4H9QA

Complex structure 4 of daxx(e225a)/h3.3(sub5)/h4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9qA00
3MVDD 4H9RA 4QLCC 4J8UB 3X1UB 4YM6B 5AVCC 3WKJA 1F66A 3REID 4YS3A 3MGSB 4WU8D 3A6NC 3UTAB 3X1TD 3AV2C 1P3OB 4Z66D 5B1LA 4WZSB 5JRGD 1ID3C 1KX3C 3AZHD 5B40D 3LELC 2FJ7A 4KHAB 3AZFA 1P3BA 1M18A 3AZNA 3TU4D 3WAAD 1N1JB 4KGCB 4WV4B 3MGRC 2CV5B 4XZQC 4XUJC 5B0ZB 3C1BC 5BO0A 5GT0C 4AWLB 3W99D 1P3KD 5B2IA 3B6GA 5AV6A 1P34C 1BH8A 3W96C 3REKB 4J8XC 1JFIB 5DNMC 4Z5TB 3MGQA 1WWIA 3AZIB 1P3IB 3RELD 4X23D 5AY8B 1M1AC 1F1EA 3W97D 1P3MA 4H9NA 4ZBJC 3LJAB 3AZEC 4KUDD 5F99C 3X1SC 4H9QB 5B24C 3X1VC 1TZYC 1P3GD 1P3LC 4J8UC 4YM6C 3C1CA 3KWQA 1H3OA 3KXBB 4WU9C 3UTAC 3AZKD 4G92B 3AFAD 3R45A 3AYWB 1P3OC 3B0CT 3MGPB 4JJNA 4QLCA 1HTAA 5AVCA 3AZLB 5BT1D 4CAYA 5B32B 1WWSA 5CP6B 3O62B 3A6NA 4J8VB 3AV2A 1P3AD 5B2JD 3KUYD 3NQUB 1P3PD 1ID3A 1KX3A 3AZGC 3LELA 3W98D 2AROB 4NE6A 5B0ZC 5B1MB 1KX5B 2NQBC 1ZLAB 4CSRB 4R8PC 4J8WC 5GSUB 3UT9D 3B6FB 3REKC 3MGRA 4XZQA 4UUZB 3C1BA 4Z5TC 5GT0A 1KX4C 3AZIC 1P3IC 5AY8C 4Z2MG 1P34A 5JA4A 3W96A 5CPKC 2HIOA 3LJAC 4J8XA 5GXQD 3V9RA 5DNMA 5B0YB 1P3FD 2F8ND 1KU5A 5B31C 4WU8B 4H9PB 1M1AA 3X1TB 3KXBC 2NZDD 5F99A 5KDMA 5JRGB 4H9OB 4DRAA 5B24A 3X1VA 4LD9D 4G92C 3AYWC 1TZYA 5B40B 1P3LA 4J8UA 4YM6A 3AZLC 3WKJD 5AV8C 2JSSA 5B32C 1F66D 2PYOC 4YS3D 4WU9A 3WA9B 3O62C 3UTAA 3WAAB 1P3OA 2YFWB 1EQZB 4ZUXB 2AROC 5C3IC 4KHAA 3AZFD 3W99B 5B1MC 1P3BD 4NE5A 5CPIB 3AZND 1M18D 1KX5C 1AOIC 2F8NH 1A7WA 4EO5B 4HGAB 1ULYA 1N1JA 5GSUC 3B6FC 3AZGA 3MNNB 5B0ZA 3W97B 3B6GD 5B2ID 5AV6D 2NQBA 4R8PA 4J8WA 3REKA 1JFIA 4Z5TA 3MGQD 5B0YC 3LZ1D 1KX4A 1R4VA 3AZIA 1P3IA 3X1TC 1P3MD 5CPKA 5GT3B 3LJAA 4H9QA 5JRGC 2BYMB 2RVQD 3C1CD 5B31A 3KWQD 3UTBB 5AV5B 5CPJC 1HQ3C 3KXBA 5B33C 3WA9C 1P3PB 5AVBB 3AYWA 4JJND 1EQZC 4ZUXC 3KSYA 5AVCD 5DNNB 3AZLA 3AV1B 5AV8A 3AZJC 2PYOA 2YFVB 5CPIC 3O62A 3A6ND 3AV2D 4EO5C 1TZYB 4HGAC 3VH6W 1ID3D 4E45A 3MNNC 3LELD 5B1MA 1KX5A 1AOIA 1BH9B 5GXQB 5AV9A 4CSRA 1M19D 5GSUA 3B6FA 3MGRD 4XZQD 3VH5W 3C1BD 3X1UC 5GT0D 3LZ0B 3MGSC 2NZDB 2BYKB 4LD9B 5GT3C 1BFMA 2HIOD 4NFTA 4J8XD 3REJD 5DNMD 4G91B 5BT1C 5B0YA 4YS3B 3UTBC 1U35B 4H9PA 5AV5C 3X1TA 5B24D 5JRGA 3REHB 1TAFB 3WTPB 5AVBC 4KGCC 1TZYD 2CV5C 1P3LD 3NQJB 3AN2B 4J8UD 5DNNC 3AV1C 5CPJA 1HQ3A 4WU9D 4AWLC 3WA9A 5B33A 1S32D 1P3OD 2YFWA 1EQZA 4XUJA 5BO0B 4ZUXA 3AZJA 5B2IB 3WTPE 5CPIA 3AZMB 1BH8B 5CHLB 3MVDB 5E5AD 3AZGD 3MNNA 3LZ1B 3REIB 2HUEB 3LZ0C 4H9NB 2NQBD 3AZEA 2NZDC 4Z66B 3X1SA 4R8PD 4J8WD 3REKD 4LD9C 3AZHB 3MGPC 4G91C 3C1CB 3X1UA 1KX4D 3AZID 2IO5B 3MGSA 5CP6C 1U35C 3TU4B 5CPKD 4J8VC 5GT3A 4WNNB 4JJNB 5B1LD 3REHC 3WTPC 2BYMA 2FJ7D 3B0CW 3AN2C 5B31D 3UTBA 1P3KB 1Q9CA 3A6NB 5AV5A 3AV2B 2F8NG 3KXBD 5BS7C 3B0DB 1ZLAC 5AVBA 4KGCA 3AYWD 3LELB 2CV5A 3RELB 4X23B 3AZLD 5DNNA 3AV1A 5AV8D 2PYOD 4KUDB 2YFVA 3AZMC 1M19B 3VH6A 1P3GB 3MVDC 5GT0B 3LZ1C 5B1MD 3REIC 2HUEC 4WU8C 5AY8A 1KX5D 1AOID 1BH9A 3AZKB 3B0BA 2HIOB 5B31G 3AFAB 3REJB 5AV9D 4Z66C 1B67A 5GSUD 3AZHC 5B40C 5G49B 3C1CC 3LZ0A 2L5AA 4ZBJB 2IO5C 1P3AB 2NZDA 5B2JB 5KDMB 3KUYB 3TU4C 3WAAC 4LD9A 3W98B 3MGPA 4QLCD 5B0YD 5B32A 4WU9B 3W99C 1P3KC 1U35A 5CP6A 1S32B 3UT9B 4J8VA 2LY8A 3B0DC 5FUGB 3NQUA 3REHA 1TAFA 3WTPA 1KX3D 3NQJA 2AROA 3AN2A 4NE3A 3RELC 4X23C 3W97C 5CPJD 1HQ3D 3WA9D 5B33D 4KUDC 5BS7A 1M19C 1ZLAA 5E5AB 3AZGB 1P3FB 1P3GC 1EQZD 4XUJD 4UUZA 4ZUXD 2F8NB 5BNVB 3AZJD 5BNXB 2NQBB 5CPID 1P34D 4R8PB 4J8WB 3AZMA 3W96D 3AZKC 2HIOC 3AFAC 3REJC 4H9RB 3MVDA 3MNND 3LZ1A 1KX4B 3WKJB 1F66B 3REIA 4WU8A 1M1AD 5CPKB 3AZED 1P3AC 5B1LB 5F99D 5B2JC 3X1SD 4Z66A 3KUYC 1P3PC 4H9OA 3X1VD 3AZHA 5B40A 2FJ7B 3W98C 3AZFB 5B31B 3X1UD 4YM6D 1P3BB 1M18B 3AZNB 4DRBA 3MGSD 1S32C 3UTAD 3TU4A 3WAAA 3UT9C 5GT3D 4WNNA 5AV8B 2PYOB 3UTBD 3B6GB 3W99A 1P3KA 5AV6B 5AV5D 5GXQC 5AVBD 4KGCD 5E5AC 3MGQB 2CV5D 1P3FC 5C3IB 5B0ZD 3RELA 5DNND 4X23A 3AV1D 1AOIB 1P3MB 3W97A 4KUDA 5AV9B 1M19A 4H9SC 1P3GA 4Z5TD 1H3OB 3KWQB 3WKJC 1F66C 1P3ID 4YS3C 4Z2MH 5AY8D 2CWEA 3AZKA 3R45B 3AFAA 3LJAD 3REJA 5B1LC 4QLCB 5AVCB 2FJ7C 4CAYB 3AZFC 5G49A 1P3BC 3LZ0D 1M18C 3AZNC 1B6WA 1P3AA 5B2JA 3KUYA 1P3PA 1ID3B 1KX3B 2F8NK 3MGPD 3W98A 5B32D 5CPJB 1HQ3B 3B6GC 5B33B 5B2IC 3VH6T 5CP6D 5AV6C 4E44A 3O62D 1U35D 1S32A 4J8VD 3UT9A 3MGRB 4XZQB 5FUGA 3REHD 4XUJB 3WTPD 3C1BB 4M6BA 3MGQC 3AZJB 2AROD 3AN2D 1P34B 5JA4B 1P3MC 3W96B 4J8XB 3VH5T 5AV9C 5GXQA 3V9RB 5DNMB 1ZLAD 3B6FD 5E5AA 3VH5A 1P3FA 2RVQC 2F8NA 3KWQC 1M1AB 5BNVA 5BNXA 3AZEB 5F99B 3X1SB 3AZMD 5B24B 5B32G 2BYKA 3X1VB 4H9SA 1P3LB 4JJNC
chains in the Genus database with same CATH superfamily
3MVDD 4H9RA 4QLCC 4J8UB 3X1UB 4YM6B 5AVCC 3WKJA 1F66A 3REID 4YS3A 3MGSB 4WU8D 3A1IA 3A6NC 3X1TD 3UTAB 3AV2C 1P3OB 4Z66D 5B1LA 4WZSB 5JRGD 2Y2PA 1KX3C 2Y2GA 1ID3C 3AZHD 5B40D 3LELC 2FJ7A 4KHAB 3AZFA 1P3BA 1M18A 3AZNA 3TU4D 3WAAD 1N1JB 4KGCB 4WV4B 3MGRC 2CV5B 4XZQC 4XUJC 5B0ZB 3C1BC 5BO0A 2F2AC 5GT0C 3FDDA 3KFUG 4AWLB 3W99D 1P3KD 5B2IA 3B6GA 5AV6A 1P34C 1BH8A 3W96C 3REKB 4J8XC 1JFIB 5DNMC 4Z5TB 3MGQA 1WWIA 3AZIB 1P3IB 3RELD 4X23D 5AY8B 1M1AC 1F1EA 3W97D 1P3MA 2J8PA 4H9NA 4ZBJC 3LJAB 3AZEC 4KUDD 5F99C 3X1SC 4H9QB 5B24C 3X1VC 1TZYC 1P3GD 1P3LC 4J8UC 4YM6C 3C1CA 3KWQA 1H3OA 3EPHA 3KXBB 4WU9C 3UTAC 4DQYB 3AZKD 4G92B 3AFAD 3R45A 3AYWB 1P3OC 3B0CT 3MGPB 4JJNA 4QLCA 1HTAA 5AVCA 3AZLB 3H0RC 5BT1D 4CAYA 5B32B 1WWSA 5CP6B 3O62B 3A6NA 4J8VB 2DQNC 3AV2A 1P3AD 5B2JD 3KUYD 3NQUB 1P3PD 1ID3A 1KX3A 3EPKA 3AZGC 3LELA 3W98D 2AROB 4NE6A 5B0ZC 5B1MB 1KX5B 2NQBC 3EG5B 1ZLAB 4CSRB 4R8PC 4J8WC 5GSUB 3UT9D 3B6FB 3REKC 3MGRA 4XZQA 4UUZB 3C1BA 4Z5TC 5GT0A 1KX4C 3AZIC 1P3IC 5AY8C 4Z2MG 1P34A 5JA4A 3W96A 5CPKC 2HIOA 3LJAC 4J8XA 5GXQD 3V9RA 5DNMA 2ZY5A 5B0YB 1P3FD 2F8ND 1KU5A 5B31C 4WU8B 4H9PB 1M1AA 3X1TB 2BG1A 3KXBC 2NZDD 5F99A 5KDMA 5JRGB 4H9OB 4DRAA 5B24A 3X1VA 4LD9D 4G92C 3AYWC 1TZYA 3EPLA 5B40B 1P3LA 4J8UA 4YM6A 3AZLC 3WKJD 5AV8C 2JSSA 5B32C 1F66D 2PYOC 4YS3D 4WU9A 3WA9B 3O62C 3UTAA 3WAAB 1P3OA 2YFWB 1EQZB 4ZUXB 2AROC 5C3IC 4KHAA 3AZFD 3W99B 5B1MC 1P3BD 4NE5A 5CPIB 2ZY4A 3AZND 1M18D 1KX5C 1AOIC 2F8NH 1A7WA 4EO5B 4HGAB 1ULYA 1N1JA 5GSUC 3B6FC 3AZGA 3MNNB 5B0ZA 3W97B 3B6GD 5B2ID 5AV6D 2NQBA 4R8PA 4J8WA 3REKA 1JFIA 4Z5TA 3MGQD 5B0YC 3LZ1D 1KX4A 1R4VA 3AZIA 1P3IA 2G5IC 3X1TC 1P3MD 5CPKA 5GT3B 3LJAA 4H9QA 5JRGC 2BYMB 2RVQD 3C1CD 5B31A 3KWQD 3UTBB 5AV5B 5CPJC 1HQ3C 3KXBA 5B33C 3WA9C 1P3PB 5AVBB 2VQRA 4WJ3C 3AYWA 4JJND 1EQZC 4ZUXC 3KSYA 5AVCD 5DNNB 3AZLA 3AV1B 5AV8A 3AZJC 2PYOA 2YFVB 5CPIC 3O62A 3A6ND 3AV2D 4EO5C 1TZYB 4HGAC 3VH6W 1ID3D 4E45A 3MNNC 3LELD 5B1MA 1KX5A 1AOIA 1BH9B 5GXQB 5AV9A 4CSRA 1M19D 5GSUA 3B6FA 3MGRD 4XZQD 3VH5W 3C1BD 3X1UC 5GT0D 3LZ0B 3MGSC 2NZDB 2BYKB 4LD9B 5GT3C 1BFMA 2HIOD 4NFTA 4J8XD 3REJD 5DNMD 4G91B 5BT1C 5B0YA 4YS3B 3UTBC 1U35B 2XD5A 4H9PA 5AV5C 3X1TA 5B24D 5JRGA 3REHB 1TAFB 3WTPB 5AVBC 4KGCC 1TZYD 2CV5C 1P3LD 3NQJB 3AN2B 4J8UD 5DNNC 3AV1C 5CPJA 1HQ3A 4WU9D 4AWLC 3WA9A 5B33A 1S32D 4UPKA 1P3OD 2YFWA 1EQZA 4XUJA 5BO0B 4ZUXA 3AZJA 5B2IB 2RIQA 3WTPE 5CPIA 3AZMB 3A1KA 1BH8B 5CHLB 3MVDB 5E5AD 3AZGD 3MNNA 3P5JB 3LZ1B 3REIB 2HUEB 3LZ0C 4H9NB 2NQBD 3AZEA 2NZDC 4Z66B 3X1SA 4R8PD 4J8WD 3REKD 4LD9C 3AZHB 3MGPC 4G91C 2JE5A 3C1CB 3X1UA 1KX4D 2ZY2A 3AZID 2IO5B 3MGSA 5CP6C 1U35C 3TU4B 5CPKD 2DF4C 5GT3A 4J8VC 4WNNB 4JJNB 5B1LD 3REHC 3WTPC 2BYMA 2FJ7D 3B0CW 3AN2C 5B31D 3UTBA 1P3KB 1Q9CA 3A6NB 5AV5A 3AV2B 2F8NG 3KXBD 5BS7C 3B0DB 1ZLAC 5AVBA 4KGCA 3AYWD 3LELB 2CV5A 3RELB 2FFFB 4X23B 5DNNA 3AZLD 3AV1A 5AV8D 2PYOD 2G5HC 4KUDB 2YFVA 3AZMC 1M19B 3VH6A 1P3GB 3MVDC 5GT0B 3LZ1C 5B1MD 3REIC 2HUEC 1PZRA 4WU8C 5AY8A 1KX5D 1AOID 1BH9A 3AZKB 3B0BA 2HIOB 5B31G 3AFAB 3REJB 5AV9D 4Z66C 1B67A 5GSUD 3AZHC 5B40C 5G49B 3C1CC 3LZ0A 2L5AA 4ZBJB 2IO5C 1P3AB 2NZDA 5B2JB 5KDMB 3KUYB 3TU4C 3WAAC 4LD9A 3W98B 3MGPA 4QLCD 5B0YD 5B32A 4WU9B 3W99C 1P3KC 1U35A 5CP6A 1S32B 3UT9B 4J8VA 2LY8A 3B0DC 3H0MC 5FUGB 3NQUA 3REHA 1TAFA 3WTPA 1KX3D 3NQJA 2AROA 3AN2A 4NE3A 3RELC 2JCHA 4X23C 3AL0C 3W97C 5CPJD 1HQ3D 3WA9D 5B33D 4KUDC 5BS7A 1M19C 1ZLAA 5E5AB 3AZGB 1P3FB 1P3GC 1EQZD 2Y2QA 4XUJD 4UUZA 4ZUXD 2F8NB 5BNVB 3AZJD 5BNXB 2NQBB 5CPID 1P34D 4R8PB 4J8WB 3AZMA 3W96D 3AZKC 2HIOC 3AFAC 3REJC 4H9RB 3MVDA 3MNND 3LZ1A 1KX4B 3WKJB 1F66B 3F6TA 3REIA 4WU8A 1M1AD 5CPKB 3AZED 1P3AC 5B1LB 5F99D 5B2JC 3X1SD 4Z66A 3KUYC 1P3PC 4H9OA 3X1VD 3AZHA 3EPJA 5B40A 2FJ7B 3W98C 3AZFB 5B31B 3X1UD 4YM6D 1P3BB 1M18B 3AZNB 4DRBA 3H0LC 2ZM5A 3MGSD 1S32C 3UTAD 3TU4A 3WAAA 3UT9C 5GT3D 4WNNA 2Y2OA 2Y2LA 2XD1A 5AV8B 2PYOB 3UTBD 3B6GB 3W99A 1P3KA 3IP4C 5AV6B 1T3UA 5AV5D 5GXQC 5AVBD 4KGCD 1Z2CB 5E5AC 2Y2HA 3MGQB 2CV5D 1P3FC 5C3IB 5B0ZD 3RELA 2Y2MA 5DNND 4X23A 3AV1D 1AOIB 1P3MB 3W97A 4KUDA 5AV9B 1M19A 2Y2IA 4H9SC 2W8SA 1W2EA 1P3GA 4Z5TD 1H3OB 3KWQB 3WKJC 1F66C 1P3ID 4YS3C 4Z2MH 5AY8D 2CWEA 3AZKA 3R45B 3AFAA 3LJAD 3REJA 5B1LC 4QLCB 5AVCB 2FJ7C 4CAYB 3AZFC 5G49A 1P3BC 3LZ0D 1M18C 3AZNC 2Y2KA 1B6WA 1P3AA 2ZY3A 5B2JA 3KUYA 1P3PA 1ID3B 1KX3B 2F8NK 3MGPD 3W98A 5B32D 5CPJB 1HQ3B 3B6GC 5B33B 5B2IC 3VH6T 5CP6D 5AV6C 4E44A 3O62D 1U35D 1S32A 4J8VD 2Y2NA 3UT9A 3MGRB 4XZQB 5FUGA 3REHD 4XUJB 3WTPD 3C1BB 4M6BA 3MGQC 3AZJB 2AROD 3AN2D 1P34B 5JA4B 1P3MC 3W96B 4J8XB 5AV9C 3VH5T 5GXQA 3V9RB 5DNMB 1ZLAD 3B6FD 5E5AA 3VH5A 1P3FA 2UWXA 2RVQC 2F8NA 3KWQC 1M1AB 5BNVA 5BNXA 3AZEB 5F99B 3X1SB 3AZMD 2Y2JA 5B24B 5B32G 2BYKA 3X1VB 4H9SA 1P3LB 4JJNC
chains in the Genus database with same CATH topology
3MVDD 4H9RA 4QLCC 4J8UB 3X1UB 4YM6B 5AVCC 3WKJA 1F66A 3REID 4YS3A 3MGSB 4WU8D 3A1IA 3A6NC 3X1TD 3UTAB 3AV2C 1P3OB 4Z66D 5B1LA 4WZSB 5JRGD 2Y2PA 1KX3C 2Y2GA 1ID3C 3AZHD 5B40D 3LELC 2FJ7A 4KHAB 3AZFA 1P3BA 1M18A 3AZNA 3TU4D 3WAAD 1N1JB 4KGCB 4WV4B 3MGRC 2CV5B 4XZQC 4XUJC 5B0ZB 3C1BC 5BO0A 2F2AC 5GT0C 3FDDA 3KFUG 4AWLB 3W99D 1P3KD 5B2IA 3B6GA 5AV6A 1P34C 1BH8A 3W96C 3REKB 4J8XC 1JFIB 5DNMC 4Z5TB 3MGQA 1WWIA 3AZIB 1P3IB 3RELD 4X23D 5AY8B 1M1AC 1F1EA 3W97D 1P3MA 2J8PA 4H9NA 4ZBJC 3LJAB 3AZEC 4KUDD 5F99C 3X1SC 4H9QB 5B24C 3X1VC 1TZYC 1P3GD 1P3LC 4J8UC 4YM6C 3C1CA 3KWQA 1H3OA 3EPHA 3KXBB 4WU9C 3UTAC 4DQYB 3AZKD 4G92B 3AFAD 3R45A 3AYWB 1P3OC 3B0CT 3MGPB 4JJNA 4QLCA 1HTAA 5AVCA 3AZLB 3H0RC 5BT1D 4CAYA 5B32B 1WWSA 5CP6B 3O62B 3A6NA 4J8VB 2DQNC 3AV2A 1P3AD 5B2JD 3KUYD 3NQUB 1P3PD 1ID3A 1KX3A 3EPKA 3AZGC 3LELA 3W98D 2AROB 4NE6A 5B0ZC 5B1MB 1KX5B 2NQBC 3EG5B 1ZLAB 4CSRB 4R8PC 4J8WC 5GSUB 3UT9D 3B6FB 3REKC 3MGRA 4XZQA 4UUZB 3C1BA 4Z5TC 5GT0A 1KX4C 3AZIC 1P3IC 5AY8C 4Z2MG 1P34A 5JA4A 3W96A 5CPKC 2HIOA 3LJAC 4J8XA 5GXQD 3V9RA 5DNMA 2ZY5A 5B0YB 1P3FD 2F8ND 1KU5A 5B31C 4WU8B 4H9PB 1M1AA 3X1TB 2BG1A 3KXBC 2NZDD 5F99A 5KDMA 5JRGB 4H9OB 4DRAA 5B24A 3X1VA 4LD9D 4G92C 3AYWC 1TZYA 3EPLA 5B40B 1P3LA 4J8UA 4YM6A 3AZLC 3WKJD 5AV8C 2JSSA 5B32C 1F66D 2PYOC 4YS3D 4WU9A 3WA9B 3O62C 3UTAA 3WAAB 1P3OA 2YFWB 1EQZB 4ZUXB 2AROC 5C3IC 4KHAA 3AZFD 3W99B 5B1MC 1P3BD 4NE5A 5CPIB 2ZY4A 3AZND 1M18D 1KX5C 1AOIC 2F8NH 1A7WA 4EO5B 4HGAB 1ULYA 1N1JA 5GSUC 3B6FC 3AZGA 3MNNB 5B0ZA 3W97B 3B6GD 5B2ID 5AV6D 2NQBA 4R8PA 4J8WA 3REKA 1JFIA 4Z5TA 3MGQD 5B0YC 3LZ1D 1KX4A 1R4VA 3AZIA 1P3IA 2G5IC 3X1TC 1P3MD 5CPKA 5GT3B 3LJAA 4H9QA 5JRGC 2BYMB 2RVQD 3C1CD 5B31A 3KWQD 3UTBB 5AV5B 5CPJC 1HQ3C 3KXBA 5B33C 3WA9C 1P3PB 5AVBB 2VQRA 4WJ3C 3AYWA 4JJND 1EQZC 4ZUXC 3KSYA 5AVCD 5DNNB 3AZLA 3AV1B 5AV8A 3AZJC 2PYOA 2YFVB 5CPIC 3O62A 3A6ND 3AV2D 4EO5C 1TZYB 4HGAC 3VH6W 1ID3D 4E45A 3MNNC 3LELD 5B1MA 1KX5A 1AOIA 1BH9B 5GXQB 5AV9A 4CSRA 1M19D 5GSUA 3B6FA 3MGRD 4XZQD 3VH5W 3C1BD 3X1UC 5GT0D 3LZ0B 3MGSC 2NZDB 2BYKB 4LD9B 5GT3C 1BFMA 2HIOD 4NFTA 4J8XD 3REJD 5DNMD 4G91B 5BT1C 5B0YA 4YS3B 3UTBC 1U35B 2XD5A 4H9PA 5AV5C 3X1TA 5B24D 5JRGA 3REHB 1TAFB 3WTPB 5AVBC 4KGCC 1TZYD 2CV5C 1P3LD 3NQJB 3AN2B 4J8UD 5DNNC 3AV1C 5CPJA 1HQ3A 4WU9D 4AWLC 3WA9A 5B33A 1S32D 4UPKA 1P3OD 2YFWA 1EQZA 4XUJA 5BO0B 4ZUXA 3AZJA 5B2IB 2RIQA 3WTPE 5CPIA 3AZMB 3A1KA 1BH8B 5CHLB 3MVDB 5E5AD 3AZGD 3MNNA 3P5JB 3LZ1B 3REIB 2HUEB 3LZ0C 4H9NB 2NQBD 3AZEA 2NZDC 4Z66B 3X1SA 4R8PD 4J8WD 3REKD 4LD9C 3AZHB 3MGPC 4G91C 2JE5A 3C1CB 3X1UA 1KX4D 2ZY2A 3AZID 2IO5B 3MGSA 5CP6C 1U35C 3TU4B 5CPKD 2DF4C 5GT3A 4J8VC 4WNNB 4JJNB 5B1LD 3REHC 3WTPC 2BYMA 2FJ7D 3B0CW 3AN2C 5B31D 3UTBA 1P3KB 1Q9CA 3A6NB 5AV5A 3AV2B 2F8NG 3KXBD 5BS7C 3B0DB 1ZLAC 5AVBA 4KGCA 3AYWD 3LELB 2CV5A 3RELB 2FFFB 4X23B 5DNNA 3AZLD 3AV1A 5AV8D 2PYOD 2G5HC 4KUDB 2YFVA 3AZMC 1M19B 3VH6A 1P3GB 3MVDC 5GT0B 3LZ1C 5B1MD 3REIC 2HUEC 1PZRA 4WU8C 5AY8A 1KX5D 1AOID 1BH9A 3AZKB 3B0BA 2HIOB 5B31G 3AFAB 3REJB 5AV9D 4Z66C 1B67A 5GSUD 3AZHC 5B40C 5G49B 3C1CC 3LZ0A 2L5AA 4ZBJB 2IO5C 1P3AB 2NZDA 5B2JB 5KDMB 3KUYB 3TU4C 3WAAC 4LD9A 3W98B 3MGPA 4QLCD 5B0YD 5B32A 4WU9B 3W99C 1P3KC 1U35A 5CP6A 1S32B 3UT9B 4J8VA 2LY8A 3B0DC 3H0MC 5FUGB 3NQUA 3REHA 1TAFA 3WTPA 1KX3D 3NQJA 2AROA 3AN2A 4NE3A 3RELC 2JCHA 4X23C 3AL0C 3W97C 5CPJD 1HQ3D 3WA9D 5B33D 4KUDC 5BS7A 1M19C 1ZLAA 5E5AB 3AZGB 1P3FB 1P3GC 1EQZD 2Y2QA 4XUJD 4UUZA 4ZUXD 2F8NB 5BNVB 3AZJD 5BNXB 2NQBB 5CPID 1P34D 4R8PB 4J8WB 3AZMA 3W96D 3AZKC 2HIOC 3AFAC 3REJC 4H9RB 3MVDA 3MNND 3LZ1A 1KX4B 3WKJB 1F66B 3F6TA 3REIA 4WU8A 1M1AD 5CPKB 3AZED 1P3AC 5B1LB 5F99D 5B2JC 3X1SD 4Z66A 3KUYC 1P3PC 4H9OA 3X1VD 3AZHA 3EPJA 5B40A 2FJ7B 3W98C 3AZFB 5B31B 3X1UD 4YM6D 1P3BB 1M18B 3AZNB 4DRBA 3H0LC 2ZM5A 3MGSD 1S32C 3UTAD 3TU4A 3WAAA 3UT9C 5GT3D 4WNNA 2Y2OA 2Y2LA 2XD1A 5AV8B 2PYOB 3UTBD 3B6GB 3W99A 1P3KA 3IP4C 5AV6B 1T3UA 5AV5D 5GXQC 5AVBD 4KGCD 1Z2CB 5E5AC 2Y2HA 3MGQB 2CV5D 1P3FC 5C3IB 5B0ZD 3RELA 2Y2MA 5DNND 4X23A 3AV1D 1AOIB 1P3MB 3W97A 4KUDA 5AV9B 1M19A 2Y2IA 4H9SC 2W8SA 1W2EA 1P3GA 4Z5TD 1H3OB 3KWQB 3WKJC 1F66C 1P3ID 4YS3C 4Z2MH 5AY8D 2CWEA 3AZKA 3R45B 3AFAA 3LJAD 3REJA 5B1LC 4QLCB 5AVCB 2FJ7C 4CAYB 3AZFC 5G49A 1P3BC 3LZ0D 1M18C 3AZNC 2Y2KA 1B6WA 1P3AA 2ZY3A 5B2JA 3KUYA 1P3PA 1ID3B 1KX3B 2F8NK 3MGPD 3W98A 5B32D 5CPJB 1HQ3B 3B6GC 5B33B 5B2IC 3VH6T 5CP6D 5AV6C 4E44A 3O62D 1U35D 1S32A 4J8VD 2Y2NA 3UT9A 3MGRB 4XZQB 5FUGA 3REHD 4XUJB 3WTPD 3C1BB 4M6BA 3MGQC 3AZJB 2AROD 3AN2D 1P34B 5JA4B 1P3MC 3W96B 4J8XB 5AV9C 3VH5T 5GXQA 3V9RB 5DNMB 1ZLAD 3B6FD 5E5AA 3VH5A 1P3FA 2UWXA 2RVQC 2F8NA 3KWQC 1M1AB 5BNVA 5BNXA 3AZEB 5F99B 3X1SB 3AZMD 2Y2JA 5B24B 5B32G 2BYKA 3X1VB 4H9SA 1P3LB 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD D;  4H9R A;  4QLC C;  4J8U B;  3X1U B;  4YM6 B;  5AVC C;  3WKJ A;  1F66 A;  3REI D;  4YS3 A;  3MGS B;  4WU8 D;  3A6N C;  3UTA B;  3X1T D;  3AV2 C;  1P3O B;  4Z66 D;  5B1L A;  4WZS B;  5JRG D;  1ID3 C;  1KX3 C;  3AZH D;  5B40 D;  3LEL C;  2FJ7 A;  4KHA B;  3AZF A;  1P3B A;  1M18 A;  3AZN A;  3TU4 D;  3WAA D;  1N1J B;  4KGC B;  4WV4 B;  3MGR C;  2CV5 B;  4XZQ C;  4XUJ C;  5B0Z B;  3C1B C;  5BO0 A;  5GT0 C;  4AWL B;  3W99 D;  1P3K D;  5B2I A;  3B6G A;  5AV6 A;  1P34 C;  1BH8 A;  3W96 C;  3REK B;  4J8X C;  1JFI B;  5DNM C;  4Z5T B;  3MGQ A;  1WWI A;  3AZI B;  1P3I B;  3REL D;  4X23 D;  5AY8 B;  1M1A C;  1F1E A;  3W97 D;  1P3M A;  4H9N A;  4ZBJ C;  3LJA B;  3AZE C;  4KUD D;  5F99 C;  3X1S C;  4H9Q B;  5B24 C;  3X1V C;  1TZY C;  1P3G D;  1P3L C;  4J8U C;  4YM6 C;  3C1C A;  3KWQ A;  1H3O A;  3KXB B;  4WU9 C;  3UTA C;  3AZK D;  4G92 B;  3AFA D;  3R45 A;  3AYW B;  1P3O C;  3B0C T;  3MGP B;  4JJN A;  4QLC A;  1HTA A;  5AVC A;  3AZL B;  5BT1 D;  4CAY A;  5B32 B;  1WWS A;  5CP6 B;  3O62 B;  3A6N A;  4J8V B;  3AV2 A;  1P3A D;  5B2J D;  3KUY D;  3NQU B;  1P3P D;  1ID3 A;  1KX3 A;  3AZG C;  3LEL A;  3W98 D;  2ARO B;  4NE6 A;  5B0Z C;  5B1M B;  1KX5 B;  2NQB C;  1ZLA B;  4CSR B;  4R8P C;  4J8W C;  5GSU B;  3UT9 D;  3B6F B;  3REK C;  3MGR A;  4XZQ A;  4UUZ B;  3C1B A;  4Z5T C;  5GT0 A;  1KX4 C;  3AZI C;  1P3I C;  5AY8 C;  4Z2M G;  1P34 A;  5JA4 A;  3W96 A;  5CPK C;  2HIO A;  3LJA C;  4J8X A;  5GXQ D;  3V9R A;  5DNM A;  5B0Y B;  1P3F D;  2F8N D;  1KU5 A;  5B31 C;  4WU8 B;  4H9P B;  1M1A A;  3X1T B;  3KXB C;  2NZD D;  5F99 A;  5KDM A;  5JRG B;  4H9O B;  4DRA A;  5B24 A;  3X1V A;  4LD9 D;  4G92 C;  3AYW C;  1TZY A;  5B40 B;  1P3L A;  4J8U A;  4YM6 A;  3AZL C;  3WKJ D;  5AV8 C;  2JSS A;  5B32 C;  1F66 D;  2PYO C;  4YS3 D;  4WU9 A;  3WA9 B;  3O62 C;  3UTA A;  3WAA B;  1P3O A;  2YFW B;  1EQZ B;  4ZUX B;  2ARO C;  5C3I C;  4KHA A;  3AZF D;  3W99 B;  5B1M C;  1P3B D;  4NE5 A;  5CPI B;  3AZN D;  1M18 D;  1KX5 C;  1AOI C;  2F8N H;  1A7W A;  4EO5 B;  4HGA B;  1ULY A;  1N1J A;  5GSU C;  3B6F C;  3AZG A;  3MNN B;  5B0Z A;  3W97 B;  3B6G D;  5B2I D;  5AV6 D;  2NQB A;  4R8P A;  4J8W A;  3REK A;  1JFI A;  4Z5T A;  3MGQ D;  5B0Y C;  3LZ1 D;  1KX4 A;  1R4V A;  3AZI A;  1P3I A;  3X1T C;  1P3M D;  5CPK A;  5GT3 B;  3LJA A;  4H9Q A;  5JRG C;  2BYM B;  2RVQ D;  3C1C D;  5B31 A;  3KWQ D;  3UTB B;  5AV5 B;  5CPJ C;  1HQ3 C;  3KXB A;  5B33 C;  3WA9 C;  1P3P B;  5AVB B;  3AYW A;  4JJN D;  1EQZ C;  4ZUX C;  3KSY A;  5AVC D;  5DNN B;  3AZL A;  3AV1 B;  5AV8 A;  3AZJ C;  2PYO A;  2YFV B;  5CPI C;  3O62 A;  3A6N D;  3AV2 D;  4EO5 C;  1TZY B;  4HGA C;  3VH6 W;  1ID3 D;  4E45 A;  3MNN C;  3LEL D;  5B1M A;  1KX5 A;  1AOI A;  1BH9 B;  5GXQ B;  5AV9 A;  4CSR A;  1M19 D;  5GSU A;  3B6F A;  3MGR D;  4XZQ D;  3VH5 W;  3C1B D;  3X1U C;  5GT0 D;  3LZ0 B;  3MGS C;  2NZD B;  2BYK B;  4LD9 B;  5GT3 C;  1BFM A;  2HIO D;  4NFT A;  4J8X D;  3REJ D;  5DNM D;  4G91 B;  5BT1 C;  5B0Y A;  4YS3 B;  3UTB C;  1U35 B;  4H9P A;  5AV5 C;  3X1T A;  5B24 D;  5JRG A;  3REH B;  1TAF B;  3WTP B;  5AVB C;  4KGC C;  1TZY D;  2CV5 C;  1P3L D;  3NQJ B;  3AN2 B;  4J8U D;  5DNN C;  3AV1 C;  5CPJ A;  1HQ3 A;  4WU9 D;  4AWL C;  3WA9 A;  5B33 A;  1S32 D;  1P3O D;  2YFW A;  1EQZ A;  4XUJ A;  5BO0 B;  4ZUX A;  3AZJ A;  5B2I B;  3WTP E;  5CPI A;  3AZM B;  1BH8 B;  5CHL B;  3MVD B;  5E5A D;  3AZG D;  3MNN A;  3LZ1 B;  3REI B;  2HUE B;  3LZ0 C;  4H9N B;  2NQB D;  3AZE A;  2NZD C;  4Z66 B;  3X1S A;  4R8P D;  4J8W D;  3REK D;  4LD9 C;  3AZH B;  3MGP C;  4G91 C;  3C1C B;  3X1U A;  1KX4 D;  3AZI D;  2IO5 B;  3MGS A;  5CP6 C;  1U35 C;  3TU4 B;  5CPK D;  4J8V C;  5GT3 A;  4WNN B;  4JJN B;  5B1L D;  3REH C;  3WTP C;  2BYM A;  2FJ7 D;  3B0C W;  3AN2 C;  5B31 D;  3UTB A;  1P3K B;  1Q9C A;  3A6N B;  5AV5 A;  3AV2 B;  2F8N G;  3KXB D;  5BS7 C;  3B0D B;  1ZLA C;  5AVB A;  4KGC A;  3AYW D;  3LEL B;  2CV5 A;  3REL B;  4X23 B;  3AZL D;  5DNN A;  3AV1 A;  5AV8 D;  2PYO D;  4KUD B;  2YFV A;  3AZM C;  1M19 B;  3VH6 A;  1P3G B;  3MVD C;  5GT0 B;  3LZ1 C;  5B1M D;  3REI C;  2HUE C;  4WU8 C;  5AY8 A;  1KX5 D;  1AOI D;  1BH9 A;  3AZK B;  3B0B A;  2HIO B;  5B31 G;  3AFA B;  3REJ B;  5AV9 D;  4Z66 C;  1B67 A;  5GSU D;  3AZH C;  5B40 C;  5G49 B;  3C1C C;  3LZ0 A;  2L5A A;  4ZBJ B;  2IO5 C;  1P3A B;  2NZD A;  5B2J B;  5KDM B;  3KUY B;  3TU4 C;  3WAA C;  4LD9 A;  3W98 B;  3MGP A;  4QLC D;  5B0Y D;  5B32 A;  4WU9 B;  3W99 C;  1P3K C;  1U35 A;  5CP6 A;  1S32 B;  3UT9 B;  4J8V A;  2LY8 A;  3B0D C;  5FUG B;  3NQU A;  3REH A;  1TAF A;  3WTP A;  1KX3 D;  3NQJ A;  2ARO A;  3AN2 A;  4NE3 A;  3REL C;  4X23 C;  3W97 C;  5CPJ D;  1HQ3 D;  3WA9 D;  5B33 D;  4KUD C;  5BS7 A;  1M19 C;  1ZLA A;  5E5A B;  3AZG B;  1P3F B;  1P3G C;  1EQZ D;  4XUJ D;  4UUZ A;  4ZUX D;  2F8N B;  5BNV B;  3AZJ D;  5BNX B;  2NQB B;  5CPI D;  1P34 D;  4R8P B;  4J8W B;  3AZM A;  3W96 D;  3AZK C;  2HIO C;  3AFA C;  3REJ C;  4H9R B;  3MVD A;  3MNN D;  3LZ1 A;  1KX4 B;  3WKJ B;  1F66 B;  3REI A;  4WU8 A;  1M1A D;  5CPK B;  3AZE D;  1P3A C;  5B1L B;  5F99 D;  5B2J C;  3X1S D;  4Z66 A;  3KUY C;  1P3P C;  4H9O A;  3X1V D;  3AZH A;  5B40 A;  2FJ7 B;  3W98 C;  3AZF B;  5B31 B;  3X1U D;  4YM6 D;  1P3B B;  1M18 B;  3AZN B;  4DRB A;  3MGS D;  1S32 C;  3UTA D;  3TU4 A;  3WAA A;  3UT9 C;  5GT3 D;  4WNN A;  5AV8 B;  2PYO B;  3UTB D;  3B6G B;  3W99 A;  1P3K A;  5AV6 B;  5AV5 D;  5GXQ C;  5AVB D;  4KGC D;  5E5A C;  3MGQ B;  2CV5 D;  1P3F C;  5C3I B;  5B0Z D;  3REL A;  5DNN D;  4X23 A;  3AV1 D;  1AOI B;  1P3M B;  3W97 A;  4KUD A;  5AV9 B;  1M19 A;  4H9S C;  1P3G A;  4Z5T D;  1H3O B;  3KWQ B;  3WKJ C;  1F66 C;  1P3I D;  4YS3 C;  4Z2M H;  5AY8 D;  2CWE A;  3AZK A;  3R45 B;  3AFA A;  3LJA D;  3REJ A;  5B1L C;  4QLC B;  5AVC B;  2FJ7 C;  4CAY B;  3AZF C;  5G49 A;  1P3B C;  3LZ0 D;  1M18 C;  3AZN C;  1B6W A;  1P3A A;  5B2J A;  3KUY A;  1P3P A;  1ID3 B;  1KX3 B;  2F8N K;  3MGP D;  3W98 A;  5B32 D;  5CPJ B;  1HQ3 B;  3B6G C;  5B33 B;  5B2I C;  3VH6 T;  5CP6 D;  5AV6 C;  4E44 A;  3O62 D;  1U35 D;  1S32 A;  4J8V D;  3UT9 A;  3MGR B;  4XZQ B;  5FUG A;  3REH D;  4XUJ B;  3WTP D;  3C1B B;  4M6B A;  3MGQ C;  3AZJ B;  2ARO D;  3AN2 D;  1P34 B;  5JA4 B;  1P3M C;  3W96 B;  4J8X B;  3VH5 T;  5AV9 C;  5GXQ A;  3V9R B;  5DNM B;  1ZLA D;  3B6F D;  5E5A A;  3VH5 A;  1P3F A;  2RVQ C;  2F8N A;  3KWQ C;  1M1A B;  5BNV A;  5BNX A;  3AZE B;  5F99 B;  3X1S B;  3AZM D;  5B24 B;  5B32 G;  2BYK A;  3X1V B;  4H9S A;  1P3L B;  4JJN C; 
#chains in the Genus database with same CATH topology
 3MVD D;  4H9R A;  4QLC C;  4J8U B;  3X1U B;  4YM6 B;  5AVC C;  3WKJ A;  1F66 A;  3REI D;  4YS3 A;  3MGS B;  4WU8 D;  3A1I A;  3A6N C;  3X1T D;  3UTA B;  3AV2 C;  1P3O B;  4Z66 D;  5B1L A;  4WZS B;  5JRG D;  2Y2P A;  1KX3 C;  2Y2G A;  1ID3 C;  3AZH D;  5B40 D;  3LEL C;  2FJ7 A;  4KHA B;  3AZF A;  1P3B A;  1M18 A;  3AZN A;  3TU4 D;  3WAA D;  1N1J B;  4KGC B;  4WV4 B;  3MGR C;  2CV5 B;  4XZQ C;  4XUJ C;  5B0Z B;  3C1B C;  5BO0 A;  2F2A C;  5GT0 C;  3FDD A;  3KFU G;  4AWL B;  3W99 D;  1P3K D;  5B2I A;  3B6G A;  5AV6 A;  1P34 C;  1BH8 A;  3W96 C;  3REK B;  4J8X C;  1JFI B;  5DNM C;  4Z5T B;  3MGQ A;  1WWI A;  3AZI B;  1P3I B;  3REL D;  4X23 D;  5AY8 B;  1M1A C;  1F1E A;  3W97 D;  1P3M A;  2J8P A;  4H9N A;  4ZBJ C;  3LJA B;  3AZE C;  4KUD D;  5F99 C;  3X1S C;  4H9Q B;  5B24 C;  3X1V C;  1TZY C;  1P3G D;  1P3L C;  4J8U C;  4YM6 C;  3C1C A;  3KWQ A;  1H3O A;  3EPH A;  3KXB B;  4WU9 C;  3UTA C;  4DQY B;  3AZK D;  4G92 B;  3AFA D;  3R45 A;  3AYW B;  1P3O C;  3B0C T;  3MGP B;  4JJN A;  4QLC A;  1HTA A;  5AVC A;  3AZL B;  3H0R C;  5BT1 D;  4CAY A;  5B32 B;  1WWS A;  5CP6 B;  3O62 B;  3A6N A;  4J8V B;  2DQN C;  3AV2 A;  1P3A D;  5B2J D;  3KUY D;  3NQU B;  1P3P D;  1ID3 A;  1KX3 A;  3EPK A;  3AZG C;  3LEL A;  3W98 D;  2ARO B;  4NE6 A;  5B0Z C;  5B1M B;  1KX5 B;  2NQB C;  3EG5 B;  1ZLA B;  4CSR B;  4R8P C;  4J8W C;  5GSU B;  3UT9 D;  3B6F B;  3REK C;  3MGR A;  4XZQ A;  4UUZ B;  3C1B A;  4Z5T C;  5GT0 A;  1KX4 C;  3AZI C;  1P3I C;  5AY8 C;  4Z2M G;  1P34 A;  5JA4 A;  3W96 A;  5CPK C;  2HIO A;  3LJA C;  4J8X A;  5GXQ D;  3V9R A;  5DNM A;  2ZY5 A;  5B0Y B;  1P3F D;  2F8N D;  1KU5 A;  5B31 C;  4WU8 B;  4H9P B;  1M1A A;  3X1T B;  2BG1 A;  3KXB C;  2NZD D;  5F99 A;  5KDM A;  5JRG B;  4H9O B;  4DRA A;  5B24 A;  3X1V A;  4LD9 D;  4G92 C;  3AYW C;  1TZY A;  3EPL A;  5B40 B;  1P3L A;  4J8U A;  4YM6 A;  3AZL C;  3WKJ D;  5AV8 C;  2JSS A;  5B32 C;  1F66 D;  2PYO C;  4YS3 D;  4WU9 A;  3WA9 B;  3O62 C;  3UTA A;  3WAA B;  1P3O A;  2YFW B;  1EQZ B;  4ZUX B;  2ARO C;  5C3I C;  4KHA A;  3AZF D;  3W99 B;  5B1M C;  1P3B D;  4NE5 A;  5CPI B;  2ZY4 A;  3AZN D;  1M18 D;  1KX5 C;  1AOI C;  2F8N H;  1A7W A;  4EO5 B;  4HGA B;  1ULY A;  1N1J A;  5GSU C;  3B6F C;  3AZG A;  3MNN B;  5B0Z A;  3W97 B;  3B6G D;  5B2I D;  5AV6 D;  2NQB A;  4R8P A;  4J8W A;  3REK A;  1JFI A;  4Z5T A;  3MGQ D;  5B0Y C;  3LZ1 D;  1KX4 A;  1R4V A;  3AZI A;  1P3I A;  2G5I C;  3X1T C;  1P3M D;  5CPK A;  5GT3 B;  3LJA A;  4H9Q A;  5JRG C;  2BYM B;  2RVQ D;  3C1C D;  5B31 A;  3KWQ D;  3UTB B;  5AV5 B;  5CPJ C;  1HQ3 C;  3KXB A;  5B33 C;  3WA9 C;  1P3P B;  5AVB B;  2VQR A;  4WJ3 C;  3AYW A;  4JJN D;  1EQZ C;  4ZUX C;  3KSY A;  5AVC D;  5DNN B;  3AZL A;  3AV1 B;  5AV8 A;  3AZJ C;  2PYO A;  2YFV B;  5CPI C;  3O62 A;  3A6N D;  3AV2 D;  4EO5 C;  1TZY B;  4HGA C;  3VH6 W;  1ID3 D;  4E45 A;  3MNN C;  3LEL D;  5B1M A;  1KX5 A;  1AOI A;  1BH9 B;  5GXQ B;  5AV9 A;  4CSR A;  1M19 D;  5GSU A;  3B6F A;  3MGR D;  4XZQ D;  3VH5 W;  3C1B D;  3X1U C;  5GT0 D;  3LZ0 B;  3MGS C;  2NZD B;  2BYK B;  4LD9 B;  5GT3 C;  1BFM A;  2HIO D;  4NFT A;  4J8X D;  3REJ D;  5DNM D;  4G91 B;  5BT1 C;  5B0Y A;  4YS3 B;  3UTB C;  1U35 B;  2XD5 A;  4H9P A;  5AV5 C;  3X1T A;  5B24 D;  5JRG A;  3REH B;  1TAF B;  3WTP B;  5AVB C;  4KGC C;  1TZY D;  2CV5 C;  1P3L D;  3NQJ B;  3AN2 B;  4J8U D;  5DNN C;  3AV1 C;  5CPJ A;  1HQ3 A;  4WU9 D;  4AWL C;  3WA9 A;  5B33 A;  1S32 D;  4UPK A;  1P3O D;  2YFW A;  1EQZ A;  4XUJ A;  5BO0 B;  4ZUX A;  3AZJ A;  5B2I B;  2RIQ A;  3WTP E;  5CPI A;  3AZM B;  3A1K A;  1BH8 B;  5CHL B;  3MVD B;  5E5A D;  3AZG D;  3MNN A;  3P5J B;  3LZ1 B;  3REI B;  2HUE B;  3LZ0 C;  4H9N B;  2NQB D;  3AZE A;  2NZD C;  4Z66 B;  3X1S A;  4R8P D;  4J8W D;  3REK D;  4LD9 C;  3AZH B;  3MGP C;  4G91 C;  2JE5 A;  3C1C B;  3X1U A;  1KX4 D;  2ZY2 A;  3AZI D;  2IO5 B;  3MGS A;  5CP6 C;  1U35 C;  3TU4 B;  5CPK D;  2DF4 C;  5GT3 A;  4J8V C;  4WNN B;  4JJN B;  5B1L D;  3REH C;  3WTP C;  2BYM A;  2FJ7 D;  3B0C W;  3AN2 C;  5B31 D;  3UTB A;  1P3K B;  1Q9C A;  3A6N B;  5AV5 A;  3AV2 B;  2F8N G;  3KXB D;  5BS7 C;  3B0D B;  1ZLA C;  5AVB A;  4KGC A;  3AYW D;  3LEL B;  2CV5 A;  3REL B;  2FFF B;  4X23 B;  5DNN A;  3AZL D;  3AV1 A;  5AV8 D;  2PYO D;  2G5H C;  4KUD B;  2YFV A;  3AZM C;  1M19 B;  3VH6 A;  1P3G B;  3MVD C;  5GT0 B;  3LZ1 C;  5B1M D;  3REI C;  2HUE C;  1PZR A;  4WU8 C;  5AY8 A;  1KX5 D;  1AOI D;  1BH9 A;  3AZK B;  3B0B A;  2HIO B;  5B31 G;  3AFA B;  3REJ B;  5AV9 D;  4Z66 C;  1B67 A;  5GSU D;  3AZH C;  5B40 C;  5G49 B;  3C1C C;  3LZ0 A;  2L5A A;  4ZBJ B;  2IO5 C;  1P3A B;  2NZD A;  5B2J B;  5KDM B;  3KUY B;  3TU4 C;  3WAA C;  4LD9 A;  3W98 B;  3MGP A;  4QLC D;  5B0Y D;  5B32 A;  4WU9 B;  3W99 C;  1P3K C;  1U35 A;  5CP6 A;  1S32 B;  3UT9 B;  4J8V A;  2LY8 A;  3B0D C;  3H0M C;  5FUG B;  3NQU A;  3REH A;  1TAF A;  3WTP A;  1KX3 D;  3NQJ A;  2ARO A;  3AN2 A;  4NE3 A;  3REL C;  2JCH A;  4X23 C;  3AL0 C;  3W97 C;  5CPJ D;  1HQ3 D;  3WA9 D;  5B33 D;  4KUD C;  5BS7 A;  1M19 C;  1ZLA A;  5E5A B;  3AZG B;  1P3F B;  1P3G C;  1EQZ D;  2Y2Q A;  4XUJ D;  4UUZ A;  4ZUX D;  2F8N B;  5BNV B;  3AZJ D;  5BNX B;  2NQB B;  5CPI D;  1P34 D;  4R8P B;  4J8W B;  3AZM A;  3W96 D;  3AZK C;  2HIO C;  3AFA C;  3REJ C;  4H9R B;  3MVD A;  3MNN D;  3LZ1 A;  1KX4 B;  3WKJ B;  1F66 B;  3F6T A;  3REI A;  4WU8 A;  1M1A D;  5CPK B;  3AZE D;  1P3A C;  5B1L B;  5F99 D;  5B2J C;  3X1S D;  4Z66 A;  3KUY C;  1P3P C;  4H9O A;  3X1V D;  3AZH A;  3EPJ A;  5B40 A;  2FJ7 B;  3W98 C;  3AZF B;  5B31 B;  3X1U D;  4YM6 D;  1P3B B;  1M18 B;  3AZN B;  4DRB A;  3H0L C;  2ZM5 A;  3MGS D;  1S32 C;  3UTA D;  3TU4 A;  3WAA A;  3UT9 C;  5GT3 D;  4WNN A;  2Y2O A;  2Y2L A;  2XD1 A;  5AV8 B;  2PYO B;  3UTB D;  3B6G B;  3W99 A;  1P3K A;  3IP4 C;  5AV6 B;  1T3U A;  5AV5 D;  5GXQ C;  5AVB D;  4KGC D;  1Z2C B;  5E5A C;  2Y2H A;  3MGQ B;  2CV5 D;  1P3F C;  5C3I B;  5B0Z D;  3REL A;  2Y2M A;  5DNN D;  4X23 A;  3AV1 D;  1AOI B;  1P3M B;  3W97 A;  4KUD A;  5AV9 B;  1M19 A;  2Y2I A;  4H9S C;  2W8S A;  1W2E A;  1P3G A;  4Z5T D;  1H3O B;  3KWQ B;  3WKJ C;  1F66 C;  1P3I D;  4YS3 C;  4Z2M H;  5AY8 D;  2CWE A;  3AZK A;  3R45 B;  3AFA A;  3LJA D;  3REJ A;  5B1L C;  4QLC B;  5AVC B;  2FJ7 C;  4CAY B;  3AZF C;  5G49 A;  1P3B C;  3LZ0 D;  1M18 C;  3AZN C;  2Y2K A;  1B6W A;  1P3A A;  2ZY3 A;  5B2J A;  3KUY A;  1P3P A;  1ID3 B;  1KX3 B;  2F8N K;  3MGP D;  3W98 A;  5B32 D;  5CPJ B;  1HQ3 B;  3B6G C;  5B33 B;  5B2I C;  3VH6 T;  5CP6 D;  5AV6 C;  4E44 A;  3O62 D;  1U35 D;  1S32 A;  4J8V D;  2Y2N A;  3UT9 A;  3MGR B;  4XZQ B;  5FUG A;  3REH D;  4XUJ B;  3WTP D;  3C1B B;  4M6B A;  3MGQ C;  3AZJ B;  2ARO D;  3AN2 D;  1P34 B;  5JA4 B;  1P3M C;  3W96 B;  4J8X B;  5AV9 C;  3VH5 T;  5GXQ A;  3V9R B;  5DNM B;  1ZLA D;  3B6F D;  5E5A A;  3VH5 A;  1P3F A;  2UWX A;  2RVQ C;  2F8N A;  3KWQ C;  1M1A B;  5BNV A;  5BNX A;  3AZE B;  5F99 B;  3X1S B;  3AZM D;  2Y2J A;  5B24 B;  5B32 G;  2BYK A;  3X1V B;  4H9S A;  1P3L B;  4JJN C; 
#chains in the Genus database with same CATH homology
 3MVD D;  4H9R A;  4QLC C;  4J8U B;  3X1U B;  4YM6 B;  5AVC C;  3WKJ A;  1F66 A;  3REI D;  4YS3 A;  3MGS B;  4WU8 D;  3A1I A;  3A6N C;  3X1T D;  3UTA B;  3AV2 C;  1P3O B;  4Z66 D;  5B1L A;  4WZS B;  5JRG D;  2Y2P A;  1KX3 C;  2Y2G A;  1ID3 C;  3AZH D;  5B40 D;  3LEL C;  2FJ7 A;  4KHA B;  3AZF A;  1P3B A;  1M18 A;  3AZN A;  3TU4 D;  3WAA D;  1N1J B;  4KGC B;  4WV4 B;  3MGR C;  2CV5 B;  4XZQ C;  4XUJ C;  5B0Z B;  3C1B C;  5BO0 A;  2F2A C;  5GT0 C;  3FDD A;  3KFU G;  4AWL B;  3W99 D;  1P3K D;  5B2I A;  3B6G A;  5AV6 A;  1P34 C;  1BH8 A;  3W96 C;  3REK B;  4J8X C;  1JFI B;  5DNM C;  4Z5T B;  3MGQ A;  1WWI A;  3AZI B;  1P3I B;  3REL D;  4X23 D;  5AY8 B;  1M1A C;  1F1E A;  3W97 D;  1P3M A;  2J8P A;  4H9N A;  4ZBJ C;  3LJA B;  3AZE C;  4KUD D;  5F99 C;  3X1S C;  4H9Q B;  5B24 C;  3X1V C;  1TZY C;  1P3G D;  1P3L C;  4J8U C;  4YM6 C;  3C1C A;  3KWQ A;  1H3O A;  3EPH A;  3KXB B;  4WU9 C;  3UTA C;  4DQY B;  3AZK D;  4G92 B;  3AFA D;  3R45 A;  3AYW B;  1P3O C;  3B0C T;  3MGP B;  4JJN A;  4QLC A;  1HTA A;  5AVC A;  3AZL B;  3H0R C;  5BT1 D;  4CAY A;  5B32 B;  1WWS A;  5CP6 B;  3O62 B;  3A6N A;  4J8V B;  2DQN C;  3AV2 A;  1P3A D;  5B2J D;  3KUY D;  3NQU B;  1P3P D;  1ID3 A;  1KX3 A;  3EPK A;  3AZG C;  3LEL A;  3W98 D;  2ARO B;  4NE6 A;  5B0Z C;  5B1M B;  1KX5 B;  2NQB C;  3EG5 B;  1ZLA B;  4CSR B;  4R8P C;  4J8W C;  5GSU B;  3UT9 D;  3B6F B;  3REK C;  3MGR A;  4XZQ A;  4UUZ B;  3C1B A;  4Z5T C;  5GT0 A;  1KX4 C;  3AZI C;  1P3I C;  5AY8 C;  4Z2M G;  1P34 A;  5JA4 A;  3W96 A;  5CPK C;  2HIO A;  3LJA C;  4J8X A;  5GXQ D;  3V9R A;  5DNM A;  2ZY5 A;  5B0Y B;  1P3F D;  2F8N D;  1KU5 A;  5B31 C;  4WU8 B;  4H9P B;  1M1A A;  3X1T B;  2BG1 A;  3KXB C;  2NZD D;  5F99 A;  5KDM A;  5JRG B;  4H9O B;  4DRA A;  5B24 A;  3X1V A;  4LD9 D;  4G92 C;  3AYW C;  1TZY A;  3EPL A;  5B40 B;  1P3L A;  4J8U A;  4YM6 A;  3AZL C;  3WKJ D;  5AV8 C;  2JSS A;  5B32 C;  1F66 D;  2PYO C;  4YS3 D;  4WU9 A;  3WA9 B;  3O62 C;  3UTA A;  3WAA B;  1P3O A;  2YFW B;  1EQZ B;  4ZUX B;  2ARO C;  5C3I C;  4KHA A;  3AZF D;  3W99 B;  5B1M C;  1P3B D;  4NE5 A;  5CPI B;  2ZY4 A;  3AZN D;  1M18 D;  1KX5 C;  1AOI C;  2F8N H;  1A7W A;  4EO5 B;  4HGA B;  1ULY A;  1N1J A;  5GSU C;  3B6F C;  3AZG A;  3MNN B;  5B0Z A;  3W97 B;  3B6G D;  5B2I D;  5AV6 D;  2NQB A;  4R8P A;  4J8W A;  3REK A;  1JFI A;  4Z5T A;  3MGQ D;  5B0Y C;  3LZ1 D;  1KX4 A;  1R4V A;  3AZI A;  1P3I A;  2G5I C;  3X1T C;  1P3M D;  5CPK A;  5GT3 B;  3LJA A;  4H9Q A;  5JRG C;  2BYM B;  2RVQ D;  3C1C D;  5B31 A;  3KWQ D;  3UTB B;  5AV5 B;  5CPJ C;  1HQ3 C;  3KXB A;  5B33 C;  3WA9 C;  1P3P B;  5AVB B;  2VQR A;  4WJ3 C;  3AYW A;  4JJN D;  1EQZ C;  4ZUX C;  3KSY A;  5AVC D;  5DNN B;  3AZL A;  3AV1 B;  5AV8 A;  3AZJ C;  2PYO A;  2YFV B;  5CPI C;  3O62 A;  3A6N D;  3AV2 D;  4EO5 C;  1TZY B;  4HGA C;  3VH6 W;  1ID3 D;  4E45 A;  3MNN C;  3LEL D;  5B1M A;  1KX5 A;  1AOI A;  1BH9 B;  5GXQ B;  5AV9 A;  4CSR A;  1M19 D;  5GSU A;  3B6F A;  3MGR D;  4XZQ D;  3VH5 W;  3C1B D;  3X1U C;  5GT0 D;  3LZ0 B;  3MGS C;  2NZD B;  2BYK B;  4LD9 B;  5GT3 C;  1BFM A;  2HIO D;  4NFT A;  4J8X D;  3REJ D;  5DNM D;  4G91 B;  5BT1 C;  5B0Y A;  4YS3 B;  3UTB C;  1U35 B;  2XD5 A;  4H9P A;  5AV5 C;  3X1T A;  5B24 D;  5JRG A;  3REH B;  1TAF B;  3WTP B;  5AVB C;  4KGC C;  1TZY D;  2CV5 C;  1P3L D;  3NQJ B;  3AN2 B;  4J8U D;  5DNN C;  3AV1 C;  5CPJ A;  1HQ3 A;  4WU9 D;  4AWL C;  3WA9 A;  5B33 A;  1S32 D;  4UPK A;  1P3O D;  2YFW A;  1EQZ A;  4XUJ A;  5BO0 B;  4ZUX A;  3AZJ A;  5B2I B;  2RIQ A;  3WTP E;  5CPI A;  3AZM B;  3A1K A;  1BH8 B;  5CHL B;  3MVD B;  5E5A D;  3AZG D;  3MNN A;  3P5J B;  3LZ1 B;  3REI B;  2HUE B;  3LZ0 C;  4H9N B;  2NQB D;  3AZE A;  2NZD C;  4Z66 B;  3X1S A;  4R8P D;  4J8W D;  3REK D;  4LD9 C;  3AZH B;  3MGP C;  4G91 C;  2JE5 A;  3C1C B;  3X1U A;  1KX4 D;  2ZY2 A;  3AZI D;  2IO5 B;  3MGS A;  5CP6 C;  1U35 C;  3TU4 B;  5CPK D;  2DF4 C;  5GT3 A;  4J8V C;  4WNN B;  4JJN B;  5B1L D;  3REH C;  3WTP C;  2BYM A;  2FJ7 D;  3B0C W;  3AN2 C;  5B31 D;  3UTB A;  1P3K B;  1Q9C A;  3A6N B;  5AV5 A;  3AV2 B;  2F8N G;  3KXB D;  5BS7 C;  3B0D B;  1ZLA C;  5AVB A;  4KGC A;  3AYW D;  3LEL B;  2CV5 A;  3REL B;  2FFF B;  4X23 B;  5DNN A;  3AZL D;  3AV1 A;  5AV8 D;  2PYO D;  2G5H C;  4KUD B;  2YFV A;  3AZM C;  1M19 B;  3VH6 A;  1P3G B;  3MVD C;  5GT0 B;  3LZ1 C;  5B1M D;  3REI C;  2HUE C;  1PZR A;  4WU8 C;  5AY8 A;  1KX5 D;  1AOI D;  1BH9 A;  3AZK B;  3B0B A;  2HIO B;  5B31 G;  3AFA B;  3REJ B;  5AV9 D;  4Z66 C;  1B67 A;  5GSU D;  3AZH C;  5B40 C;  5G49 B;  3C1C C;  3LZ0 A;  2L5A A;  4ZBJ B;  2IO5 C;  1P3A B;  2NZD A;  5B2J B;  5KDM B;  3KUY B;  3TU4 C;  3WAA C;  4LD9 A;  3W98 B;  3MGP A;  4QLC D;  5B0Y D;  5B32 A;  4WU9 B;  3W99 C;  1P3K C;  1U35 A;  5CP6 A;  1S32 B;  3UT9 B;  4J8V A;  2LY8 A;  3B0D C;  3H0M C;  5FUG B;  3NQU A;  3REH A;  1TAF A;  3WTP A;  1KX3 D;  3NQJ A;  2ARO A;  3AN2 A;  4NE3 A;  3REL C;  2JCH A;  4X23 C;  3AL0 C;  3W97 C;  5CPJ D;  1HQ3 D;  3WA9 D;  5B33 D;  4KUD C;  5BS7 A;  1M19 C;  1ZLA A;  5E5A B;  3AZG B;  1P3F B;  1P3G C;  1EQZ D;  2Y2Q A;  4XUJ D;  4UUZ A;  4ZUX D;  2F8N B;  5BNV B;  3AZJ D;  5BNX B;  2NQB B;  5CPI D;  1P34 D;  4R8P B;  4J8W B;  3AZM A;  3W96 D;  3AZK C;  2HIO C;  3AFA C;  3REJ C;  4H9R B;  3MVD A;  3MNN D;  3LZ1 A;  1KX4 B;  3WKJ B;  1F66 B;  3F6T A;  3REI A;  4WU8 A;  1M1A D;  5CPK B;  3AZE D;  1P3A C;  5B1L B;  5F99 D;  5B2J C;  3X1S D;  4Z66 A;  3KUY C;  1P3P C;  4H9O A;  3X1V D;  3AZH A;  3EPJ A;  5B40 A;  2FJ7 B;  3W98 C;  3AZF B;  5B31 B;  3X1U D;  4YM6 D;  1P3B B;  1M18 B;  3AZN B;  4DRB A;  3H0L C;  2ZM5 A;  3MGS D;  1S32 C;  3UTA D;  3TU4 A;  3WAA A;  3UT9 C;  5GT3 D;  4WNN A;  2Y2O A;  2Y2L A;  2XD1 A;  5AV8 B;  2PYO B;  3UTB D;  3B6G B;  3W99 A;  1P3K A;  3IP4 C;  5AV6 B;  1T3U A;  5AV5 D;  5GXQ C;  5AVB D;  4KGC D;  1Z2C B;  5E5A C;  2Y2H A;  3MGQ B;  2CV5 D;  1P3F C;  5C3I B;  5B0Z D;  3REL A;  2Y2M A;  5DNN D;  4X23 A;  3AV1 D;  1AOI B;  1P3M B;  3W97 A;  4KUD A;  5AV9 B;  1M19 A;  2Y2I A;  4H9S C;  2W8S A;  1W2E A;  1P3G A;  4Z5T D;  1H3O B;  3KWQ B;  3WKJ C;  1F66 C;  1P3I D;  4YS3 C;  4Z2M H;  5AY8 D;  2CWE A;  3AZK A;  3R45 B;  3AFA A;  3LJA D;  3REJ A;  5B1L C;  4QLC B;  5AVC B;  2FJ7 C;  4CAY B;  3AZF C;  5G49 A;  1P3B C;  3LZ0 D;  1M18 C;  3AZN C;  2Y2K A;  1B6W A;  1P3A A;  2ZY3 A;  5B2J A;  3KUY A;  1P3P A;  1ID3 B;  1KX3 B;  2F8N K;  3MGP D;  3W98 A;  5B32 D;  5CPJ B;  1HQ3 B;  3B6G C;  5B33 B;  5B2I C;  3VH6 T;  5CP6 D;  5AV6 C;  4E44 A;  3O62 D;  1U35 D;  1S32 A;  4J8V D;  2Y2N A;  3UT9 A;  3MGR B;  4XZQ B;  5FUG A;  3REH D;  4XUJ B;  3WTP D;  3C1B B;  4M6B A;  3MGQ C;  3AZJ B;  2ARO D;  3AN2 D;  1P34 B;  5JA4 B;  1P3M C;  3W96 B;  4J8X B;  5AV9 C;  3VH5 T;  5GXQ A;  3V9R B;  5DNM B;  1ZLA D;  3B6F D;  5E5A A;  3VH5 A;  1P3F A;  2UWX A;  2RVQ C;  2F8N A;  3KWQ C;  1M1A B;  5BNV A;  5BNX A;  3AZE B;  5F99 B;  3X1S B;  3AZM D;  2Y2J A;  5B24 B;  5B32 G;  2BYK A;  3X1V B;  4H9S A;  1P3L B;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...