3B6GB

Nucleosome core particle treated with oxaliplatin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gB00
5BS7A 3WTPE 3C1BA 1F1EA 4XUJD 3W98A 3X1SB 4XUJB 3V9RB 4KGCD 1EQZA 4Z66A 4KGCB 3O62C 4CAYB 5C3IB 1BH9B 5AVBD 5AVBB 2HUEC 3AV2C 5BNVB 3AFAC 1HQ3D 5BNXA 1ZLAC 1HQ3B 5B2JD 5E5AB 3AV2A 2NZDD 3WKJC 4H9NA 2NZDB 5JRGC 5B32C 3AFAA 3B6GC 4H9RB 3MGQB 3VH5A 3UTAD 1KX4C 1M18C 1ZLAA 3WAAD 3UTAB 3WAAB 1S32C 5B0YD 1P3AB 5AY8C 3WKJA 2F8NH 5JRGA 5B32A 5B0YB 1P3IC 1BFMA 3B6GA 3W97D 1KX4A 3W97B 1M18A 4CSRB 1N1JB 4NE3A 5BT1C 3X1UD 1S32A 2YFVB 5DNNC 5AY8A 3TU4C 1P3IA 5AV9C 3RELD 5AVCC 3AN2C 4J8VC 5DNNA 2NQBD 3TU4A 5B33B 5AV9A 1P3LD 4H9SA 5AVCA 3KXBA 3REKC 1P3LB 1P3OB 3AN2A 1M19B 3KWQC 3LJAC 3AZID 4J8VA 3AZIB 1U35D 5BO0A 5G49A 1U35B 3REKA 5B31D 1BH8A 3LJAA 3UT9A 1P3FB 2PYOA 3MGSC 3KUYD 3KUYB 3AZKC 4R8PB 3LZ1D 4WNNA 3LZ1B 3A6ND 4J8UB 3WA9C 3MGSA 3AZJC 3NQJB 4H9PA 5GT0C 4UUZA 3AZKA 3B6FD 1F66C 3B6FB 3X1VD 3MNND 3MNNB 5GT3D 2AROD 3WA9A 5GT3B 2AROB 4H9OB 3AZHC 3AZJA 5GT0A 3MGRC 1AOIC 3B0BA 5F99C 2F8ND 1F66A 2F8NB 4J8WD 3AZLD 4J8WB 4YM6D 3LZ0C 3AZLB 2CV5C 4YM6B 3AZHA 3UTBD 4ZUXC 3MGRA 1KX5C 3AYWB 5F99A 5B2IC 5B24D 3UTBB 1AOIA 4LD9C 5B24B 5DNMB 4YS3B 1KX3D 3MGPB 5GSUD 1KX3B 4XZQC 2CV5A 4G92C 5GSUB 3AZFC 1P3BD 5B32G 1P3BB 3AV1A 4ZUXA 1KX5A 4KHAA 5B2IA 5B1LC 4WU9B 1ID3C 3C1CC 3REHC 4XZQA 3AZFA 1P3KC 1P3PD 4NE6A 1P3PB 1ID3A 5B1LA 3C1CA 3X1TD 1P3KA 4WZSB 3X1TB 3MVDA 3WTPC 3REIB 4Z5TC 5B40D 5B40B 1H3OB 4QLCC 4J8XD 3REJD 5AV5A 4X23C 4J8XB 3REJB 3X1SD 3R45A 3WTPA 3W96D 4Z5TA 5CPKA 3W96B 5AV8B 4HGAC 4QLCA 4X23A 3W98B 1EQZD 4Z66D 1EQZB 4Z66B 4KGCC 5CPIC 3O62A 4KUDC 5E5AD 3AZMC 4WU8C 4KGCA 5B0ZC 5CPIA 3MGQD 5BNXB 3AV2D 3VH6T 2HUEB 3AV2B 4KUDA 5B2JC 3AFAD 4Z2MG 4H9NB 3AZMA 4WU8A 3AFAB 1P3AD 5B1MC 5B0ZA 1ZLAB 1TZYC 3WKJD 5B2JA 5JRGD 4E44A 5B32D 3WKJB 3VH5W 5JRGB 5B32B 3B6GD 5B1MA 3B6GB 1KX4B 1Q9CA 1M18B 5JA4B 1TZYA 5KDMA 1S32D 5AY8D 1S32B 1P3ID 4H9QA 5AY8B 3X1UC 2LY8A 1P3IB 2L5AA 5B33D 1M1AD 5BT1D 3RELC 1M1AB 3VH6A 1P3OD 1M19D 3AZEC 3TU4D 4E45A 5DNNB 4AWLC 3TU4B 3X1UA 2NQBC 5AVCD 5AV9B 3KXBD 1HTAA 4JJNC 5AVCB 3KXBB 3AN2B 3RELA 4J8VD 3AZEA 2IO5C 4J8VB 3KWQA 5BO0B 1P3FD 5G49B 2NQBA 4ZBJC 3REKD 4JJNA 3REKB 4R8PD 3UT9D 3LJAB 2PYOD 3LELC 3UT9B 5B31C 2BYKA 2PYOB 4J8UD 3KUYC 4WNNB 3LELA 3MGSD 5B31A 3MGSB 3A6NC 3AZKD 1P3GC 5FUGA 1P3MC 3KUYA 4H9PB 3AZKB 4UUZB 4G91C 3WA9D 3X1VC 3AZJD 2YFWA 3WA9B 3A6NA 5GT0D 3AZJB 1P3GA 1P3MA 5GT0B 3AYWD 1JFIA 5DNMD 4YS3D 3MGPD 5CP6C 3AZGC 3X1VA 1R4VA 3AZHD 3LZ0A 3MGRD 3AZHB 1AOID 5F99D 3MGRB 3AZNC 5F99B 1AOIB 3UTBC 3B0CW 4WU9D 2CV5D 4LD9A 5CP6A 2CV5B 3AZGA 3AV1D 4ZUXD 5CPJC 1KX5D 3AV1B 5B2ID 4ZUXB 1KX5B 3AZNA 4KHAB 5B2IB 2HIOC 4XZQD 4XZQB 3AZFD 3B0DC 5AV6C 3REHA 3AZFB 2BYMA 4WV4B 5CPJA 1ID3D 5B1LD 3C1CD 1ID3B 5B1LB 2HIOA 3C1CB 3REID 1TAFB 2FJ7C 1P3KD 3W99C 5AV6A 1P3KB 3MVDD 3MVDB 1P34C 4EO5C 5GXQC 2FJ7A 5AV8D 3W99A 5AV5D 3C1BD 5AV5B 3WTPD 3C1BB 4J8XC 3REJC 4Z5TD 5CPKD 1P34A 3R45B 3WTPB 3W98D 5GXQA 4Z5TB 5CPKB 4DRBA 3X1SC 4XUJC 4QLCD 2RVQD 4QLCB 4X23D 3NQUA 4X23B 4J8XA 3REJA 5C3IC 3X1SA 5AVBC 4XUJA 3V9RA 5B31G 4HGAB 3VH5T 3O62D 3O62B 4CAYA 1BH9A 1HQ3C 5AVBA 5E5AC 5CPID 5BNVA 4NE5A 5CPIB 2NZDC 4KUDD 1ZLAD 3MGQC 4KUDB 3AZMD 4WU8D 1ULYA 1HQ3A 3UTAC 5B0ZD 5E5AA 4WU8B 3AZMB 3WAAC 5B0ZB 1P3AC 2NZDA 4Z2MH 5B0YC 1KX4D 1M18D 4H9RA 3MGQA 5B2JB 3W97C 2F8NG 5B1MD 3UTAA 5B1MB 3WAAA 1P3AA 1TZYD 5B0YA 1TZYB 5KDMB 3W97A 4CSRA 4H9QB 1KU5A 1N1JA 5DNND 2YFVA 5AV9D 5B33C 5JA4A 3AN2D 1M1AC 1M19C 1P3LC 1P3OC 3X1UB 3VH6W 3KSYA 3AZIC 2F8NK 4H9SC 5B33A 3NQUB 3KXBC 3RELB 3AZED 1U35C 3AZEB 1M1AA 3KWQD 3LJAD 1BH8B 4AWLB 1P3LA 1P3OA 3KWQB 4NFTA 1M19A 2NQBB 4DRAA 4JJND 1P3FC 3AZIA 4JJNB 1U35A 1WWIA 2IO5B 4R8PC 3UT9C 2BYKB 2PYOC 3LZ1C 5CHLB 4ZBJB 4J8UC 1P3FA 3LELD 4R8PA 3LELB 3B0CT 1B6WA 5B31B 3B6FC 3LZ1A 5FUGB 3MNNC 4J8UA 5GT3C 2AROC 2JSSA 1F66D 3NQJA 1F66B 1P3MD 2YFWB 1P3GD 3B6FA 3A6NB 4J8WC 1P3GB 1P3MB 3AZLC 3MNNA 4YM6C 5GT3A 2AROA 4H9OA 1JFIB 4G91B 3AYWC 3X1VB 2F8NA 5DNMC 5B24C 3LZ0D 4YS3C 3MGPC 4J8WA 3LZ0B 1KX3C 3AZLA 5GSUC 4YM6A 1P3BC 4LD9D 5CP6D 3AZGD 3AYWA 3UTBA 4WU9C 4LD9B 5CP6B 1A7WA 3AZGB 5DNMA 5B24A 4YS3A 3MGPA 4G92B 3AZND 1KX3A 5GSUA 3AV1C 3AZNB 1WWSA 1P3BA 2CWEA 4M6BA 1P3PC 4WU9A 3REHD 3REHB 5CPJD 2BYMB 1B67A 5CPJB 2HIOD 2HIOB 3X1TC 1P3PA 5AV6D 3REIC 3B0DB 5AV6B 5B40C 3MVDC 3X1TA 2FJ7D 1TAFA 3W99D 2FJ7B 3REIA 3W99B 3W96C 5AV8C 1P34D 5AV5C 5GXQD 5BS7C 1H3OA 4EO5B 5B40A 3C1BC 1P34B 5GXQB 3W98C 5CPKC 1EQZC 3W96A 4Z66C 5AV8A 2RVQC
chains in the Genus database with same CATH superfamily
5BS7A 3WTPE 3C1BA 1F1EA 4XUJD 3W98A 3X1SB 4XUJB 3V9RB 4KGCD 1EQZA 4Z66A 4KGCB 3FDDA 3O62C 4CAYB 5C3IB 1BH9B 5AVBD 5AVBB 2HUEC 3AV2C 5BNVB 3AFAC 1HQ3D 5BNXA 1ZLAC 1HQ3B 5B2JD 5E5AB 3AV2A 2NZDD 3WKJC 4H9NA 2NZDB 5JRGC 5B32C 3AFAA 3B6GC 4H9RB 2DF4C 3MGQB 3VH5A 3UTAD 1KX4C 1M18C 1ZLAA 3WAAD 3UTAB 3WAAB 1S32C 5B0YD 1P3AB 5AY8C 3WKJA 2F8NH 5JRGA 5B32A 5B0YB 1P3IC 3KFUG 1BFMA 3B6GA 3W97D 1KX4A 3W97B 1M18A 4CSRB 1N1JB 4NE3A 5BT1C 3X1UD 1S32A 2YFVB 5DNNC 5AY8A 3TU4C 1P3IA 5AV9C 3RELD 5AVCC 3AN2C 4J8VC 5DNNA 1T3UA 2NQBD 3TU4A 5B33B 5AV9A 1P3LD 4H9SA 5AVCA 3KXBA 3REKC 1P3LB 1P3OB 3AN2A 1M19B 3KWQC 3LJAC 3AZID 4J8VA 3EPHA 3AZIB 1U35D 5BO0A 5G49A 1U35B 3REKA 5B31D 1BH8A 3LJAA 3UT9A 1P3FB 2PYOA 3MGSC 3KUYD 3KUYB 3AZKC 4R8PB 3LZ1D 2ZY5A 4WNNA 3LZ1B 1PZRA 3A6ND 4J8UB 3WA9C 3MGSA 2W8SA 2ZY2A 3AZJC 3NQJB 4H9PA 5GT0C 4UUZA 3AZKA 3B6FD 3EG5B 1F66C 3B6FB 3P5JB 3X1VD 3MNND 3MNNB 5GT3D 2AROD 3WA9A 5GT3B 2AROB 4H9OB 3AZHC 3AZJA 5GT0A 3MGRC 1AOIC 2XD1A 3B0BA 5F99C 2F8ND 1F66A 2F8NB 4J8WD 3AZLD 4J8WB 4YM6D 3LZ0C 3AZLB 2CV5C 4YM6B 3AZHA 3UTBD 2J8PA 4ZUXC 3MGRA 1KX5C 3AYWB 5F99A 5B2IC 5B24D 3UTBB 1AOIA 4LD9C 5B24B 5DNMB 4YS3B 1KX3D 3MGPB 5GSUD 1KX3B 2DQNC 4XZQC 4G92C 5GSUB 2CV5A 4WJ3C 3AZFC 1P3BD 5B32G 1P3BB 3AV1A 4ZUXA 1KX5A 4KHAA 5B2IA 5B1LC 4WU9B 1ID3C 3C1CC 3REHC 4XZQA 3AZFA 1P3KC 1P3PD 4NE6A 2VQRA 1P3PB 1ID3A 5B1LA 3C1CA 3X1TD 1P3KA 4WZSB 3X1TB 3A1KA 3MVDA 3WTPC 3REIB 4Z5TC 1W2EA 5B40D 5B40B 1H3OB 4QLCC 4J8XD 3REJD 5AV5A 2FFFB 4X23C 4J8XB 3REJB 3X1SD 3R45A 3WTPA 3W96D 4Z5TA 5CPKA 2UWXA 3W96B 2BG1A 5AV8B 4HGAC 4QLCA 4X23A 3W98B 1EQZD 2Y2KA 4Z66D 1EQZB 4Z66B 4KGCC 5CPIC 3IP4C 3O62A 4KUDC 5E5AD 3AZMC 4WU8C 4KGCA 5B0ZC 5CPIA 3MGQD 5BNXB 3AV2D 3VH6T 2HUEB 3AV2B 4KUDA 5B2JC 3AFAD 4Z2MG 4H9NB 3AZMA 4WU8A 3AFAB 1P3AD 5B1MC 5B0ZA 2ZY4A 1ZLAB 1TZYC 3WKJD 5B2JA 5JRGD 4E44A 5B32D 3WKJB 3VH5W 5JRGB 5B32B 3B6GD 5B1MA 3B6GB 1KX4B 1Q9CA 1M18B 5JA4B 1TZYA 5KDMA 1S32D 5AY8D 1S32B 1P3ID 4H9QA 5AY8B 3X1UC 2LY8A 1P3IB 2L5AA 5B33D 2JE5A 1M1AD 5BT1D 3RELC 1M1AB 3VH6A 1P3OD 1M19D 3AZEC 3TU4D 4E45A 5DNNB 4AWLC 3TU4B 3X1UA 2NQBC 5AVCD 5AV9B 3KXBD 1HTAA 4JJNC 5AVCB 3KXBB 3EPLA 2Y2GA 3AN2B 2XD5A 4J8VD 2Y2NA 3RELA 3AZEA 2IO5C 4J8VB 3KWQA 5BO0B 1P3FD 5G49B 2NQBA 4ZBJC 3REKD 4JJNA 3REKB 4R8PD 3UT9D 3LJAB 2PYOD 3LELC 3UT9B 5B31C 2BYKA 2PYOB 4J8UD 3KUYC 4WNNB 3LELA 3MGSD 5B31A 3MGSB 2Y2QA 3A6NC 3AZKD 1P3GC 5FUGA 1P3MC 3KUYA 4H9PB 3AZKB 4UUZB 2ZY3A 4G91C 3WA9D 3X1VC 3AZJD 2YFWA 3WA9B 3A6NA 5GT0D 3AZJB 1P3GA 1P3MA 5GT0B 3AYWD 1JFIA 5DNMD 4YS3D 3MGPD 5CP6C 3AZGC 3X1VA 1R4VA 3AZHD 3LZ0A 3MGRD 3AZHB 1AOID 5F99D 3MGRB 3AZNC 5F99B 1AOIB 3UTBC 3B0CW 4WU9D 2CV5D 4LD9A 5CP6A 2CV5B 3AZGA 4DQYB 3AV1D 3A1IA 4ZUXD 5CPJC 1KX5D 3AV1B 5B2ID 4ZUXB 1KX5B 3AZNA 4KHAB 5B2IB 2HIOC 4XZQD 4XZQB 3AZFD 3B0DC 5AV6C 3REHA 3AZFB 2BYMA 4WV4B 5CPJA 1ID3D 5B1LD 3C1CD 1ID3B 5B1LB 2HIOA 3C1CB 3H0RC 3REID 1TAFB 2FJ7C 1P3KD 3W99C 5AV6A 1P3KB 3MVDD 3MVDB 1P34C 4EO5C 5GXQC 2FJ7A 5AV8D 3W99A 5AV5D 3C1BD 5AV5B 4UPKA 3WTPD 3C1BB 4J8XC 3REJC 4Z5TD 5CPKD 1P34A 3R45B 3WTPB 3W98D 5GXQA 4Z5TB 5CPKB 4DRBA 3X1SC 4XUJC 4QLCD 2RVQD 4QLCB 4X23D 2RIQA 3NQUA 4X23B 4J8XA 3REJA 5C3IC 3X1SA 5AVBC 4XUJA 3V9RA 5B31G 4HGAB 3VH5T 3O62D 3O62B 2Y2IA 4CAYA 1BH9A 1HQ3C 5AVBA 2G5IC 5E5AC 5CPID 5BNVA 4NE5A 5CPIB 2NZDC 4KUDD 1ZLAD 3MGQC 4KUDB 3AZMD 4WU8D 1ULYA 1HQ3A 3UTAC 5B0ZD 5E5AA 4WU8B 3AZMB 3WAAC 5B0ZB 1P3AC 2NZDA 2G5HC 4Z2MH 5B0YC 1KX4D 1M18D 4H9RA 3MGQA 5B2JB 3W97C 2F8NG 5B1MD 3UTAA 5B1MB 3WAAA 1P3AA 1TZYD 5B0YA 1TZYB 5KDMB 3W97A 4CSRA 4H9QB 1KU5A 1N1JA 5DNND 2YFVA 2JCHA 5AV9D 5B33C 5JA4A 3AN2D 1M1AC 1M19C 1P3LC 1P3OC 3X1UB 2Y2LA 3VH6W 3KSYA 3AZIC 2F8NK 4H9SC 5B33A 3NQUB 3KXBC 3RELB 3AZED 1U35C 3AZEB 1M1AA 3KWQD 3LJAD 1BH8B 4AWLB 1P3LA 1P3OA 3KWQB 4NFTA 1M19A 3H0LC 2NQBB 4DRAA 4JJND 1P3FC 3AZIA 4JJNB 1U35A 1WWIA 2Y2HA 2IO5B 4R8PC 3UT9C 2BYKB 2PYOC 3LZ1C 5CHLB 3F6TA 4ZBJB 4J8UC 1P3FA 3LELD 3H0MC 4R8PA 3B0CT 1B6WA 5B31B 3LELB 3B6FC 3LZ1A 5FUGB 3MNNC 4J8UA 5GT3C 2AROC 2JSSA 3EPJA 1F66D 3NQJA 1F66B 1P3MD 2YFWB 1P3GD 3B6FA 3A6NB 4J8WC 1P3GB 1P3MB 3AZLC 3MNNA 4YM6C 2Y2PA 5GT3A 2AROA 4H9OA 1JFIB 4G91B 3AYWC 3X1VB 2F8NA 5DNMC 5B24C 3LZ0D 4YS3C 3MGPC 4J8WA 3LZ0B 1KX3C 3AZLA 5GSUC 4YM6A 1P3BC 4LD9D 5CP6D 3AZGD 3AYWA 3UTBA 4WU9C 4LD9B 5CP6B 1A7WA 3AZGB 5DNMA 5B24A 4YS3A 3MGPA 4G92B 3AZND 1KX3A 5GSUA 3AV1C 3AZNB 1WWSA 1P3BA 2CWEA 4M6BA 1P3PC 4WU9A 3REHD 3EPKA 3REHB 5CPJD 2BYMB 1B67A 5CPJB 2HIOD 2HIOB 3X1TC 1P3PA 5AV6D 3REIC 3B0DB 5AV6B 5B40C 3MVDC 3X1TA 2FJ7D 1TAFA 3W99D 2FJ7B 3REIA 2Y2JA 3W99B 3W96C 3AL0C 5AV8C 1P34D 2Y2MA 5AV5C 5B40A 5GXQD 1H3OA 4EO5B 2Y2OA 5BS7C 2ZM5A 5GXQB 3C1BC 1P34B 1Z2CB 5CPKC 3W98C 1EQZC 3W96A 4Z66C 5AV8A 2RVQC 2F2AC
chains in the Genus database with same CATH topology
5BS7A 3WTPE 3C1BA 1F1EA 4XUJD 3W98A 3X1SB 4XUJB 3V9RB 4KGCD 1EQZA 4Z66A 4KGCB 3FDDA 3O62C 4CAYB 5C3IB 1BH9B 5AVBD 5AVBB 2HUEC 3AV2C 5BNVB 3AFAC 1HQ3D 5BNXA 1ZLAC 1HQ3B 5B2JD 5E5AB 3AV2A 2NZDD 3WKJC 4H9NA 2NZDB 5JRGC 5B32C 3AFAA 3B6GC 4H9RB 2DF4C 3MGQB 3VH5A 3UTAD 1KX4C 1M18C 1ZLAA 3WAAD 3UTAB 3WAAB 1S32C 5B0YD 1P3AB 5AY8C 3WKJA 2F8NH 5JRGA 5B32A 5B0YB 1P3IC 3KFUG 1BFMA 3B6GA 3W97D 1KX4A 3W97B 1M18A 4CSRB 1N1JB 4NE3A 5BT1C 3X1UD 1S32A 2YFVB 5DNNC 5AY8A 3TU4C 1P3IA 5AV9C 3RELD 5AVCC 3AN2C 4J8VC 5DNNA 1T3UA 2NQBD 3TU4A 5B33B 5AV9A 1P3LD 4H9SA 5AVCA 3KXBA 3REKC 1P3LB 1P3OB 3AN2A 1M19B 3KWQC 3LJAC 3AZID 4J8VA 3EPHA 3AZIB 1U35D 5BO0A 5G49A 1U35B 3REKA 5B31D 1BH8A 3LJAA 3UT9A 1P3FB 2PYOA 3MGSC 3KUYD 3KUYB 3AZKC 4R8PB 3LZ1D 2ZY5A 4WNNA 3LZ1B 1PZRA 3A6ND 4J8UB 3WA9C 3MGSA 2W8SA 2ZY2A 3AZJC 3NQJB 4H9PA 5GT0C 4UUZA 3AZKA 3B6FD 3EG5B 1F66C 3B6FB 3P5JB 3X1VD 3MNND 3MNNB 5GT3D 2AROD 3WA9A 5GT3B 2AROB 4H9OB 3AZHC 3AZJA 5GT0A 3MGRC 1AOIC 2XD1A 3B0BA 5F99C 2F8ND 1F66A 2F8NB 4J8WD 3AZLD 4J8WB 4YM6D 3LZ0C 3AZLB 2CV5C 4YM6B 3AZHA 3UTBD 2J8PA 4ZUXC 3MGRA 1KX5C 3AYWB 5F99A 5B2IC 5B24D 3UTBB 1AOIA 4LD9C 5B24B 5DNMB 4YS3B 1KX3D 3MGPB 5GSUD 1KX3B 2DQNC 4XZQC 4G92C 5GSUB 2CV5A 4WJ3C 3AZFC 1P3BD 5B32G 1P3BB 3AV1A 4ZUXA 1KX5A 4KHAA 5B2IA 5B1LC 4WU9B 1ID3C 3C1CC 3REHC 4XZQA 3AZFA 1P3KC 1P3PD 4NE6A 2VQRA 1P3PB 1ID3A 5B1LA 3C1CA 3X1TD 1P3KA 4WZSB 3X1TB 3A1KA 3MVDA 3WTPC 3REIB 4Z5TC 1W2EA 5B40D 5B40B 1H3OB 4QLCC 4J8XD 3REJD 5AV5A 2FFFB 4X23C 4J8XB 3REJB 3X1SD 3R45A 3WTPA 3W96D 4Z5TA 5CPKA 2UWXA 3W96B 2BG1A 5AV8B 4HGAC 4QLCA 4X23A 3W98B 1EQZD 2Y2KA 4Z66D 1EQZB 4Z66B 4KGCC 5CPIC 3IP4C 3O62A 4KUDC 5E5AD 3AZMC 4WU8C 4KGCA 5B0ZC 5CPIA 3MGQD 5BNXB 3AV2D 3VH6T 2HUEB 3AV2B 4KUDA 5B2JC 3AFAD 4Z2MG 4H9NB 3AZMA 4WU8A 3AFAB 1P3AD 5B1MC 5B0ZA 2ZY4A 1ZLAB 1TZYC 3WKJD 5B2JA 5JRGD 4E44A 5B32D 3WKJB 3VH5W 5JRGB 5B32B 3B6GD 5B1MA 3B6GB 1KX4B 1Q9CA 1M18B 5JA4B 1TZYA 5KDMA 1S32D 5AY8D 1S32B 1P3ID 4H9QA 5AY8B 3X1UC 2LY8A 1P3IB 2L5AA 5B33D 2JE5A 1M1AD 5BT1D 3RELC 1M1AB 3VH6A 1P3OD 1M19D 3AZEC 3TU4D 4E45A 5DNNB 4AWLC 3TU4B 3X1UA 2NQBC 5AVCD 5AV9B 3KXBD 1HTAA 4JJNC 5AVCB 3KXBB 3EPLA 2Y2GA 3AN2B 2XD5A 4J8VD 2Y2NA 3RELA 3AZEA 2IO5C 4J8VB 3KWQA 5BO0B 1P3FD 5G49B 2NQBA 4ZBJC 3REKD 4JJNA 3REKB 4R8PD 3UT9D 3LJAB 2PYOD 3LELC 3UT9B 5B31C 2BYKA 2PYOB 4J8UD 3KUYC 4WNNB 3LELA 3MGSD 5B31A 3MGSB 2Y2QA 3A6NC 3AZKD 1P3GC 5FUGA 1P3MC 3KUYA 4H9PB 3AZKB 4UUZB 2ZY3A 4G91C 3WA9D 3X1VC 3AZJD 2YFWA 3WA9B 3A6NA 5GT0D 3AZJB 1P3GA 1P3MA 5GT0B 3AYWD 1JFIA 5DNMD 4YS3D 3MGPD 5CP6C 3AZGC 3X1VA 1R4VA 3AZHD 3LZ0A 3MGRD 3AZHB 1AOID 5F99D 3MGRB 3AZNC 5F99B 1AOIB 3UTBC 3B0CW 4WU9D 2CV5D 4LD9A 5CP6A 2CV5B 3AZGA 4DQYB 3AV1D 3A1IA 4ZUXD 5CPJC 1KX5D 3AV1B 5B2ID 4ZUXB 1KX5B 3AZNA 4KHAB 5B2IB 2HIOC 4XZQD 4XZQB 3AZFD 3B0DC 5AV6C 3REHA 3AZFB 2BYMA 4WV4B 5CPJA 1ID3D 5B1LD 3C1CD 1ID3B 5B1LB 2HIOA 3C1CB 3H0RC 3REID 1TAFB 2FJ7C 1P3KD 3W99C 5AV6A 1P3KB 3MVDD 3MVDB 1P34C 4EO5C 5GXQC 2FJ7A 5AV8D 3W99A 5AV5D 3C1BD 5AV5B 4UPKA 3WTPD 3C1BB 4J8XC 3REJC 4Z5TD 5CPKD 1P34A 3R45B 3WTPB 3W98D 5GXQA 4Z5TB 5CPKB 4DRBA 3X1SC 4XUJC 4QLCD 2RVQD 4QLCB 4X23D 2RIQA 3NQUA 4X23B 4J8XA 3REJA 5C3IC 3X1SA 5AVBC 4XUJA 3V9RA 5B31G 4HGAB 3VH5T 3O62D 3O62B 2Y2IA 4CAYA 1BH9A 1HQ3C 5AVBA 2G5IC 5E5AC 5CPID 5BNVA 4NE5A 5CPIB 2NZDC 4KUDD 1ZLAD 3MGQC 4KUDB 3AZMD 4WU8D 1ULYA 1HQ3A 3UTAC 5B0ZD 5E5AA 4WU8B 3AZMB 3WAAC 5B0ZB 1P3AC 2NZDA 2G5HC 4Z2MH 5B0YC 1KX4D 1M18D 4H9RA 3MGQA 5B2JB 3W97C 2F8NG 5B1MD 3UTAA 5B1MB 3WAAA 1P3AA 1TZYD 5B0YA 1TZYB 5KDMB 3W97A 4CSRA 4H9QB 1KU5A 1N1JA 5DNND 2YFVA 2JCHA 5AV9D 5B33C 5JA4A 3AN2D 1M1AC 1M19C 1P3LC 1P3OC 3X1UB 2Y2LA 3VH6W 3KSYA 3AZIC 2F8NK 4H9SC 5B33A 3NQUB 3KXBC 3RELB 3AZED 1U35C 3AZEB 1M1AA 3KWQD 3LJAD 1BH8B 4AWLB 1P3LA 1P3OA 3KWQB 4NFTA 1M19A 3H0LC 2NQBB 4DRAA 4JJND 1P3FC 3AZIA 4JJNB 1U35A 1WWIA 2Y2HA 2IO5B 4R8PC 3UT9C 2BYKB 2PYOC 3LZ1C 5CHLB 3F6TA 4ZBJB 4J8UC 1P3FA 3LELD 3H0MC 4R8PA 3B0CT 1B6WA 5B31B 3LELB 3B6FC 3LZ1A 5FUGB 3MNNC 4J8UA 5GT3C 2AROC 2JSSA 3EPJA 1F66D 3NQJA 1F66B 1P3MD 2YFWB 1P3GD 3B6FA 3A6NB 4J8WC 1P3GB 1P3MB 3AZLC 3MNNA 4YM6C 2Y2PA 5GT3A 2AROA 4H9OA 1JFIB 4G91B 3AYWC 3X1VB 2F8NA 5DNMC 5B24C 3LZ0D 4YS3C 3MGPC 4J8WA 3LZ0B 1KX3C 3AZLA 5GSUC 4YM6A 1P3BC 4LD9D 5CP6D 3AZGD 3AYWA 3UTBA 4WU9C 4LD9B 5CP6B 1A7WA 3AZGB 5DNMA 5B24A 4YS3A 3MGPA 4G92B 3AZND 1KX3A 5GSUA 3AV1C 3AZNB 1WWSA 1P3BA 2CWEA 4M6BA 1P3PC 4WU9A 3REHD 3EPKA 3REHB 5CPJD 2BYMB 1B67A 5CPJB 2HIOD 2HIOB 3X1TC 1P3PA 5AV6D 3REIC 3B0DB 5AV6B 5B40C 3MVDC 3X1TA 2FJ7D 1TAFA 3W99D 2FJ7B 3REIA 2Y2JA 3W99B 3W96C 3AL0C 5AV8C 1P34D 2Y2MA 5AV5C 5B40A 5GXQD 1H3OA 4EO5B 2Y2OA 5BS7C 2ZM5A 5GXQB 3C1BC 1P34B 1Z2CB 5CPKC 3W98C 1EQZC 3W96A 4Z66C 5AV8A 2RVQC 2F2AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS7 A;  3WTP E;  3C1B A;  1F1E A;  4XUJ D;  3W98 A;  3X1S B;  4XUJ B;  3V9R B;  4KGC D;  1EQZ A;  4Z66 A;  4KGC B;  3O62 C;  4CAY B;  5C3I B;  1BH9 B;  5AVB D;  5AVB B;  2HUE C;  3AV2 C;  5BNV B;  3AFA C;  1HQ3 D;  5BNX A;  1ZLA C;  1HQ3 B;  5B2J D;  5E5A B;  3AV2 A;  2NZD D;  3WKJ C;  4H9N A;  2NZD B;  5JRG C;  5B32 C;  3AFA A;  3B6G C;  4H9R B;  3MGQ B;  3VH5 A;  3UTA D;  1KX4 C;  1M18 C;  1ZLA A;  3WAA D;  3UTA B;  3WAA B;  1S32 C;  5B0Y D;  1P3A B;  5AY8 C;  3WKJ A;  2F8N H;  5JRG A;  5B32 A;  5B0Y B;  1P3I C;  1BFM A;  3B6G A;  3W97 D;  1KX4 A;  3W97 B;  1M18 A;  4CSR B;  1N1J B;  4NE3 A;  5BT1 C;  3X1U D;  1S32 A;  2YFV B;  5DNN C;  5AY8 A;  3TU4 C;  1P3I A;  5AV9 C;  3REL D;  5AVC C;  3AN2 C;  4J8V C;  5DNN A;  2NQB D;  3TU4 A;  5B33 B;  5AV9 A;  1P3L D;  4H9S A;  5AVC A;  3KXB A;  3REK C;  1P3L B;  1P3O B;  3AN2 A;  1M19 B;  3KWQ C;  3LJA C;  3AZI D;  4J8V A;  3AZI B;  1U35 D;  5BO0 A;  5G49 A;  1U35 B;  3REK A;  5B31 D;  1BH8 A;  3LJA A;  3UT9 A;  1P3F B;  2PYO A;  3MGS C;  3KUY D;  3KUY B;  3AZK C;  4R8P B;  3LZ1 D;  4WNN A;  3LZ1 B;  3A6N D;  4J8U B;  3WA9 C;  3MGS A;  3AZJ C;  3NQJ B;  4H9P A;  5GT0 C;  4UUZ A;  3AZK A;  3B6F D;  1F66 C;  3B6F B;  3X1V D;  3MNN D;  3MNN B;  5GT3 D;  2ARO D;  3WA9 A;  5GT3 B;  2ARO B;  4H9O B;  3AZH C;  3AZJ A;  5GT0 A;  3MGR C;  1AOI C;  3B0B A;  5F99 C;  2F8N D;  1F66 A;  2F8N B;  4J8W D;  3AZL D;  4J8W B;  4YM6 D;  3LZ0 C;  3AZL B;  2CV5 C;  4YM6 B;  3AZH A;  3UTB D;  4ZUX C;  3MGR A;  1KX5 C;  3AYW B;  5F99 A;  5B2I C;  5B24 D;  3UTB B;  1AOI A;  4LD9 C;  5B24 B;  5DNM B;  4YS3 B;  1KX3 D;  3MGP B;  5GSU D;  1KX3 B;  4XZQ C;  2CV5 A;  4G92 C;  5GSU B;  3AZF C;  1P3B D;  5B32 G;  1P3B B;  3AV1 A;  4ZUX A;  1KX5 A;  4KHA A;  5B2I A;  5B1L C;  4WU9 B;  1ID3 C;  3C1C C;  3REH C;  4XZQ A;  3AZF A;  1P3K C;  1P3P D;  4NE6 A;  1P3P B;  1ID3 A;  5B1L A;  3C1C A;  3X1T D;  1P3K A;  4WZS B;  3X1T B;  3MVD A;  3WTP C;  3REI B;  4Z5T C;  5B40 D;  5B40 B;  1H3O B;  4QLC C;  4J8X D;  3REJ D;  5AV5 A;  4X23 C;  4J8X B;  3REJ B;  3X1S D;  3R45 A;  3WTP A;  3W96 D;  4Z5T A;  5CPK A;  3W96 B;  5AV8 B;  4HGA C;  4QLC A;  4X23 A;  3W98 B;  1EQZ D;  4Z66 D;  1EQZ B;  4Z66 B;  4KGC C;  5CPI C;  3O62 A;  4KUD C;  5E5A D;  3AZM C;  4WU8 C;  4KGC A;  5B0Z C;  5CPI A;  3MGQ D;  5BNX B;  3AV2 D;  3VH6 T;  2HUE B;  3AV2 B;  4KUD A;  5B2J C;  3AFA D;  4Z2M G;  4H9N B;  3AZM A;  4WU8 A;  3AFA B;  1P3A D;  5B1M C;  5B0Z A;  1ZLA B;  1TZY C;  3WKJ D;  5B2J A;  5JRG D;  4E44 A;  5B32 D;  3WKJ B;  3VH5 W;  5JRG B;  5B32 B;  3B6G D;  5B1M A;  3B6G B;  1KX4 B;  1Q9C A;  1M18 B;  5JA4 B;  1TZY A;  5KDM A;  1S32 D;  5AY8 D;  1S32 B;  1P3I D;  4H9Q A;  5AY8 B;  3X1U C;  2LY8 A;  1P3I B;  2L5A A;  5B33 D;  1M1A D;  5BT1 D;  3REL C;  1M1A B;  3VH6 A;  1P3O D;  1M19 D;  3AZE C;  3TU4 D;  4E45 A;  5DNN B;  4AWL C;  3TU4 B;  3X1U A;  2NQB C;  5AVC D;  5AV9 B;  3KXB D;  1HTA A;  4JJN C;  5AVC B;  3KXB B;  3AN2 B;  3REL A;  4J8V D;  3AZE A;  2IO5 C;  4J8V B;  3KWQ A;  5BO0 B;  1P3F D;  5G49 B;  2NQB A;  4ZBJ C;  3REK D;  4JJN A;  3REK B;  4R8P D;  3UT9 D;  3LJA B;  2PYO D;  3LEL C;  3UT9 B;  5B31 C;  2BYK A;  2PYO B;  4J8U D;  3KUY C;  4WNN B;  3LEL A;  3MGS D;  5B31 A;  3MGS B;  3A6N C;  3AZK D;  1P3G C;  5FUG A;  1P3M C;  3KUY A;  4H9P B;  3AZK B;  4UUZ B;  4G91 C;  3WA9 D;  3X1V C;  3AZJ D;  2YFW A;  3WA9 B;  3A6N A;  5GT0 D;  3AZJ B;  1P3G A;  1P3M A;  5GT0 B;  3AYW D;  1JFI A;  5DNM D;  4YS3 D;  3MGP D;  5CP6 C;  3AZG C;  3X1V A;  1R4V A;  3AZH D;  3LZ0 A;  3MGR D;  3AZH B;  1AOI D;  5F99 D;  3MGR B;  3AZN C;  5F99 B;  1AOI B;  3UTB C;  3B0C W;  4WU9 D;  2CV5 D;  4LD9 A;  5CP6 A;  2CV5 B;  3AZG A;  3AV1 D;  4ZUX D;  5CPJ C;  1KX5 D;  3AV1 B;  5B2I D;  4ZUX B;  1KX5 B;  3AZN A;  4KHA B;  5B2I B;  2HIO C;  4XZQ D;  4XZQ B;  3AZF D;  3B0D C;  5AV6 C;  3REH A;  3AZF B;  2BYM A;  4WV4 B;  5CPJ A;  1ID3 D;  5B1L D;  3C1C D;  1ID3 B;  5B1L B;  2HIO A;  3C1C B;  3REI D;  1TAF B;  2FJ7 C;  1P3K D;  3W99 C;  5AV6 A;  1P3K B;  3MVD D;  3MVD B;  1P34 C;  4EO5 C;  5GXQ C;  2FJ7 A;  5AV8 D;  3W99 A;  5AV5 D;  3C1B D;  5AV5 B;  3WTP D;  3C1B B;  4J8X C;  3REJ C;  4Z5T D;  5CPK D;  1P34 A;  3R45 B;  3WTP B;  3W98 D;  5GXQ A;  4Z5T B;  5CPK B;  4DRB A;  3X1S C;  4XUJ C;  4QLC D;  2RVQ D;  4QLC B;  4X23 D;  3NQU A;  4X23 B;  4J8X A;  3REJ A;  5C3I C;  3X1S A;  5AVB C;  4XUJ A;  3V9R A;  5B31 G;  4HGA B;  3VH5 T;  3O62 D;  3O62 B;  4CAY A;  1BH9 A;  1HQ3 C;  5AVB A;  5E5A C;  5CPI D;  5BNV A;  4NE5 A;  5CPI B;  2NZD C;  4KUD D;  1ZLA D;  3MGQ C;  4KUD B;  3AZM D;  4WU8 D;  1ULY A;  1HQ3 A;  3UTA C;  5B0Z D;  5E5A A;  4WU8 B;  3AZM B;  3WAA C;  5B0Z B;  1P3A C;  2NZD A;  4Z2M H;  5B0Y C;  1KX4 D;  1M18 D;  4H9R A;  3MGQ A;  5B2J B;  3W97 C;  2F8N G;  5B1M D;  3UTA A;  5B1M B;  3WAA A;  1P3A A;  1TZY D;  5B0Y A;  1TZY B;  5KDM B;  3W97 A;  4CSR A;  4H9Q B;  1KU5 A;  1N1J A;  5DNN D;  2YFV A;  5AV9 D;  5B33 C;  5JA4 A;  3AN2 D;  1M1A C;  1M19 C;  1P3L C;  1P3O C;  3X1U B;  3VH6 W;  3KSY A;  3AZI C;  2F8N K;  4H9S C;  5B33 A;  3NQU B;  3KXB C;  3REL B;  3AZE D;  1U35 C;  3AZE B;  1M1A A;  3KWQ D;  3LJA D;  1BH8 B;  4AWL B;  1P3L A;  1P3O A;  3KWQ B;  4NFT A;  1M19 A;  2NQB B;  4DRA A;  4JJN D;  1P3F C;  3AZI A;  4JJN B;  1U35 A;  1WWI A;  2IO5 B;  4R8P C;  3UT9 C;  2BYK B;  2PYO C;  3LZ1 C;  5CHL B;  4ZBJ B;  4J8U C;  1P3F A;  3LEL D;  4R8P A;  3LEL B;  3B0C T;  1B6W A;  5B31 B;  3B6F C;  3LZ1 A;  5FUG B;  3MNN C;  4J8U A;  5GT3 C;  2ARO C;  2JSS A;  1F66 D;  3NQJ A;  1F66 B;  1P3M D;  2YFW B;  1P3G D;  3B6F A;  3A6N B;  4J8W C;  1P3G B;  1P3M B;  3AZL C;  3MNN A;  4YM6 C;  5GT3 A;  2ARO A;  4H9O A;  1JFI B;  4G91 B;  3AYW C;  3X1V B;  2F8N A;  5DNM C;  5B24 C;  3LZ0 D;  4YS3 C;  3MGP C;  4J8W A;  3LZ0 B;  1KX3 C;  3AZL A;  5GSU C;  4YM6 A;  1P3B C;  4LD9 D;  5CP6 D;  3AZG D;  3AYW A;  3UTB A;  4WU9 C;  4LD9 B;  5CP6 B;  1A7W A;  3AZG B;  5DNM A;  5B24 A;  4YS3 A;  3MGP A;  4G92 B;  3AZN D;  1KX3 A;  5GSU A;  3AV1 C;  3AZN B;  1WWS A;  1P3B A;  2CWE A;  4M6B A;  1P3P C;  4WU9 A;  3REH D;  3REH B;  5CPJ D;  2BYM B;  1B67 A;  5CPJ B;  2HIO D;  2HIO B;  3X1T C;  1P3P A;  5AV6 D;  3REI C;  3B0D B;  5AV6 B;  5B40 C;  3MVD C;  3X1T A;  2FJ7 D;  1TAF A;  3W99 D;  2FJ7 B;  3REI A;  3W99 B;  3W96 C;  5AV8 C;  1P34 D;  5AV5 C;  5GXQ D;  5BS7 C;  1H3O A;  4EO5 B;  5B40 A;  3C1B C;  1P34 B;  5GXQ B;  3W98 C;  5CPK C;  1EQZ C;  3W96 A;  4Z66 C;  5AV8 A;  2RVQ C; 
#chains in the Genus database with same CATH topology
 5BS7 A;  3WTP E;  3C1B A;  1F1E A;  4XUJ D;  3W98 A;  3X1S B;  4XUJ B;  3V9R B;  4KGC D;  1EQZ A;  4Z66 A;  4KGC B;  3FDD A;  3O62 C;  4CAY B;  5C3I B;  1BH9 B;  5AVB D;  5AVB B;  2HUE C;  3AV2 C;  5BNV B;  3AFA C;  1HQ3 D;  5BNX A;  1ZLA C;  1HQ3 B;  5B2J D;  5E5A B;  3AV2 A;  2NZD D;  3WKJ C;  4H9N A;  2NZD B;  5JRG C;  5B32 C;  3AFA A;  3B6G C;  4H9R B;  2DF4 C;  3MGQ B;  3VH5 A;  3UTA D;  1KX4 C;  1M18 C;  1ZLA A;  3WAA D;  3UTA B;  3WAA B;  1S32 C;  5B0Y D;  1P3A B;  5AY8 C;  3WKJ A;  2F8N H;  5JRG A;  5B32 A;  5B0Y B;  1P3I C;  3KFU G;  1BFM A;  3B6G A;  3W97 D;  1KX4 A;  3W97 B;  1M18 A;  4CSR B;  1N1J B;  4NE3 A;  5BT1 C;  3X1U D;  1S32 A;  2YFV B;  5DNN C;  5AY8 A;  3TU4 C;  1P3I A;  5AV9 C;  3REL D;  5AVC C;  3AN2 C;  4J8V C;  5DNN A;  1T3U A;  2NQB D;  3TU4 A;  5B33 B;  5AV9 A;  1P3L D;  4H9S A;  5AVC A;  3KXB A;  3REK C;  1P3L B;  1P3O B;  3AN2 A;  1M19 B;  3KWQ C;  3LJA C;  3AZI D;  4J8V A;  3EPH A;  3AZI B;  1U35 D;  5BO0 A;  5G49 A;  1U35 B;  3REK A;  5B31 D;  1BH8 A;  3LJA A;  3UT9 A;  1P3F B;  2PYO A;  3MGS C;  3KUY D;  3KUY B;  3AZK C;  4R8P B;  3LZ1 D;  2ZY5 A;  4WNN A;  3LZ1 B;  1PZR A;  3A6N D;  4J8U B;  3WA9 C;  3MGS A;  2W8S A;  2ZY2 A;  3AZJ C;  3NQJ B;  4H9P A;  5GT0 C;  4UUZ A;  3AZK A;  3B6F D;  3EG5 B;  1F66 C;  3B6F B;  3P5J B;  3X1V D;  3MNN D;  3MNN B;  5GT3 D;  2ARO D;  3WA9 A;  5GT3 B;  2ARO B;  4H9O B;  3AZH C;  3AZJ A;  5GT0 A;  3MGR C;  1AOI C;  2XD1 A;  3B0B A;  5F99 C;  2F8N D;  1F66 A;  2F8N B;  4J8W D;  3AZL D;  4J8W B;  4YM6 D;  3LZ0 C;  3AZL B;  2CV5 C;  4YM6 B;  3AZH A;  3UTB D;  2J8P A;  4ZUX C;  3MGR A;  1KX5 C;  3AYW B;  5F99 A;  5B2I C;  5B24 D;  3UTB B;  1AOI A;  4LD9 C;  5B24 B;  5DNM B;  4YS3 B;  1KX3 D;  3MGP B;  5GSU D;  1KX3 B;  2DQN C;  4XZQ C;  4G92 C;  5GSU B;  2CV5 A;  4WJ3 C;  3AZF C;  1P3B D;  5B32 G;  1P3B B;  3AV1 A;  4ZUX A;  1KX5 A;  4KHA A;  5B2I A;  5B1L C;  4WU9 B;  1ID3 C;  3C1C C;  3REH C;  4XZQ A;  3AZF A;  1P3K C;  1P3P D;  4NE6 A;  2VQR A;  1P3P B;  1ID3 A;  5B1L A;  3C1C A;  3X1T D;  1P3K A;  4WZS B;  3X1T B;  3A1K A;  3MVD A;  3WTP C;  3REI B;  4Z5T C;  1W2E A;  5B40 D;  5B40 B;  1H3O B;  4QLC C;  4J8X D;  3REJ D;  5AV5 A;  2FFF B;  4X23 C;  4J8X B;  3REJ B;  3X1S D;  3R45 A;  3WTP A;  3W96 D;  4Z5T A;  5CPK A;  2UWX A;  3W96 B;  2BG1 A;  5AV8 B;  4HGA C;  4QLC A;  4X23 A;  3W98 B;  1EQZ D;  2Y2K A;  4Z66 D;  1EQZ B;  4Z66 B;  4KGC C;  5CPI C;  3IP4 C;  3O62 A;  4KUD C;  5E5A D;  3AZM C;  4WU8 C;  4KGC A;  5B0Z C;  5CPI A;  3MGQ D;  5BNX B;  3AV2 D;  3VH6 T;  2HUE B;  3AV2 B;  4KUD A;  5B2J C;  3AFA D;  4Z2M G;  4H9N B;  3AZM A;  4WU8 A;  3AFA B;  1P3A D;  5B1M C;  5B0Z A;  2ZY4 A;  1ZLA B;  1TZY C;  3WKJ D;  5B2J A;  5JRG D;  4E44 A;  5B32 D;  3WKJ B;  3VH5 W;  5JRG B;  5B32 B;  3B6G D;  5B1M A;  3B6G B;  1KX4 B;  1Q9C A;  1M18 B;  5JA4 B;  1TZY A;  5KDM A;  1S32 D;  5AY8 D;  1S32 B;  1P3I D;  4H9Q A;  5AY8 B;  3X1U C;  2LY8 A;  1P3I B;  2L5A A;  5B33 D;  2JE5 A;  1M1A D;  5BT1 D;  3REL C;  1M1A B;  3VH6 A;  1P3O D;  1M19 D;  3AZE C;  3TU4 D;  4E45 A;  5DNN B;  4AWL C;  3TU4 B;  3X1U A;  2NQB C;  5AVC D;  5AV9 B;  3KXB D;  1HTA A;  4JJN C;  5AVC B;  3KXB B;  3EPL A;  2Y2G A;  3AN2 B;  2XD5 A;  4J8V D;  2Y2N A;  3REL A;  3AZE A;  2IO5 C;  4J8V B;  3KWQ A;  5BO0 B;  1P3F D;  5G49 B;  2NQB A;  4ZBJ C;  3REK D;  4JJN A;  3REK B;  4R8P D;  3UT9 D;  3LJA B;  2PYO D;  3LEL C;  3UT9 B;  5B31 C;  2BYK A;  2PYO B;  4J8U D;  3KUY C;  4WNN B;  3LEL A;  3MGS D;  5B31 A;  3MGS B;  2Y2Q A;  3A6N C;  3AZK D;  1P3G C;  5FUG A;  1P3M C;  3KUY A;  4H9P B;  3AZK B;  4UUZ B;  2ZY3 A;  4G91 C;  3WA9 D;  3X1V C;  3AZJ D;  2YFW A;  3WA9 B;  3A6N A;  5GT0 D;  3AZJ B;  1P3G A;  1P3M A;  5GT0 B;  3AYW D;  1JFI A;  5DNM D;  4YS3 D;  3MGP D;  5CP6 C;  3AZG C;  3X1V A;  1R4V A;  3AZH D;  3LZ0 A;  3MGR D;  3AZH B;  1AOI D;  5F99 D;  3MGR B;  3AZN C;  5F99 B;  1AOI B;  3UTB C;  3B0C W;  4WU9 D;  2CV5 D;  4LD9 A;  5CP6 A;  2CV5 B;  3AZG A;  4DQY B;  3AV1 D;  3A1I A;  4ZUX D;  5CPJ C;  1KX5 D;  3AV1 B;  5B2I D;  4ZUX B;  1KX5 B;  3AZN A;  4KHA B;  5B2I B;  2HIO C;  4XZQ D;  4XZQ B;  3AZF D;  3B0D C;  5AV6 C;  3REH A;  3AZF B;  2BYM A;  4WV4 B;  5CPJ A;  1ID3 D;  5B1L D;  3C1C D;  1ID3 B;  5B1L B;  2HIO A;  3C1C B;  3H0R C;  3REI D;  1TAF B;  2FJ7 C;  1P3K D;  3W99 C;  5AV6 A;  1P3K B;  3MVD D;  3MVD B;  1P34 C;  4EO5 C;  5GXQ C;  2FJ7 A;  5AV8 D;  3W99 A;  5AV5 D;  3C1B D;  5AV5 B;  4UPK A;  3WTP D;  3C1B B;  4J8X C;  3REJ C;  4Z5T D;  5CPK D;  1P34 A;  3R45 B;  3WTP B;  3W98 D;  5GXQ A;  4Z5T B;  5CPK B;  4DRB A;  3X1S C;  4XUJ C;  4QLC D;  2RVQ D;  4QLC B;  4X23 D;  2RIQ A;  3NQU A;  4X23 B;  4J8X A;  3REJ A;  5C3I C;  3X1S A;  5AVB C;  4XUJ A;  3V9R A;  5B31 G;  4HGA B;  3VH5 T;  3O62 D;  3O62 B;  2Y2I A;  4CAY A;  1BH9 A;  1HQ3 C;  5AVB A;  2G5I C;  5E5A C;  5CPI D;  5BNV A;  4NE5 A;  5CPI B;  2NZD C;  4KUD D;  1ZLA D;  3MGQ C;  4KUD B;  3AZM D;  4WU8 D;  1ULY A;  1HQ3 A;  3UTA C;  5B0Z D;  5E5A A;  4WU8 B;  3AZM B;  3WAA C;  5B0Z B;  1P3A C;  2NZD A;  2G5H C;  4Z2M H;  5B0Y C;  1KX4 D;  1M18 D;  4H9R A;  3MGQ A;  5B2J B;  3W97 C;  2F8N G;  5B1M D;  3UTA A;  5B1M B;  3WAA A;  1P3A A;  1TZY D;  5B0Y A;  1TZY B;  5KDM B;  3W97 A;  4CSR A;  4H9Q B;  1KU5 A;  1N1J A;  5DNN D;  2YFV A;  2JCH A;  5AV9 D;  5B33 C;  5JA4 A;  3AN2 D;  1M1A C;  1M19 C;  1P3L C;  1P3O C;  3X1U B;  2Y2L A;  3VH6 W;  3KSY A;  3AZI C;  2F8N K;  4H9S C;  5B33 A;  3NQU B;  3KXB C;  3REL B;  3AZE D;  1U35 C;  3AZE B;  1M1A A;  3KWQ D;  3LJA D;  1BH8 B;  4AWL B;  1P3L A;  1P3O A;  3KWQ B;  4NFT A;  1M19 A;  3H0L C;  2NQB B;  4DRA A;  4JJN D;  1P3F C;  3AZI A;  4JJN B;  1U35 A;  1WWI A;  2Y2H A;  2IO5 B;  4R8P C;  3UT9 C;  2BYK B;  2PYO C;  3LZ1 C;  5CHL B;  3F6T A;  4ZBJ B;  4J8U C;  1P3F A;  3LEL D;  3H0M C;  4R8P A;  3B0C T;  1B6W A;  5B31 B;  3LEL B;  3B6F C;  3LZ1 A;  5FUG B;  3MNN C;  4J8U A;  5GT3 C;  2ARO C;  2JSS A;  3EPJ A;  1F66 D;  3NQJ A;  1F66 B;  1P3M D;  2YFW B;  1P3G D;  3B6F A;  3A6N B;  4J8W C;  1P3G B;  1P3M B;  3AZL C;  3MNN A;  4YM6 C;  2Y2P A;  5GT3 A;  2ARO A;  4H9O A;  1JFI B;  4G91 B;  3AYW C;  3X1V B;  2F8N A;  5DNM C;  5B24 C;  3LZ0 D;  4YS3 C;  3MGP C;  4J8W A;  3LZ0 B;  1KX3 C;  3AZL A;  5GSU C;  4YM6 A;  1P3B C;  4LD9 D;  5CP6 D;  3AZG D;  3AYW A;  3UTB A;  4WU9 C;  4LD9 B;  5CP6 B;  1A7W A;  3AZG B;  5DNM A;  5B24 A;  4YS3 A;  3MGP A;  4G92 B;  3AZN D;  1KX3 A;  5GSU A;  3AV1 C;  3AZN B;  1WWS A;  1P3B A;  2CWE A;  4M6B A;  1P3P C;  4WU9 A;  3REH D;  3EPK A;  3REH B;  5CPJ D;  2BYM B;  1B67 A;  5CPJ B;  2HIO D;  2HIO B;  3X1T C;  1P3P A;  5AV6 D;  3REI C;  3B0D B;  5AV6 B;  5B40 C;  3MVD C;  3X1T A;  2FJ7 D;  1TAF A;  3W99 D;  2FJ7 B;  3REI A;  2Y2J A;  3W99 B;  3W96 C;  3AL0 C;  5AV8 C;  1P34 D;  2Y2M A;  5AV5 C;  5B40 A;  5GXQ D;  1H3O A;  4EO5 B;  2Y2O A;  5BS7 C;  2ZM5 A;  5GXQ B;  3C1B C;  1P34 B;  1Z2C B;  5CPK C;  3W98 C;  1EQZ C;  3W96 A;  4Z66 C;  5AV8 A;  2RVQ C;  2F2A C; 
#chains in the Genus database with same CATH homology
 5BS7 A;  3WTP E;  3C1B A;  1F1E A;  4XUJ D;  3W98 A;  3X1S B;  4XUJ B;  3V9R B;  4KGC D;  1EQZ A;  4Z66 A;  4KGC B;  3FDD A;  3O62 C;  4CAY B;  5C3I B;  1BH9 B;  5AVB D;  5AVB B;  2HUE C;  3AV2 C;  5BNV B;  3AFA C;  1HQ3 D;  5BNX A;  1ZLA C;  1HQ3 B;  5B2J D;  5E5A B;  3AV2 A;  2NZD D;  3WKJ C;  4H9N A;  2NZD B;  5JRG C;  5B32 C;  3AFA A;  3B6G C;  4H9R B;  2DF4 C;  3MGQ B;  3VH5 A;  3UTA D;  1KX4 C;  1M18 C;  1ZLA A;  3WAA D;  3UTA B;  3WAA B;  1S32 C;  5B0Y D;  1P3A B;  5AY8 C;  3WKJ A;  2F8N H;  5JRG A;  5B32 A;  5B0Y B;  1P3I C;  3KFU G;  1BFM A;  3B6G A;  3W97 D;  1KX4 A;  3W97 B;  1M18 A;  4CSR B;  1N1J B;  4NE3 A;  5BT1 C;  3X1U D;  1S32 A;  2YFV B;  5DNN C;  5AY8 A;  3TU4 C;  1P3I A;  5AV9 C;  3REL D;  5AVC C;  3AN2 C;  4J8V C;  5DNN A;  1T3U A;  2NQB D;  3TU4 A;  5B33 B;  5AV9 A;  1P3L D;  4H9S A;  5AVC A;  3KXB A;  3REK C;  1P3L B;  1P3O B;  3AN2 A;  1M19 B;  3KWQ C;  3LJA C;  3AZI D;  4J8V A;  3EPH A;  3AZI B;  1U35 D;  5BO0 A;  5G49 A;  1U35 B;  3REK A;  5B31 D;  1BH8 A;  3LJA A;  3UT9 A;  1P3F B;  2PYO A;  3MGS C;  3KUY D;  3KUY B;  3AZK C;  4R8P B;  3LZ1 D;  2ZY5 A;  4WNN A;  3LZ1 B;  1PZR A;  3A6N D;  4J8U B;  3WA9 C;  3MGS A;  2W8S A;  2ZY2 A;  3AZJ C;  3NQJ B;  4H9P A;  5GT0 C;  4UUZ A;  3AZK A;  3B6F D;  3EG5 B;  1F66 C;  3B6F B;  3P5J B;  3X1V D;  3MNN D;  3MNN B;  5GT3 D;  2ARO D;  3WA9 A;  5GT3 B;  2ARO B;  4H9O B;  3AZH C;  3AZJ A;  5GT0 A;  3MGR C;  1AOI C;  2XD1 A;  3B0B A;  5F99 C;  2F8N D;  1F66 A;  2F8N B;  4J8W D;  3AZL D;  4J8W B;  4YM6 D;  3LZ0 C;  3AZL B;  2CV5 C;  4YM6 B;  3AZH A;  3UTB D;  2J8P A;  4ZUX C;  3MGR A;  1KX5 C;  3AYW B;  5F99 A;  5B2I C;  5B24 D;  3UTB B;  1AOI A;  4LD9 C;  5B24 B;  5DNM B;  4YS3 B;  1KX3 D;  3MGP B;  5GSU D;  1KX3 B;  2DQN C;  4XZQ C;  4G92 C;  5GSU B;  2CV5 A;  4WJ3 C;  3AZF C;  1P3B D;  5B32 G;  1P3B B;  3AV1 A;  4ZUX A;  1KX5 A;  4KHA A;  5B2I A;  5B1L C;  4WU9 B;  1ID3 C;  3C1C C;  3REH C;  4XZQ A;  3AZF A;  1P3K C;  1P3P D;  4NE6 A;  2VQR A;  1P3P B;  1ID3 A;  5B1L A;  3C1C A;  3X1T D;  1P3K A;  4WZS B;  3X1T B;  3A1K A;  3MVD A;  3WTP C;  3REI B;  4Z5T C;  1W2E A;  5B40 D;  5B40 B;  1H3O B;  4QLC C;  4J8X D;  3REJ D;  5AV5 A;  2FFF B;  4X23 C;  4J8X B;  3REJ B;  3X1S D;  3R45 A;  3WTP A;  3W96 D;  4Z5T A;  5CPK A;  2UWX A;  3W96 B;  2BG1 A;  5AV8 B;  4HGA C;  4QLC A;  4X23 A;  3W98 B;  1EQZ D;  2Y2K A;  4Z66 D;  1EQZ B;  4Z66 B;  4KGC C;  5CPI C;  3IP4 C;  3O62 A;  4KUD C;  5E5A D;  3AZM C;  4WU8 C;  4KGC A;  5B0Z C;  5CPI A;  3MGQ D;  5BNX B;  3AV2 D;  3VH6 T;  2HUE B;  3AV2 B;  4KUD A;  5B2J C;  3AFA D;  4Z2M G;  4H9N B;  3AZM A;  4WU8 A;  3AFA B;  1P3A D;  5B1M C;  5B0Z A;  2ZY4 A;  1ZLA B;  1TZY C;  3WKJ D;  5B2J A;  5JRG D;  4E44 A;  5B32 D;  3WKJ B;  3VH5 W;  5JRG B;  5B32 B;  3B6G D;  5B1M A;  3B6G B;  1KX4 B;  1Q9C A;  1M18 B;  5JA4 B;  1TZY A;  5KDM A;  1S32 D;  5AY8 D;  1S32 B;  1P3I D;  4H9Q A;  5AY8 B;  3X1U C;  2LY8 A;  1P3I B;  2L5A A;  5B33 D;  2JE5 A;  1M1A D;  5BT1 D;  3REL C;  1M1A B;  3VH6 A;  1P3O D;  1M19 D;  3AZE C;  3TU4 D;  4E45 A;  5DNN B;  4AWL C;  3TU4 B;  3X1U A;  2NQB C;  5AVC D;  5AV9 B;  3KXB D;  1HTA A;  4JJN C;  5AVC B;  3KXB B;  3EPL A;  2Y2G A;  3AN2 B;  2XD5 A;  4J8V D;  2Y2N A;  3REL A;  3AZE A;  2IO5 C;  4J8V B;  3KWQ A;  5BO0 B;  1P3F D;  5G49 B;  2NQB A;  4ZBJ C;  3REK D;  4JJN A;  3REK B;  4R8P D;  3UT9 D;  3LJA B;  2PYO D;  3LEL C;  3UT9 B;  5B31 C;  2BYK A;  2PYO B;  4J8U D;  3KUY C;  4WNN B;  3LEL A;  3MGS D;  5B31 A;  3MGS B;  2Y2Q A;  3A6N C;  3AZK D;  1P3G C;  5FUG A;  1P3M C;  3KUY A;  4H9P B;  3AZK B;  4UUZ B;  2ZY3 A;  4G91 C;  3WA9 D;  3X1V C;  3AZJ D;  2YFW A;  3WA9 B;  3A6N A;  5GT0 D;  3AZJ B;  1P3G A;  1P3M A;  5GT0 B;  3AYW D;  1JFI A;  5DNM D;  4YS3 D;  3MGP D;  5CP6 C;  3AZG C;  3X1V A;  1R4V A;  3AZH D;  3LZ0 A;  3MGR D;  3AZH B;  1AOI D;  5F99 D;  3MGR B;  3AZN C;  5F99 B;  1AOI B;  3UTB C;  3B0C W;  4WU9 D;  2CV5 D;  4LD9 A;  5CP6 A;  2CV5 B;  3AZG A;  4DQY B;  3AV1 D;  3A1I A;  4ZUX D;  5CPJ C;  1KX5 D;  3AV1 B;  5B2I D;  4ZUX B;  1KX5 B;  3AZN A;  4KHA B;  5B2I B;  2HIO C;  4XZQ D;  4XZQ B;  3AZF D;  3B0D C;  5AV6 C;  3REH A;  3AZF B;  2BYM A;  4WV4 B;  5CPJ A;  1ID3 D;  5B1L D;  3C1C D;  1ID3 B;  5B1L B;  2HIO A;  3C1C B;  3H0R C;  3REI D;  1TAF B;  2FJ7 C;  1P3K D;  3W99 C;  5AV6 A;  1P3K B;  3MVD D;  3MVD B;  1P34 C;  4EO5 C;  5GXQ C;  2FJ7 A;  5AV8 D;  3W99 A;  5AV5 D;  3C1B D;  5AV5 B;  4UPK A;  3WTP D;  3C1B B;  4J8X C;  3REJ C;  4Z5T D;  5CPK D;  1P34 A;  3R45 B;  3WTP B;  3W98 D;  5GXQ A;  4Z5T B;  5CPK B;  4DRB A;  3X1S C;  4XUJ C;  4QLC D;  2RVQ D;  4QLC B;  4X23 D;  2RIQ A;  3NQU A;  4X23 B;  4J8X A;  3REJ A;  5C3I C;  3X1S A;  5AVB C;  4XUJ A;  3V9R A;  5B31 G;  4HGA B;  3VH5 T;  3O62 D;  3O62 B;  2Y2I A;  4CAY A;  1BH9 A;  1HQ3 C;  5AVB A;  2G5I C;  5E5A C;  5CPI D;  5BNV A;  4NE5 A;  5CPI B;  2NZD C;  4KUD D;  1ZLA D;  3MGQ C;  4KUD B;  3AZM D;  4WU8 D;  1ULY A;  1HQ3 A;  3UTA C;  5B0Z D;  5E5A A;  4WU8 B;  3AZM B;  3WAA C;  5B0Z B;  1P3A C;  2NZD A;  2G5H C;  4Z2M H;  5B0Y C;  1KX4 D;  1M18 D;  4H9R A;  3MGQ A;  5B2J B;  3W97 C;  2F8N G;  5B1M D;  3UTA A;  5B1M B;  3WAA A;  1P3A A;  1TZY D;  5B0Y A;  1TZY B;  5KDM B;  3W97 A;  4CSR A;  4H9Q B;  1KU5 A;  1N1J A;  5DNN D;  2YFV A;  2JCH A;  5AV9 D;  5B33 C;  5JA4 A;  3AN2 D;  1M1A C;  1M19 C;  1P3L C;  1P3O C;  3X1U B;  2Y2L A;  3VH6 W;  3KSY A;  3AZI C;  2F8N K;  4H9S C;  5B33 A;  3NQU B;  3KXB C;  3REL B;  3AZE D;  1U35 C;  3AZE B;  1M1A A;  3KWQ D;  3LJA D;  1BH8 B;  4AWL B;  1P3L A;  1P3O A;  3KWQ B;  4NFT A;  1M19 A;  3H0L C;  2NQB B;  4DRA A;  4JJN D;  1P3F C;  3AZI A;  4JJN B;  1U35 A;  1WWI A;  2Y2H A;  2IO5 B;  4R8P C;  3UT9 C;  2BYK B;  2PYO C;  3LZ1 C;  5CHL B;  3F6T A;  4ZBJ B;  4J8U C;  1P3F A;  3LEL D;  3H0M C;  4R8P A;  3B0C T;  1B6W A;  5B31 B;  3LEL B;  3B6F C;  3LZ1 A;  5FUG B;  3MNN C;  4J8U A;  5GT3 C;  2ARO C;  2JSS A;  3EPJ A;  1F66 D;  3NQJ A;  1F66 B;  1P3M D;  2YFW B;  1P3G D;  3B6F A;  3A6N B;  4J8W C;  1P3G B;  1P3M B;  3AZL C;  3MNN A;  4YM6 C;  2Y2P A;  5GT3 A;  2ARO A;  4H9O A;  1JFI B;  4G91 B;  3AYW C;  3X1V B;  2F8N A;  5DNM C;  5B24 C;  3LZ0 D;  4YS3 C;  3MGP C;  4J8W A;  3LZ0 B;  1KX3 C;  3AZL A;  5GSU C;  4YM6 A;  1P3B C;  4LD9 D;  5CP6 D;  3AZG D;  3AYW A;  3UTB A;  4WU9 C;  4LD9 B;  5CP6 B;  1A7W A;  3AZG B;  5DNM A;  5B24 A;  4YS3 A;  3MGP A;  4G92 B;  3AZN D;  1KX3 A;  5GSU A;  3AV1 C;  3AZN B;  1WWS A;  1P3B A;  2CWE A;  4M6B A;  1P3P C;  4WU9 A;  3REH D;  3EPK A;  3REH B;  5CPJ D;  2BYM B;  1B67 A;  5CPJ B;  2HIO D;  2HIO B;  3X1T C;  1P3P A;  5AV6 D;  3REI C;  3B0D B;  5AV6 B;  5B40 C;  3MVD C;  3X1T A;  2FJ7 D;  1TAF A;  3W99 D;  2FJ7 B;  3REI A;  2Y2J A;  3W99 B;  3W96 C;  3AL0 C;  5AV8 C;  1P34 D;  2Y2M A;  5AV5 C;  5B40 A;  5GXQ D;  1H3O A;  4EO5 B;  2Y2O A;  5BS7 C;  2ZM5 A;  5GXQ B;  3C1B C;  1P34 B;  1Z2C B;  5CPK C;  3W98 C;  1EQZ C;  3W96 A;  4Z66 C;  5AV8 A;  2RVQ C;  2F2A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...