X1VA 3C1BA 3AZHA 2HIOB 4J8VC 3MGSA 3AZEB 3A1KA 2F8NG 1N1JA 4ZUXC 5B24B 3MGRA 2F2AC 4KHAA 5AV9B 3AZNB 1HQ3B 5GSUC 2ZM5A 1Z2CB 4WU9D 5JRGB 5GXQC 4R8PC 2IO5B 4J8VD 5AV9C 3MVDA 3REJC 4ZUXD 1M19A 1P3FB 5F99D 3V9RB 2YFVA 4G91B 5CPIC 3KWQB 3AZMD 2ZY3A 5B40A 5GXQD 2CV5A 1JFIA 1A7WA 5BT1C 3LJAA 4H9SC 3REKA 3AV1A 1KX5B 4G91C 2Y2QA 3KSYA 3B6FC 1TAFA 5AV5D 1P3GB 1EQZB 5AV6D 5AY8C 2PYOB 4KUDB 4Z5TD 1B6WA 1F66C 1KX4B 3C1CB 1ZLAD 1P3GC 5CHLB 5AVCC 1EQZC 3KXBA 3B6FD 4LD9B 1WWSA 3TU4A 2AROD 2F8NB 5AY8D 3B6GA 3WKJC 5BNVB 2YFWB 3X1TA 3KUYB 3AYWC 5B2JA 3REHC 4DRBA 5AVBD 5CPJD 3UTAC 3UT9C 3AZJC 1P3LD 2NQBB 4H9RB 4WU8B 1BH8B 3AZKA 5DNNC 5B32G 4QLCD 5CP6C 3UTBB 1AOIC 5B33A 4J8WB 3NQUA 3AYWD 1P3AA 4J8UB 3REHD 4X23A 3LELD 3EPLA 3AV2D 2FFFB 2HIOA 5B1LD 3AZEA 3W98C 5B24A 1PZRA 1HTAA 3AZNA 1HQ3A 4Z66B 1P3OA 5AV8B 3WAAB 5JRGA 1P3KA 1TZYD 5DNMA 5B0ZD 3KFUG 5B2IC 4Z2MH 1P3IB 3W98D 3W96D 4CAYB 1P3FA 3WTPB 4YS3D 2VQRA 3V9RA 3KWQA 5B1MC 3A6NC 3AN2D 3REIC 2HUEC 5B0YA 1S32C 2F8NH 1KX5A 3H0MC 2FJ7B 4AWLC 2BYKB 4WJ3C 5CPKD 4XUJC 2PYOA 5B32B 2XD5A 4KUDA 4XZQB 3O62B 4J8XC 3WA9D 5JA4B 5B31C 1P3PC 3R45B 1KX3C 1M18D 1KX4A 3C1CA 3MGQB 4JJNB 3AZID 1P34C 1M1AA 3W97B 3EPHA 4LD9A 1P3MD 4UUZA 2F8NA 5BS7C 3REJA 3W99D 2Y2LA 4JJNC 3X1VD 3NQJB 5B31D 3LZ0B 3W97C 2G5HC 5KDMB 3KUYA 3AZHD 3AZGB 3MGSD 3LZ1B 1P34D 3VH5T 4KGCC 2NQBA 4M6BA 4WU8A 1H3OB 3MGPB 2G5IC 4J8WA 4WU9B 2Y2OA 4J8UA 3MVDD 5C3IC 1U35C 4J8VB 2CWEA 4ZUXB 5GSUB 5B40D 4Z66A 4WNNB 5AV8A 3LJAD 5GXQB 5GT0C 3REKD 3AV1D 3WAAA 1U35D 4R8PB 3EPJA 2W8SA 5F99C 3REJB 1P3IA 4CAYA 3AZMC 5CPIB 3WTPA 1P3BC 5AV6B 3AZFC 5GT0D 1T3UA 3KXBD 2Y2MA 5AV5C 3TU4D 4H9QB 2J8PA 3B6FB 5AV6C 2AROB 4NE5A 4Z5TC 2FJ7A 1P3BD 3B6GD 5AY8B 2BYKA 3AZFD 1F66B 5B32A 3X1TD 1ZLAC 1F1EA 5B2JD 4XZQA 3O62A 2F8NK 5JA4A 4X23C 2Y2NA 2AROC 2Y2JA 3R45A 5AVCB 5AVBB 4DQYB 3MGQA 5CPJB 3AZKD 3AL0C 2NZDC 1ID3C 5B33D 3WKJB 1P3AD 5AVBC 3AYWB 4X23D 5CPJC 1P3LC 5DNMC 3LZ0A 3REHB 3AZGA 3UTAB 2HIOD 3UT9B 3AZED 3LZ1A 5E5AA 3AZJB 4QLCC 5B24D 5DNNB 2NZDD 3AZND 1HQ3D 5CP6B 1ID3D 1AOIB 1P3OD 5B31G 3RELC 3MGPA 1P3KD 3LELC 5DNMD 5B0YC 3AV2C 5B1LC 4WU9A 3AFAC 4J8VA 3W98B 1P3FD 3VH6T 4ZUXA 1KU5A 3KWQD 3RELD 1ULYA 5GSUA 1TZYC 5B0ZC 3AN2B 3EPKA 5B0YD 4WNNA 3W96C 3AFAD 5GXQA 5B2IB 4R8PA 3FDDA 4YS3C 5AV9A 4YM6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO5 C;  3AN2 C;  4ZBJ C;  5CPI A;  5B1M B;  3A6N B;  4KUD D;  3REI B;  3MNN C;  2HUE B;  1B67 A;  1KX4 D;  4H9S A;  1S32 B;  3C1C D;  4YM6 D;  1M1A D;  4LD9 D;  1BH9 B;  3AZL C;  3X1S C;  3B6F A;  5CPK C;  5BNX B;  4AWL B;  5GT3 C;  3WA9 C;  5AY8 A;  4XUJ B;  3MNN D;  4J8X B;  1M18 C;  1F66 A;  3W99 B;  3AZI C;  3KUY D;  5B31 B;  1P3P B;  1KX3 B;  3AZH B;  2NQB D;  3X1U C;  1P34 B;  5AVC A;  1P3M C;  1P3G A;  1EQZ A;  3AZL D;  3X1S D;  4WU8 D;  5GT3 D;  3W99 C;  3X1V C;  4E45 A;  3C1B C;  3AZH C;  3WKJ A;  3MGS C;  4J8U D;  2RVQ C;  5G49 B;  3MGR C;  3X1U D;  3B0C T;  4NE3 A;  3REH A;  4KGC B;  3UTA A;  3UT9 A;  3AZJ A;  3WTP E;  2YFV B;  5DNN A;  5BNV A;  2YFW A;  4H9O B;  5CP6 A;  3C1B D;  1AOI A;  3VH5 W;  4Z66 D;  5AV8 D;  4WV4 B;  3MVD C;  1JFI B;  2RVQ D;  1M19 C;  3MGR D;  4H9R A;  3REK B;  5C3I B;  1BH8 A;  1U35 B;  1P3I D;  1R4V A;  3UTB A;  3W98 A;  1TAF B;  4CSR B;  5B40 C;  2CV5 C;  3LJA C;  3REK C;  3AV1 C;  1Q9C A;  1M19 D;  5GT0 B;  1WWI A;  4DRA A;  5B2I A;  5F99 B;  3AZM B;  4NE6 A;  2CV5 D;  2FJ7 D;  1P3B B;  5B1M A;  3A6N A;  3AZF B;  5B32 D;  3REI A;  4XZQ D;  3KXB C;  2L5A A;  3TU4 C;  1S32 A;  5AV5 B;  3AZK B;  3B6G C;  4Z5T B;  3VH6 A;  5BNX A;  3X1T C;  5B2J C;  2LY8 A;  4XUJ A;  1ZLA B;  4J8X A;  3LZ0 D;  4X23 B;  3AZG D;  5B31 A;  3AZK C;  1P3P A;  1KX3 A;  3LZ1 D;  5E5A D;  4G92 C;  1P34 A;  2JSS A;  5B33 C;  2BYM B;  2NZD B;  1P3A C;  1ID3 B;  3MGP D;  5BS7 A;  1P3O B;  2HIO C;  4JJN A;  3AZE C;  5DNM B;  1P3L B;  1P3K B;  3W97 A;  5B24 C;  5G49 A;  5FUG B;  3AZN C;  4QLC B;  1HQ3 C;  4KGC A;  1P3O C;  5JRG C;  5GSU D;  3NQJ A;  1P3K C;  4H9O A;  3REL B;  5KDM A;  2IO5 C;  3LEL B;  5B0Y B;  3AV2 B;  5B1L B;  1P3F C;  4R8P D;  4H9P B;  3AFA B;  5AV9 D;  3REJ D;  1U35 A;  4H9N B;  3KWQ C;  1H3O A;  5CPI D;  4CSR A;  5BO0 B;  5JRG D;  4E44 A;  1TZY B;  5B0Z B;  1KX5 C;  3W96 B;  5BT1 D;  3VH6 W;  5GT0 A;  4YS3 B;  5F99 A;  4YM6 B;  1M1A B;  4EO5 B;  3AZM A;  2PYO C;  4KUD C;  3B0D B;  4ZBJ B;  4UUZ B;  1P3B A;  1KX5 D;  1KX4 C;  1F66 D;  3MNN B;  3AZF A;  3C1C C;  1M1A C;  3VH5 A;  4LD9 C;  1P3G D;  3B0D C;  5AVC D;  4WZS B;  1EQZ D;  5AV5 A;  2PYO D;  3AZL B;  3X1S B;  5AV6 A;  5CPK B;  5GT3 B;  4Z5T A;  3WA9 B;  3KUY C;  3WKJ D;  1M18 B;  3AZI B;  1ZLA A;  2NQB C;  4H9Q A;  4WU8 C;  3UTA D;  3X1U B;  3UT9 D;  2ARO A;  3AZJ D;  1P3M B;  2F8N D;  3UTB C;  5DNN D;  4J8W C;  5CP6 D;  2BYM A;  3B0B A;  3X1V B;  1AOI D;  4J8U C;  2NZD A;  1ID3 A;  3C1B B;  3MGS B;  5AVB A;  1N1J B;  5CPJ A;  1P3L A;  3MGR B;  4KHA B;  5FUG A;  3UTB D;  4QLC A;  4J8W D;  4Z66 C;  5AV8 C;  3AYW A;  3WAA C;  3B0C W;  3REL A;  3MVD B;  1P3I C;  1M19 B;  3LEL A;  3AV2 A;  5B1L A;  5B2I D;  3AFA A;  4H9P A;  4HGA B;  3WTP C;  4H9N A;  5B40 B;  2CV5 B;  3WAA D;  5BO0 A;  5B1M D;  3A6N D;  3LJA B;  3AV1 B;  3REI D;  1TZY A;  5B0Z A;  4HGA C;  3W96 A;  1S32 D;  3WTP D;  2FJ7 C;  4YS3 A;  4YM6 A;  3AN2 A;  5B32 C;  4XZQ C;  3O62 C;  4XUJ D;  4J8X D;  3MNN A;  3KXB B;  3MGQ C;  3TU4 B;  1P3P D;  1KX3 D;  1BFM A;  5E5A B;  4NFT A;  3B6G B;  3AZL A;  3X1S A;  3O62 D;  5CPK A;  3X1T B;  5GT3 A;  5B2J B;  3LZ0 C;  3WA9 A;  3AZG C;  3MGQ D;  4JJN D;  3LZ1 C;  5E5A C;  1M18 A;  3AZI A;  3W97 D;  4Z2M G;  1BH9 A;  4G92 B;  4KGC D;  3X1U A;  1P3M A;  5B33 B;  3MGP C;  3NQU B;  1P3A B;  3W99 A;  4WU9 C;  3X1V A;  3C1B A;  3AZH A;  2HIO B;  4J8V C;  3MGS A;  3AZE B;  2F8N G;  1N1J A;  4ZUX C;  5B24 B;  3MGR A;  4KHA A;  5AV9 B;  3AZN B;  1HQ3 B;  5GSU C;  4WU9 D;  5JRG B;  5GXQ C;  4R8P C;  2IO5 B;  4J8V D;  5AV9 C;  3MVD A;  3REJ C;  4ZUX D;  1M19 A;  1P3F B;  5F99 D;  3V9R B;  2YFV A;  4G91 B;  5CPI C;  3KWQ B;  3AZM D;  5B40 A;  5GXQ D;  2CV5 A;  1JFI A;  1A7W A;  5BT1 C;  3LJA A;  4H9S C;  3REK A;  3AV1 A;  1KX5 B;  4G91 C;  3KSY A;  3B6F C;  1TAF A;  5AV5 D;  1P3G B;  1EQZ B;  5AV6 D;  5AY8 C;  2PYO B;  4KUD B;  4Z5T D;  1B6W A;  1F66 C;  1KX4 B;  3C1C B;  1ZLA D;  1P3G C;  5CHL B;  5AVC C;  1EQZ C;  3KXB A;  3B6F D;  4LD9 B;  1WWS A;  3TU4 A;  2ARO D;  2F8N B;  5AY8 D;  3B6G A;  3WKJ C;  5BNV B;  2YFW B;  3X1T A;  3KUY B;  3AYW C;  5B2J A;  3REH C;  4DRB A;  5AVB D;  5CPJ D;  3UTA C;  3UT9 C;  3AZJ C;  1P3L D;  2NQB B;  4H9R B;  4WU8 B;  1BH8 B;  3AZK A;  5DNN C;  5B32 G;  4QLC D;  5CP6 C;  3UTB B;  1AOI C;  5B33 A;  4J8W B;  3NQU A;  3AYW D;  1P3A A;  4J8U B;  3REH D;  4X23 A;  3LEL D;  3AV2 D;  5B1L D;  2HIO A;  3AZE A;  3W98 C;  5B24 A;  1HTA A;  3AZN A;  1HQ3 A;  4Z66 B;  1P3O A;  5AV8 B;  3WAA B;  5JRG A;  1P3K A;  1TZY D;  5DNM A;  5B0Z D;  5B2I C;  4Z2M H;  1P3I B;  3W98 D;  3W96 D;  4CAY B;  1P3F A;  3WTP B;  4YS3 D;  3V9R A;  3KWQ A;  5B1M C;  3A6N C;  3AN2 D;  3REI C;  2HUE C;  5B0Y A;  1S32 C;  2F8N H;  1KX5 A;  2FJ7 B;  4AWL C;  2BYK B;  5CPK D;  4XUJ C;  2PYO A;  5B32 B;  4KUD A;  4XZQ B;  3O62 B;  4J8X C;  3WA9 D;  5JA4 B;  5B31 C;  1P3P C;  3R45 B;  1KX3 C;  1M18 D;  1KX4 A;  3C1C A;  3MGQ B;  4JJN B;  3AZI D;  1P34 C;  1M1A A;  3W97 B;  4LD9 A;  1P3M D;  4UUZ A;  2F8N A;  5BS7 C;  3REJ A;  3W99 D;  4JJN C;  3X1V D;  3NQJ B;  5B31 D;  3LZ0 B;  3W97 C;  5KDM B;  3KUY A;  3AZH D;  3AZG B;  3MGS D;  3LZ1 B;  1P34 D;  3VH5 T;  4KGC C;  2NQB A;  4M6B A;  4WU8 A;  1H3O B;  3MGP B;  4J8W A;  4WU9 B;  4J8U A;  3MVD D;  5C3I C;  1U35 C;  4J8V B;  2CWE A;  4ZUX B;  5GSU B;  5B40 D;  4Z66 A;  4WNN B;  5AV8 A;  3LJA D;  5GXQ B;  5GT0 C;  3REK D;  3AV1 D;  3WAA A;  1U35 D;  4R8P B;  5F99 C;  3REJ B;  1P3I A;  4CAY A;  3AZM C;  5CPI B;  3WTP A;  1P3B C;  5AV6 B;  3AZF C;  5GT0 D;  3KXB D;  5AV5 C;  3TU4 D;  4H9Q B;  3B6F B;  5AV6 C;  2ARO B;  4NE5 A;  4Z5T C;  2FJ7 A;  1P3B D;  3B6G D;  5AY8 B;  2BYK A;  3AZF D;  1F66 B;  5B32 A;  3X1T D;  1ZLA C;  1F1E A;  5B2J D;  4XZQ A;  3O62 A;  2F8N K;  5JA4 A;  4X23 C;  2ARO C;  3R45 A;  5AVC B;  5AVB B;  3MGQ A;  5CPJ B;  3AZK D;  2NZD C;  1ID3 C;  5B33 D;  3WKJ B;  1P3A D;  5AVB C;  3AYW B;  4X23 D;  5CPJ C;  1P3L C;  5DNM C;  3LZ0 A;  3REH B;  3AZG A;  3UTA B;  2HIO D;  3UT9 B;  3AZE D;  3LZ1 A;  5E5A A;  3AZJ B;  4QLC C;  5B24 D;  5DNN B;  2NZD D;  3AZN D;  1HQ3 D;  5CP6 B;  1ID3 D;  1AOI B;  1P3O D;  5B31 G;  3REL C;  3MGP A;  1P3K D;  3LEL C;  5DNM D;  5B0Y C;  3AV2 C;  5B1L C;  4WU9 A;  3AFA C;  4J8V A;  3W98 B;  1P3F D;  3VH6 T;  4ZUX A;  1KU5 A;  3KWQ D;  3REL D;  1ULY A;  5GSU A;  1TZY C;  5B0Z C;  3AN2 B;  5B0Y D;  4WNN A;  3W96 C;  3AFA D;  5GXQ A;  5B2I B;  4R8P A;  4YS3 C;  5AV9 A;  4YM6 C; 
#chains in the Genus database with same CATH topology
 4EO5 C;  3AN2 C;  4ZBJ C;  5CPI A;  5B1M B;  3A6N B;  4KUD D;  3REI B;  3MNN C;  2HUE B;  1B67 A;  1KX4 D;  4H9S A;  1S32 B;  3C1C D;  4YM6 D;  1M1A D;  4LD9 D;  1BH9 B;  3AZL C;  3X1S C;  3B6F A;  5CPK C;  5BNX B;  4AWL B;  5GT3 C;  3WA9 C;  5AY8 A;  4XUJ B;  3MNN D;  4J8X B;  1M18 C;  1F66 A;  3W99 B;  3AZI C;  3KUY D;  5B31 B;  1P3P B;  1KX3 B;  3AZH B;  2NQB D;  3X1U C;  1P34 B;  5AVC A;  1P3M C;  1P3G A;  1EQZ A;  3AZL D;  3X1S D;  4WU8 D;  2ZY4 A;  3P5J B;  5GT3 D;  3W99 C;  3X1V C;  4E45 A;  3C1B C;  3AZH C;  3WKJ A;  3MGS C;  4J8U D;  2DQN C;  2RVQ C;  5G49 B;  3MGR C;  3X1U D;  3B0C T;  4NE3 A;  3REH A;  4KGC B;  3UTA A;  3UT9 A;  3AZJ A;  3WTP E;  2BG1 A;  2YFV B;  5DNN A;  5BNV A;  2YFW A;  4H9O B;  5CP6 A;  3C1B D;  1AOI A;  3VH5 W;  4Z66 D;  5AV8 D;  4WV4 B;  3MVD C;  1JFI B;  2RVQ D;  1M19 C;  3MGR D;  4H9R A;  3REK B;  5C3I B;  1BH8 A;  1U35 B;  1P3I D;  1R4V A;  3UTB A;  3W98 A;  1TAF B;  4CSR B;  3IP4 C;  5B40 C;  2CV5 C;  3LJA C;  3REK C;  3AV1 C;  1Q9C A;  1M19 D;  5GT0 B;  1WWI A;  4DRA A;  5B2I A;  5F99 B;  3AZM B;  4NE6 A;  1W2E A;  2CV5 D;  2FJ7 D;  1P3B B;  5B1M A;  3A6N A;  3AZF B;  5B32 D;  2Y2G A;  3REI A;  4XZQ D;  3KXB C;  2L5A A;  3TU4 C;  1S32 A;  5AV5 B;  3AZK B;  2DF4 C;  3B6G C;  2XD1 A;  4Z5T B;  3VH6 A;  5BNX A;  3X1T C;  5B2J C;  2LY8 A;  4XUJ A;  1ZLA B;  4J8X A;  3LZ0 D;  4X23 B;  2Y2I A;  3AZG D;  5B31 A;  3AZK C;  1P3P A;  1KX3 A;  3LZ1 D;  5E5A D;  4G92 C;  1P34 A;  2JSS A;  5B33 C;  2BYM B;  2NZD B;  1P3A C;  1ID3 B;  3MGP D;  5BS7 A;  1P3O B;  2HIO C;  4JJN A;  3AZE C;  5DNM B;  1P3L B;  1P3K B;  2Y2H A;  3W97 A;  5B24 C;  5G49 A;  5FUG B;  3AZN C;  4QLC B;  1HQ3 C;  2JCH A;  4KGC A;  1P3O C;  5JRG C;  5GSU D;  3NQJ A;  1P3K C;  4H9O A;  3REL B;  5KDM A;  2IO5 C;  3LEL B;  5B0Y B;  3AV2 B;  5B1L B;  1P3F C;  4R8P D;  4H9P B;  3AFA B;  5AV9 D;  3REJ D;  1U35 A;  4H9N B;  3KWQ C;  1H3O A;  5CPI D;  4CSR A;  5BO0 B;  5JRG D;  4E44 A;  1TZY B;  5B0Z B;  2ZY5 A;  1KX5 C;  3EG5 B;  3W96 B;  5BT1 D;  3VH6 W;  5GT0 A;  4YS3 B;  5F99 A;  4YM6 B;  1M1A B;  4EO5 B;  3AZM A;  2PYO C;  4KUD C;  3B0D B;  4ZBJ B;  4UUZ B;  1P3B A;  1KX5 D;  1KX4 C;  1F66 D;  3MNN B;  3F6T A;  3AZF A;  3C1C C;  1M1A C;  3H0R C;  3VH5 A;  4LD9 C;  1P3G D;  3B0D C;  5AVC D;  4WZS B;  1EQZ D;  2UWX A;  5AV5 A;  2ZY2 A;  2PYO D;  3AZL B;  3X1S B;  5AV6 A;  5CPK B;  5GT3 B;  4Z5T A;  3WA9 B;  3KUY C;  3WKJ D;  1M18 B;  3AZI B;  1ZLA A;  2NQB C;  4H9Q A;  4WU8 C;  2Y2P A;  3UTA D;  3X1U B;  3UT9 D;  2ARO A;  3AZJ D;  1P3M B;  2F8N D;  3UTB C;  5DNN D;  4J8W C;  5CP6 D;  2BYM A;  3B0B A;  3X1V B;  1AOI D;  4J8U C;  2NZD A;  1ID3 A;  3C1B B;  3MGS B;  5AVB A;  1N1J B;  5CPJ A;  1P3L A;  3MGR B;  4KHA B;  5FUG A;  3UTB D;  4UPK A;  4QLC A;  4J8W D;  4Z66 C;  2Y2K A;  5AV8 C;  3AYW A;  3WAA C;  3B0C W;  3REL A;  3MVD B;  1P3I C;  1M19 B;  3LEL A;  3AV2 A;  5B1L A;  5B2I D;  3AFA A;  4H9P A;  4HGA B;  3WTP C;  4H9N A;  3H0L C;  5B40 B;  2CV5 B;  3WAA D;  5BO0 A;  5B1M D;  3A6N D;  3LJA B;  3AV1 B;  3REI D;  5B0Z A;  1TZY A;  4HGA C;  3W96 A;  1S32 D;  3WTP D;  2FJ7 C;  4YS3 A;  4YM6 A;  3AN2 A;  5B32 C;  4XZQ C;  3O62 C;  4XUJ D;  4J8X D;  3MNN A;  3KXB B;  3MGQ C;  3TU4 B;  1P3P D;  1KX3 D;  1BFM A;  2JE5 A;  5E5A B;  4NFT A;  3B6G B;  3AZL A;  3X1S A;  3O62 D;  5CPK A;  3X1T B;  5GT3 A;  5B2J B;  2RIQ A;  3LZ0 C;  3WA9 A;  3AZG C;  3MGQ D;  4JJN D;  3LZ1 C;  5E5A C;  1M18 A;  3AZI A;  3W97 D;  4Z2M G;  1BH9 A;  4G92 B;  4KGC D;  3X1U A;  1P3M A;  3A1I A;  5B33 B;  3MGP C;  3NQU B;  1P3A B;  3W99 A;  4WU9 C;  3X1V A;  3C1B A;  3AZH A;  2HIO B;  4J8V C;  3MGS A;  3AZE B;  3A1K A;  2F8N G;  1N1J A;  4ZUX C;  5B24 B;  3MGR A;  2F2A C;  4KHA A;  5AV9 B;  3AZN B;  1HQ3 B;  5GSU C;  2ZM5 A;  1Z2C B;  4WU9 D;  5JRG B;  5GXQ C;  4R8P C;  2IO5 B;  4J8V D;  5AV9 C;  3MVD A;  3REJ C;  4ZUX D;  1M19 A;  1P3F B;  5F99 D;  3V9R B;  2YFV A;  4G91 B;  5CPI C;  3KWQ B;  3AZM D;  2ZY3 A;  5B40 A;  5GXQ D;  2CV5 A;  1JFI A;  1A7W A;  5BT1 C;  3LJA A;  4H9S C;  3REK A;  3AV1 A;  1KX5 B;  4G91 C;  2Y2Q A;  3KSY A;  3B6F C;  1TAF A;  5AV5 D;  1P3G B;  1EQZ B;  5AV6 D;  5AY8 C;  2PYO B;  4KUD B;  4Z5T D;  1B6W A;  1F66 C;  1KX4 B;  3C1C B;  1ZLA D;  1P3G C;  5CHL B;  5AVC C;  1EQZ C;  3KXB A;  3B6F D;  4LD9 B;  1WWS A;  3TU4 A;  2ARO D;  2F8N B;  5AY8 D;  3B6G A;  3WKJ C;  5BNV B;  2YFW B;  3X1T A;  3KUY B;  3AYW C;  5B2J A;  3REH C;  4DRB A;  5AVB D;  5CPJ D;  3UTA C;  3UT9 C;  3AZJ C;  1P3L D;  2NQB B;  4H9R B;  4WU8 B;  1BH8 B;  3AZK A;  5DNN C;  5B32 G;  4QLC D;  5CP6 C;  3UTB B;  1AOI C;  5B33 A;  4J8W B;  3NQU A;  3AYW D;  1P3A A;  4J8U B;  3REH D;  4X23 A;  3LEL D;  3EPL A;  3AV2 D;  2FFF B;  2HIO A;  5B1L D;  3AZE A;  3W98 C;  5B24 A;  1PZR A;  1HTA A;  3AZN A;  1HQ3 A;  4Z66 B;  1P3O A;  5AV8 B;  3WAA B;  5JRG A;  1P3K A;  1TZY D;  5DNM A;  5B0Z D;  3KFU G;  5B2I C;  4Z2M H;  1P3I B;  3W98 D;  3W96 D;  4CAY B;  1P3F A;  3WTP B;  4YS3 D;  2VQR A;  3V9R A;  3KWQ A;  5B1M C;  3A6N C;  3AN2 D;  3REI C;  2HUE C;  5B0Y A;  1S32 C;  2F8N H;  1KX5 A;  3H0M C;  2FJ7 B;  4AWL C;  2BYK B;  4WJ3 C;  5CPK D;  4XUJ C;  2PYO A;  5B32 B;  2XD5 A;  4KUD A;  4XZQ B;  3O62 B;  4J8X C;  3WA9 D;  5JA4 B;  5B31 C;  1P3P C;  3R45 B;  1KX3 C;  1M18 D;  1KX4 A;  3C1C A;  3MGQ B;  4JJN B;  3AZI D;  1P34 C;  1M1A A;  3W97 B;  3EPH A;  4LD9 A;  1P3M D;  4UUZ A;  2F8N A;  5BS7 C;  3REJ A;  3W99 D;  2Y2L A;  4JJN C;  3X1V D;  3NQJ B;  5B31 D;  3LZ0 B;  3W97 C;  2G5H C;  5KDM B;  3KUY A;  3AZH D;  3AZG B;  3MGS D;  3LZ1 B;  1P34 D;  3VH5 T;  4KGC C;  2NQB A;  4M6B A;  4WU8 A;  1H3O B;  3MGP B;  2G5I C;  4J8W A;  4WU9 B;  2Y2O A;  4J8U A;  3MVD D;  5C3I C;  1U35 C;  4J8V B;  2CWE A;  4ZUX B;  5GSU B;  5B40 D;  4Z66 A;  4WNN B;  5AV8 A;  3LJA D;  5GXQ B;  5GT0 C;  3REK D;  3AV1 D;  3WAA A;  1U35 D;  4R8P B;  3EPJ A;  2W8S A;  5F99 C;  3REJ B;  1P3I A;  4CAY A;  3AZM C;  5CPI B;  3WTP A;  1P3B C;  5AV6 B;  3AZF C;  5GT0 D;  1T3U A;  3KXB D;  2Y2M A;  5AV5 C;  3TU4 D;  4H9Q B;  2J8P A;  3B6F B;  5AV6 C;  2ARO B;  4NE5 A;  4Z5T C;  2FJ7 A;  1P3B D;  3B6G D;  5AY8 B;  2BYK A;  3AZF D;  1F66 B;  5B32 A;  3X1T D;  1ZLA C;  1F1E A;  5B2J D;  4XZQ A;  3O62 A;  2F8N K;  5JA4 A;  4X23 C;  2Y2N A;  2ARO C;  2Y2J A;  3R45 A;  5AVC B;  5AVB B;  4DQY B;  3MGQ A;  5CPJ B;  3AZK D;  3AL0 C;  2NZD C;  1ID3 C;  5B33 D;  3WKJ B;  1P3A D;  5AVB C;  3AYW B;  4X23 D;  5CPJ C;  1P3L C;  5DNM C;  3LZ0 A;  3REH B;  3AZG A;  3UTA B;  2HIO D;  3UT9 B;  3AZE D;  3LZ1 A;  5E5A A;  3AZJ B;  4QLC C;  5B24 D;  5DNN B;  2NZD D;  3AZN D;  1HQ3 D;  5CP6 B;  1ID3 D;  1AOI B;  1P3O D;  5B31 G;  3REL C;  3MGP A;  1P3K D;  3LEL C;  5DNM D;  5B0Y C;  3AV2 C;  5B1L C;  4WU9 A;  3AFA C;  4J8V A;  3W98 B;  1P3F D;  3VH6 T;  4ZUX A;  1KU5 A;  3KWQ D;  3REL D;  1ULY A;  5GSU A;  1TZY C;  5B0Z C;  3AN2 B;  3EPK A;  5B0Y D;  4WNN A;  3W96 C;  3AFA D;  5GXQ A;  5B2I B;  4R8P A;  3FDD A;  4YS3 C;  5AV9 A;  4YM6 C; 
#chains in the Genus database with same CATH homology
 4EO5 C;  3AN2 C;  4ZBJ C;  5CPI A;  5B1M B;  3A6N B;  4KUD D;  3REI B;  3MNN C;  2HUE B;  1B67 A;  1KX4 D;  4H9S A;  1S32 B;  3C1C D;  4YM6 D;  1M1A D;  4LD9 D;  1BH9 B;  3AZL C;  3X1S C;  3B6F A;  5CPK C;  5BNX B;  4AWL B;  5GT3 C;  3WA9 C;  5AY8 A;  4XUJ B;  3MNN D;  4J8X B;  1M18 C;  1F66 A;  3W99 B;  3AZI C;  3KUY D;  5B31 B;  1P3P B;  1KX3 B;  3AZH B;  2NQB D;  3X1U C;  1P34 B;  5AVC A;  1P3M C;  1P3G A;  1EQZ A;  3AZL D;  3X1S D;  4WU8 D;  2ZY4 A;  3P5J B;  5GT3 D;  3W99 C;  3X1V C;  4E45 A;  3C1B C;  3AZH C;  3WKJ A;  3MGS C;  4J8U D;  2DQN C;  2RVQ C;  5G49 B;  3MGR C;  3X1U D;  3B0C T;  4NE3 A;  3REH A;  4KGC B;  3UTA A;  3UT9 A;  3AZJ A;  3WTP E;  2BG1 A;  2YFV B;  5DNN A;  5BNV A;  2YFW A;  4H9O B;  5CP6 A;  3C1B D;  1AOI A;  3VH5 W;  4Z66 D;  5AV8 D;  4WV4 B;  3MVD C;  1JFI B;  2RVQ D;  1M19 C;  3MGR D;  4H9R A;  3REK B;  5C3I B;  1BH8 A;  1U35 B;  1P3I D;  1R4V A;  3UTB A;  3W98 A;  1TAF B;  4CSR B;  3IP4 C;  5B40 C;  2CV5 C;  3LJA C;  3REK C;  3AV1 C;  1Q9C A;  1M19 D;  5GT0 B;  1WWI A;  4DRA A;  5B2I A;  5F99 B;  3AZM B;  4NE6 A;  1W2E A;  2CV5 D;  2FJ7 D;  1P3B B;  5B1M A;  3A6N A;  3AZF B;  5B32 D;  2Y2G A;  3REI A;  4XZQ D;  3KXB C;  2L5A A;  3TU4 C;  1S32 A;  5AV5 B;  3AZK B;  2DF4 C;  3B6G C;  2XD1 A;  4Z5T B;  3VH6 A;  5BNX A;  3X1T C;  5B2J C;  2LY8 A;  4XUJ A;  1ZLA B;  4J8X A;  3LZ0 D;  4X23 B;  2Y2I A;  3AZG D;  5B31 A;  3AZK C;  1P3P A;  1KX3 A;  3LZ1 D;  5E5A D;  4G92 C;  1P34 A;  2JSS A;  5B33 C;  2BYM B;  2NZD B;  1P3A C;  1ID3 B;  3MGP D;  5BS7 A;  1P3O B;  2HIO C;  4JJN A;  3AZE C;  5DNM B;  1P3L B;  1P3K B;  2Y2H A;  3W97 A;  5B24 C;  5G49 A;  5FUG B;  3AZN C;  4QLC B;  1HQ3 C;  2JCH A;  4KGC A;  1P3O C;  5JRG C;  5GSU D;  3NQJ A;  1P3K C;  4H9O A;  3REL B;  5KDM A;  2IO5 C;  3LEL B;  5B0Y B;  3AV2 B;  5B1L B;  1P3F C;  4R8P D;  4H9P B;  3AFA B;  5AV9 D;  3REJ D;  1U35 A;  4H9N B;  3KWQ C;  1H3O A;  5CPI D;  4CSR A;  5BO0 B;  5JRG D;  4E44 A;  1TZY B;  5B0Z B;  2ZY5 A;  1KX5 C;  3EG5 B;  3W96 B;  5BT1 D;  3VH6 W;  5GT0 A;  4YS3 B;  5F99 A;  4YM6 B;  1M1A B;  4EO5 B;  3AZM A;  2PYO C;  4KUD C;  3B0D B;  4ZBJ B;  4UUZ B;  1P3B A;  1KX5 D;  1KX4 C;  1F66 D;  3MNN B;  3F6T A;  3AZF A;  3C1C C;  1M1A C;  3H0R C;  3VH5 A;  4LD9 C;  1P3G D;  3B0D C;  5AVC D;  4WZS B;  1EQZ D;  2UWX A;  5AV5 A;  2ZY2 A;  2PYO D;  3AZL B;  3X1S B;  5AV6 A;  5CPK B;  5GT3 B;  4Z5T A;  3WA9 B;  3KUY C;  3WKJ D;  1M18 B;  3AZI B;  1ZLA A;  2NQB C;  4H9Q A;  4WU8 C;  2Y2P A;  3UTA D;  3X1U B;  3UT9 D;  2ARO A;  3AZJ D;  1P3M B;  2F8N D;  3UTB C;  5DNN D;  4J8W C;  5CP6 D;  2BYM A;  3B0B A;  3X1V B;  1AOI D;  4J8U C;  2NZD A;  1ID3 A;  3C1B B;  3MGS B;  5AVB A;  1N1J B;  5CPJ A;  1P3L A;  3MGR B;  4KHA B;  5FUG A;  3UTB D;  4UPK A;  4QLC A;  4J8W D;  4Z66 C;  2Y2K A;  5AV8 C;  3AYW A;  3WAA C;  3B0C W;  3REL A;  3MVD B;  1P3I C;  1M19 B;  3LEL A;  3AV2 A;  5B1L A;  5B2I D;  3AFA A;  4H9P A;  4HGA B;  3WTP C;  4H9N A;  3H0L C;  5B40 B;  2CV5 B;  3WAA D;  5BO0 A;  5B1M D;  3A6N D;  3LJA B;  3AV1 B;  3REI D;  5B0Z A;  1TZY A;  4HGA C;  3W96 A;  1S32 D;  3WTP D;  2FJ7 C;  4YS3 A;  4YM6 A;  3AN2 A;  5B32 C;  4XZQ C;  3O62 C;  4XUJ D;  4J8X D;  3MNN A;  3KXB B;  3MGQ C;  3TU4 B;  1P3P D;  1KX3 D;  1BFM A;  2JE5 A;  5E5A B;  4NFT A;  3B6G B;  3AZL A;  3X1S A;  3O62 D;  5CPK A;  3X1T B;  5GT3 A;  5B2J B;  2RIQ A;  3LZ0 C;  3WA9 A;  3AZG C;  3MGQ D;  4JJN D;  3LZ1 C;  5E5A C;  1M18 A;  3AZI A;  3W97 D;  4Z2M G;  1BH9 A;  4G92 B;  4KGC D;  3X1U A;  1P3M A;  3A1I A;  5B33 B;  3MGP C;  3NQU B;  1P3A B;  3W99 A;  4WU9 C;  3X1V A;  3C1B A;  3AZH A;  2HIO B;  4J8V C;  3MGS A;  3AZE B;  3A1K A;  2F8N G;  1N1J A;  4ZUX C;  5B24 B;  3MGR A;  2F2A C;  4KHA A;  5AV9 B;  3AZN B;  1HQ3 B;  5GSU C;  2ZM5 A;  1Z2C B;  4WU9 D;  5JRG B;  5GXQ C;  4R8P C;  2IO5 B;  4J8V D;  5AV9 C;  3MVD A;  3REJ C;  4ZUX D;  1M19 A;  1P3F B;  5F99 D;  3V9R B;  2YFV A;  4G91 B;  5CPI C;  3KWQ B;  3AZM D;  2ZY3 A;  5B40 A;  5GXQ D;  2CV5 A;  1JFI A;  1A7W A;  5BT1 C;  3LJA A;  4H9S C;  3REK A;  3AV1 A;  1KX5 B;  4G91 C;  2Y2Q A;  3KSY A;  3B6F C;  1TAF A;  5AV5 D;  1P3G B;  1EQZ B;  5AV6 D;  5AY8 C;  2PYO B;  4KUD B;  4Z5T D;  1B6W A;  1F66 C;  1KX4 B;  3C1C B;  1ZLA D;  1P3G C;  5CHL B;  5AVC C;  1EQZ C;  3KXB A;  3B6F D;  4LD9 B;  1WWS A;  3TU4 A;  2ARO D;  2F8N B;  5AY8 D;  3B6G A;  3WKJ C;  5BNV B;  2YFW B;  3X1T A;  3KUY B;  3AYW C;  5B2J A;  3REH C;  4DRB A;  5AVB D;  5CPJ D;  3UTA C;  3UT9 C;  3AZJ C;  1P3L D;  2NQB B;  4H9R B;  4WU8 B;  1BH8 B;  3AZK A;  5DNN C;  5B32 G;  4QLC D;  5CP6 C;  3UTB B;  1AOI C;  5B33 A;  4J8W B;  3NQU A;  3AYW D;  1P3A A;  4J8U B;  3REH D;  4X23 A;  3LEL D;  3EPL A;  3AV2 D;  2FFF B;  2HIO A;  5B1L D;  3AZE A;  3W98 C;  5B24 A;  1PZR A;  1HTA A;  3AZN A;  1HQ3 A;  4Z66 B;  1P3O A;  5AV8 B;  3WAA B;  5JRG A;  1P3K A;  1TZY D;  5DNM A;  5B0Z D;  3KFU G;  5B2I C;  4Z2M H;  1P3I B;  3W98 D;  3W96 D;  4CAY B;  1P3F A;  3WTP B;  4YS3 D;  2VQR A;  3V9R A;  3KWQ A;  5B1M C;  3A6N C;  3AN2 D;  3REI C;  2HUE C;  5B0Y A;  1S32 C;  2F8N H;  1KX5 A;  3H0M C;  2FJ7 B;  4AWL C;  2BYK B;  4WJ3 C;  5CPK D;  4XUJ C;  2PYO A;  5B32 B;  2XD5 A;  4KUD A;  4XZQ B;  3O62 B;  4J8X C;  3WA9 D;  5JA4 B;  5B31 C;  1P3P C;  3R45 B;  1KX3 C;  1M18 D;  1KX4 A;  3C1C A;  3MGQ B;  4JJN B;  3AZI D;  1P34 C;  1M1A A;  3W97 B;  3EPH A;  4LD9 A;  1P3M D;  4UUZ A;  2F8N A;  5BS7 C;  3REJ A;  3W99 D;  2Y2L A;  4JJN C;  3X1V D;  3NQJ B;  5B31 D;  3LZ0 B;  3W97 C;  2G5H C;  5KDM B;  3KUY A;  3AZH D;  3AZG B;  3MGS D;  3LZ1 B;  1P34 D;  3VH5 T;  4KGC C;  2NQB A;  4M6B A;  4WU8 A;  1H3O B;  3MGP B;  2G5I C;  4J8W A;  4WU9 B;  2Y2O A;  4J8U A;  3MVD D;  5C3I C;  1U35 C;  4J8V B;  2CWE A;  4ZUX B;  5GSU B;  5B40 D;  4Z66 A;  4WNN B;  5AV8 A;  3LJA D;  5GXQ B;  5GT0 C;  3REK D;  3AV1 D;  3WAA A;  1U35 D;  4R8P B;  3EPJ A;  2W8S A;  5F99 C;  3REJ B;  1P3I A;  4CAY A;  3AZM C;  5CPI B;  3WTP A;  1P3B C;  5AV6 B;  3AZF C;  5GT0 D;  1T3U A;  3KXB D;  2Y2M A;  5AV5 C;  3TU4 D;  4H9Q B;  2J8P A;  3B6F B;  5AV6 C;  2ARO B;  4NE5 A;  4Z5T C;  2FJ7 A;  1P3B D;  3B6G D;  5AY8 B;  2BYK A;  3AZF D;  1F66 B;  5B32 A;  3X1T D;  1ZLA C;  1F1E A;  5B2J D;  4XZQ A;  3O62 A;  2F8N K;  5JA4 A;  4X23 C;  2Y2N A;  2ARO C;  2Y2J A;  3R45 A;  5AVC B;  5AVB B;  4DQY B;  3MGQ A;  5CPJ B;  3AZK D;  3AL0 C;  2NZD C;  1ID3 C;  5B33 D;  3WKJ B;  1P3A D;  5AVB C;  3AYW B;  4X23 D;  5CPJ C;  1P3L C;  5DNM C;  3LZ0 A;  3REH B;  3AZG A;  3UTA B;  2HIO D;  3UT9 B;  3AZE D;  3LZ1 A;  5E5A A;  3AZJ B;  4QLC C;  5B24 D;  5DNN B;  2NZD D;  3AZN D;  1HQ3 D;  5CP6 B;  1ID3 D;  1AOI B;  1P3O D;  5B31 G;  3REL C;  3MGP A;  1P3K D;  3LEL C;  5DNM D;  5B0Y C;  3AV2 C;  5B1L C;  4WU9 A;  3AFA C;  4J8V A;  3W98 B;  1P3F D;  3VH6 T;  4ZUX A;  1KU5 A;  3KWQ D;  3REL D;  1ULY A;  5GSU A;  1TZY C;  5B0Z C;  3AN2 B;  3EPK A;  5B0Y D;  4WNN A;  3W96 C;  3AFA D;  5GXQ A;  5B2I B;  4R8P A;  3FDD A;  4YS3 C;  5AV9 A;  4YM6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...