1HQ3A

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 32
structure length 106
sequence length 106
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3A00
5GT3B 1EQZC 4XZQD 2F8NB 3B6GD 3UTBD 1P3MD 2YFVB 5DNNC 5B2JD 5B1MA 3AZGA 4ZUXB 1P3AA 3WKJA 4KGCC 5AY8C 3W97C 3B6FC 3C1BC 1KX4C 4H9SA 1ULYA 3VH6A 2CV5D 2FJ7B 3AN2A 5BO0B 5GT3D 3LELA 3WTPA 3MGRB 2BYKA 2F8ND 5B1MC 3AZNC 3B0DC 4DRBA 4Z2MG 1KU5A 1P3IB 4ZUXD 4H9SC 1B67A 3AN2C 3AFAB 3LJAB 2NQBC 1M19B 3B0CW 1P3GC 1HQ3C 3MGRD 4XZQA 3R45B 3UTBA 5B32D 3REJB 5CPKB 1P3MA 3AV1B 3UTAA 3WA9C 1P3ID 5B2JA 5AV6D 4CSRA 3B0BA 3MGSB 4H9OB 3AZFB 3B0CT 4Z5TB 3LJAD 3KSYA 3WTPE 1M19D 3B6GC 3UTBC 2NZDB 3AZJD 2CV5A 3V9RB 5AV8B 1B6WA 3KXBB 5B2JC 5KDMB 1S32D 2F8NA 5CPKD 4UUZA 5B31G 1P3BB 5CP6B 4YM6A 4WV4B 1KX5B 1P34B 3AZFD 3MGPD 3AZHA 4J8XB 2CV5C 5GT3C 1U35B 5CPJB 3KUYD 3NQUB 2NZDD 5BT1C 5AV9D 3MGRA 4CAYA 4ZUXC 2PYOB 1M1AD 5B32A 2BYMA 1ID3B 5JA4A 5AV6A 5AVBA 1P3LB 5GXQB 1P3FB 1KX5D 2F8NH 1P34D 5DNND 3AZID 2FJ7C 1BH8A 1U35D 1KX3B 3TU4B 3MGRC 3LZ1B 3REHD 1M19A 4ZBJB 4X23B 3AYWB 4WU9A 5B32C 2HIOD 3AZJA 3C1BD 1P3IC 5AV6C 1S32A 2PYOD 3VH6W 5CPKA 4Z66D 1ID3D 3AFAC 3AZND 3LJAC 1P3KA 1P3LD 1P3FD 5GXQD 3KWQB 1M19C 5B24B 3A6NB 3AZFA 3MGPA 3TU4D 5BNXB 3MVDB 3KUYA 2YFWA 4X23D 4H9QB 3AYWD 5CPKC 3AV2B 5GSUB 4H9RA 5E5AB 4R8PB 4JJNB 3VH6T 5AV9A 3REIB 3AV1C 1P3PA 2NQBD 5B40B 3MGSC 1M1AA 4KUDA 3NQJA 3AZFC 3MGPC 4KHAB 5FUGA 4Z5TC 3W96B 3KWQD 1KX5A 2NZDC 1P34A 4YS3B 3WA9D 4Z2MH 5DNNA 3AZIA 5AV9C 5AV8C 3KXBC 2HUEB 3MVDD 3REHA 4KGCA 3AV2D 5GSUD 1M1AC 5E5AD 4R8PD 2HIOA 4H9NA 4WNNB 3C1BA 1KX4A 5CP6C 2PYOA 1KX5C 5B0ZD 1P34C 3AZIC 4Z66A 4J8XC 1U35C 5CPJC 3AZNA 3W96D 4WZSB 3REHC 3WAAB 2HIOC 5B1LB 4E44A 2PYOC 1JFIB 4Z66C 4LD9B 1ID3C 1ZLAB 2NQBA 1P3LC 1P3FC 5BT1D 5GXQC 1A7WA 1P3GA 1HQ3A 1TZYB 1KX3C 3TU4C 5CPIB 5F99B 3LZ1C 3KWQA 4ZBJC 4X23C 3AYWC 1F66B 3WA9A 5B33B 5BNXA 5B1LD 2AROB 2L5AA 2FJ7D 5GSUA 4NE6A 5E5AA 4R8PA 5JRGB 3X1VB 1ZLAD 3W99B 3B6GA 3KWQC 5B0ZA 1TZYD 4KHAA 5CPID 5F99D 3MVDC 4H9PB 5DNMB 4J8WB 4J8VB 1BFMA 1F66D 3AV2C 5GSUC 3REIC 5E5AC 4R8PC 5B33D 3AFAD 3UT9B 4XUJB 2AROD 2RVQC 5BNVA 5B40C 5B0ZC 5GT3A 5JRGD 3X1VD 3C1CB 3W96C 3AZEB 1BH9B 3REJD 1F1EA 3AV1D 2YFVA 5AV5B 4ZUXA 2HUEC 3MGSD 5DNMD 4J8VD 4J8WD 1H3OB 3AZMB 3X1SB 4Z5TD 4EO5B 4AWLB 3LZ0B 4XUJD 3X1UB 2FJ7A 5AV8D 3VH5A 5C3IB 5BO0A 3KXBD 1Q9CA 3C1CD 2CWEA 1ZLAA 5B0YB 5B31B 3REKB 3AZKB 5AV5D 1P3BD 4QLCB 4HGAB 5CP6D 1TZYA 1P3IA 2F8NK 5B1LC 5F99A 4NE3A 1N1JB 3AZMD 3X1SD 4J8XD 3MNNB 5CPJD 3AFAA 5G49B 3LJAA 4LD9C 1ZLAC 4E45A 4WU8B 3X1TB 3X1UD 1AOIB 3W98B 4J8UB 5JRGA 1TZYC 3R45A 5B0YD 5B31D 3REKD 5CPIC 5F99C 4M6BA 3REJA 3AV1A 1F66C 5B33C 4H9PA 3MGSA 2AROC 4J8WA 3AZGB 1P3AB 4G91B 4H9OA 1KX3D 3WKJB 5JRGC 4Z5TA 3X1VC 3LZ1D 4G92B 4WU8D 4XUJA 3X1TD 2NZDA 3REJC 1AOID 3W98D 4J8UD 3V9RA 5AV8A 3KXBA 3C1CA 3AN2B 5KDMA 3LELB 3WTPB 2BYKB 5DNMC 4J8WC 4J8VC 3RELB 1P3BA 5CHLB 3UT9C 5CP6A 4XUJC 5B24D 3A6ND 1P3AD 2JSSA 3AZMA 3WKJD 4J8XA 1U35A 5CPJA 3C1CC 3NQUA 3REID 4JJND 5AV5C 1P3BC 5B2IB 3LELD 2RVQD 5B40D 5B31A 5B0YA 3WTPD 4XZQB 3RELD 2F8NG 3AZMC 3X1SC 1P3MB 1ID3A 3UTAB 2LY8A 4EO5C 1P3FA 4AWLC 4DRAA 1R4VA 5GXQA 1P3LA 4YS3D 4CSRB 3X1UC 5C3IC 1KX3A 3TU4A 3LZ1A 5B0YC 5B31C 3REKC 4X23A 3AYWA 3X1TA 3AZKC 5AVCB 4HGAC 5B2ID 4J8UA 3W98A 4NFTA 3VH5W 4UUZB 3MNNC 5B32G 3UTAD 4WU8C 5B24A 4YM6B 3A6NA 3X1TC 1M18B 1P3OB 3WAAD 1AOIC 3W98C 4J8UC 3AZHB 1WWSA 3MVDA 4H9QA 3AV2A 3REIA 5AVCD 4JJNA 4LD9D 3VH5T 5B40A 4CAYB 5B24C 3A6NC 3RELA 3AZGC 1P3AC 4G91C 3WKJC 5B32B 1TAFB 2BYMB 3W96A 4G92C 4YM6D 1M18D 5JA4B 5AVBB 5AV6B 4YS3A 1P3OD 4JJNC 3AZLB 3AZHD 1BH8B 3LELC 3WTPC 3RELC 4WNNA 4WU9B 5B2IA 3W99D 3AZJB 2IO5B 4YS3C 1S32B 1P3KB 5AVBD 5GT0B 3WAAA 3UT9D 3AZLD 5B2IC 5B1LA 3MGPB 4XZQC 3KUYB 3O62B 2YFWB 4WU9D 1JFIA 5AVCA 1P3MC 4H9RB 4LD9A 5AV9B 3MGQB 3UTAC 3AZED 1P3PB 1HTAA 3WAAC 4NE5A 1WWIA 1M1AB 4KUDB 3NQJB 5CPIA 1EQZB 5FUGB 1P3KD 1M18A 5GT0D 1P3OA 1F66A 5B33A 5AVCC 5DNNB 3AZIB 3LZ0D 2AROA 3O62D 3REHB 4KGCB 5AY8B 3W97B 3X1VA 2HIOB 4H9NB 3MGQD 3B6FB 3C1BB 1P3PD 3W99A 1KX4B 4KUDC 3AZKD 4YM6C 1M18C 4QLCD 1P3OC 4KUDD 1TAFA 4Z66B 1EQZD 3AZHC 5B1MB 5DNMA 4J8VA 3AZNB 3B0DB 3MNND 3UT9A 3AZLA 3W99C 4KGCD 5AY8D 3W97D 3B6FD 1KX4D 5BS7A 3AZEA 1BH9A 2NQBB 5AV5A 5AVBC 1P3GB 3AZLC 1HQ3B 5B1MD 3AZGD 1H3OA 5GT0A 3X1SA 4WU9C 3WA9B 3AZJC 3LZ0A 5BS7C 3AZEC 3X1UA 2IO5C 3O62A 1S32C 3AN2D 3MGQA 3REKA 3AZKA 1P3KC 3B6GB 3UTBB 4QLCA 5GT0C 1P3GD 5B0ZB 1HQ3D 1EQZA 3LZ0C 5B2JB 1N1JA 3KUYC 3O62C 3MNNA 5G49A 3MGQC 4WU8A 1P3PC 5BNVB 4QLCC 5AY8A 1AOIA 3B6FA 3W97A 2CV5B
chains in the Genus database with same CATH superfamily
5GT3B 1EQZC 4XZQD 2F8NB 3B6GD 3UTBD 1P3MD 2YFVB 5DNNC 5B2JD 5B1MA 3AZGA 4ZUXB 1P3AA 3WKJA 4KGCC 5AY8C 3W97C 3B6FC 3C1BC 1KX4C 5CPKC 4H9SA 3H0RC 3P5JB 1ULYA 3VH6A 2CV5D 2FJ7B 3AN2A 5BO0B 5GT3D 3LELA 3WTPA 3MGRB 2BYKA 2F8ND 5B1MC 3AZNC 3B0DC 4DRBA 4Z2MG 1KU5A 2JCHA 1P3IB 4ZUXD 4H9SC 3EPHA 1B67A 3AN2C 3AFAB 3LJAB 2NQBC 1M19B 3B0CW 1P3GC 1HQ3C 3MGRD 4XZQA 3R45B 3UTBA 2JE5A 5B32D 3REJB 5CPKB 2BG1A 3AV1B 1P3MA 3UTAA 3WA9C 1P3ID 5B2JA 5AV6D 4CSRA 3B0BA 3MGSB 4H9OB 3AZFB 3B0CT 4Z5TB 3LJAD 3KSYA 3WTPE 1M19D 3B6GC 3UTBC 2NZDB 2Y2JA 3AZJD 2CV5A 2FFFB 3V9RB 5AV8B 1B6WA 3KXBB 5B2JC 5KDMB 1S32D 2VQRA 2F8NA 5CPKD 4UUZA 5B31G 1P3BB 5CP6B 4YM6A 4WV4B 1KX5B 1P34B 3AZFD 3MGPD 3AZHA 4J8XB 2CV5C 5GT3C 1U35B 5CPJB 3KUYD 3NQUB 2NZDD 5BT1C 2Y2OA 5AV9D 3MGRA 4CAYA 4ZUXC 2PYOB 1M1AD 5B32A 2BYMA 1ID3B 5JA4A 5AV6A 5AVBA 2Y2LA 5GXQB 1P3LB 1P3FB 1KX5D 1P34D 2F8NH 5DNND 3AZID 2FJ7C 1BH8A 1U35D 1KX3B 3TU4B 3MGRC 3LZ1B 2ZY3A 3REHD 1M19A 4ZBJB 4X23B 3AYWB 4WU9A 5B32C 2HIOD 3AZJA 3C1BD 1P3IC 5AV6C 1S32A 2PYOD 3VH6W 5CPKA 4Z66D 1ID3D 2Y2IA 3AFAC 3AZND 3LJAC 1P3KA 1P3LD 1P3FD 5GXQD 3KWQB 1M19C 5B24B 3A6NB 3AZFA 3MGPA 3TU4D 5BNXB 3MVDB 3KUYA 2YFWA 2Y2HA 4H9QB 4X23D 3AYWD 3H0LC 3AV2B 5GSUB 4H9RA 5E5AB 4R8PB 4JJNB 3VH6T 5AV9A 3REIB 3AV1C 1P3PA 2NQBD 5B40B 3MGSC 1M1AA 4KUDA 3NQJA 2Y2KA 3MGPC 3AZFC 4KHAB 5FUGA 4Z5TC 3W96B 3KWQD 1KX5A 2NZDC 2ZY2A 1P34A 4YS3B 3WA9D 4Z2MH 5DNNA 3AZIA 5AV9C 5AV8C 3KXBC 2HUEB 3MVDD 3REHA 4KGCA 3AV2D 5GSUD 1M1AC 5E5AD 4R8PD 2HIOA 4H9NA 4WNNB 3C1BA 1KX4A 5CP6C 3A1KA 2PYOA 1KX5C 5B0ZD 1P34C 3AZIC 4Z66A 4J8XC 1U35C 3F6TA 5CPJC 3AZNA 4DQYB 3W96D 2XD1A 4WZSB 3REHC 1T3UA 3WAAB 2HIOC 5B1LB 4E44A 3EPLA 2PYOC 1JFIB 4Z66C 4LD9B 1ID3C 1ZLAB 2NQBA 1P3LC 1P3FC 5BT1D 5GXQC 1A7WA 1P3GA 1HQ3A 1TZYB 2W8SA 1KX3C 3TU4C 5CPIB 5F99B 3LZ1C 3KWQA 4ZBJC 4X23C 3AYWC 1F66B 3WA9A 5B33B 5BNXA 5B1LD 2AROB 2L5AA 2FJ7D 5GSUA 4NE6A 5E5AA 4R8PA 1PZRA 5JRGB 2UWXA 3X1VB 1ZLAD 3W99B 3B6GA 3KWQC 5B0ZA 1TZYD 4KHAA 5CPID 5F99D 3MVDC 4H9PB 5DNMB 4J8WB 4J8VB 1BFMA 1F66D 3AV2C 5GSUC 3REIC 5E5AC 4R8PC 5B33D 3AFAD 3UT9B 2Y2NA 4XUJB 2AROD 2RVQC 5BNVA 5B40C 5B0ZC 5GT3A 5JRGD 3X1VD 3C1CB 3W96C 3AZEB 1BH9B 3REJD 1F1EA 3H0MC 3AV1D 2YFVA 5AV5B 3FDDA 4ZUXA 2HUEC 3MGSD 5DNMD 4J8VD 4J8WD 1H3OB 3AZMB 3X1SB 4Z5TD 2ZY4A 4EO5B 4AWLB 3LZ0B 4XUJD 3A1IA 3X1UB 2FJ7A 5AV8D 3VH5A 5C3IB 5BO0A 3KXBD 1Q9CA 3C1CD 2CWEA 1ZLAA 5B0YB 5B31B 3REKB 3AZKB 5AV5D 1P3BD 4QLCB 4HGAB 5CP6D 1TZYA 1P3IA 2F8NK 5B1LC 5F99A 2F2AC 4NE3A 1N1JB 3AZMD 3X1SD 4J8XD 3MNNB 5CPJD 3AFAA 5G49B 3LJAA 4LD9C 1ZLAC 4E45A 4WU8B 3X1TB 3X1UD 1AOIB 3W98B 4J8UB 5JRGA 1TZYC 2J8PA 3R45A 5B0YD 5B31D 3REKD 5CPIC 5F99C 4M6BA 3REJA 3AV1A 1F66C 5B33C 4H9PA 3MGSA 1W2EA 2AROC 4J8WA 3AZGB 1P3AB 4G91B 4H9OA 1KX3D 3WKJB 5JRGC 4Z5TA 3X1VC 3LZ1D 4G92B 4WU8D 4XUJA 3X1TD 2NZDA 3REJC 2RIQA 1AOID 3W98D 4J8UD 3V9RA 5AV8A 3KXBA 3C1CA 3AN2B 5KDMA 3LELB 3WTPB 2BYKB 5DNMC 4J8WC 4J8VC 3RELB 1P3BA 2G5IC 5CHLB 3UT9C 5CP6A 2XD5A 4XUJC 5B24D 3A6ND 1P3AD 4UPKA 2JSSA 3AZMA 3WKJD 4J8XA 1U35A 5CPJA 3C1CC 3NQUA 3REID 4JJND 5AV5C 1P3BC 3AL0C 5B2IB 3LELD 2RVQD 5B40D 5B31A 5B0YA 3WTPD 4XZQB 3RELD 2F8NG 3AZMC 3X1SC 1P3MB 1ID3A 3KFUG 3UTAB 2LY8A 4EO5C 1P3FA 4AWLC 4DRAA 1R4VA 2Y2MA 5GXQA 1P3LA 4YS3D 4CSRB 3X1UC 2Y2QA 5C3IC 1KX3A 3TU4A 3LZ1A 5B0YC 5B31C 3REKC 4X23A 3AYWA 3X1TA 3AZKC 5AVCB 4HGAC 5B2ID 4J8UA 3W98A 4NFTA 3VH5W 4UUZB 4WJ3C 3MNNC 5B32G 3UTAD 4WU8C 5B24A 4YM6B 3A6NA 3X1TC 1M18B 1P3OB 3WAAD 1AOIC 3W98C 4J8UC 3AZHB 1WWSA 3MVDA 2DQNC 4H9QA 3AV2A 3REIA 5AVCD 4JJNA 4LD9D 3VH5T 2ZM5A 5B40A 4CAYB 5B24C 3A6NC 3RELA 3AZGC 1P3AC 4G91C 3WKJC 5B32B 1TAFB 2BYMB 3W96A 4G92C 4YM6D 1M18D 5JA4B 5AVBB 5AV6B 4YS3A 1P3OD 4JJNC 3AZLB 3AZHD 1BH8B 3LELC 3WTPC 1Z2CB 3RELC 4WNNA 4WU9B 5B2IA 3W99D 3AZJB 2IO5B 4YS3C 1S32B 1P3KB 5AVBD 5GT0B 3WAAA 3UT9D 2G5HC 3AZLD 5B2IC 5B1LA 3MGPB 4XZQC 2Y2PA 3KUYB 3O62B 2YFWB 4WU9D 1JFIA 5AVCA 1P3MC 4H9RB 4LD9A 5AV9B 3MGQB 3UTAC 3AZED 1P3PB 3EPJA 1HTAA 3EPKA 3WAAC 4NE5A 1WWIA 1M1AB 4KUDB 3NQJB 5CPIA 1EQZB 5FUGB 1P3KD 1M18A 5GT0D 1P3OA 1F66A 5B33A 5AVCC 5DNNB 3AZIB 3LZ0D 2AROA 3O62D 3REHB 4KGCB 5AY8B 3W97B 3X1VA 2HIOB 4H9NB 3MGQD 3B6FB 3C1BB 1P3PD 3W99A 1KX4B 4KUDC 2Y2GA 3AZKD 3IP4C 4YM6C 1M18C 4QLCD 1P3OC 4KUDD 1TAFA 4Z66B 1EQZD 3AZHC 5B1MB 5DNMA 4J8VA 3AZNB 3B0DB 3MNND 3UT9A 3AZLA 3W99C 4KGCD 5AY8D 3W97D 3B6FD 1KX4D 5BS7A 3AZEA 1BH9A 2NQBB 5AV5A 5AVBC 1P3GB 3AZLC 1HQ3B 5B1MD 3AZGD 1H3OA 5GT0A 3X1SA 4WU9C 3WA9B 3AZJC 3LZ0A 5BS7C 3AZEC 3EG5B 3X1UA 2IO5C 3O62A 1S32C 3AN2D 2DF4C 3MGQA 3REKA 3AZKA 1P3KC 3B6GB 3UTBB 4QLCA 5GT0C 1P3GD 5B0ZB 1HQ3D 2ZY5A 1EQZA 3LZ0C 5B2JB 1N1JA 3KUYC 3O62C 3MNNA 5G49A 3MGQC 4WU8A 1P3PC 5BNVB 4QLCC 5AY8A 1AOIA 3B6FA 3W97A 2CV5B
chains in the Genus database with same CATH topology
5GT3B 1EQZC 4XZQD 2F8NB 3B6GD 3UTBD 1P3MD 2YFVB 5DNNC 5B2JD 5B1MA 3AZGA 4ZUXB 1P3AA 3WKJA 4KGCC 5AY8C 3W97C 3B6FC 3C1BC 1KX4C 5CPKC 4H9SA 3H0RC 3P5JB 1ULYA 3VH6A 2CV5D 2FJ7B 3AN2A 5BO0B 5GT3D 3LELA 3WTPA 3MGRB 2BYKA 2F8ND 5B1MC 3AZNC 3B0DC 4DRBA 4Z2MG 1KU5A 2JCHA 1P3IB 4ZUXD 4H9SC 3EPHA 1B67A 3AN2C 3AFAB 3LJAB 2NQBC 1M19B 3B0CW 1P3GC 1HQ3C 3MGRD 4XZQA 3R45B 3UTBA 2JE5A 5B32D 3REJB 5CPKB 2BG1A 3AV1B 1P3MA 3UTAA 3WA9C 1P3ID 5B2JA 5AV6D 4CSRA 3B0BA 3MGSB 4H9OB 3AZFB 3B0CT 4Z5TB 3LJAD 3KSYA 3WTPE 1M19D 3B6GC 3UTBC 2NZDB 2Y2JA 3AZJD 2CV5A 2FFFB 3V9RB 5AV8B 1B6WA 3KXBB 5B2JC 5KDMB 1S32D 2VQRA 2F8NA 5CPKD 4UUZA 5B31G 1P3BB 5CP6B 4YM6A 4WV4B 1KX5B 1P34B 3AZFD 3MGPD 3AZHA 4J8XB 2CV5C 5GT3C 1U35B 5CPJB 3KUYD 3NQUB 2NZDD 5BT1C 2Y2OA 5AV9D 3MGRA 4CAYA 4ZUXC 2PYOB 1M1AD 5B32A 2BYMA 1ID3B 5JA4A 5AV6A 5AVBA 2Y2LA 5GXQB 1P3LB 1P3FB 1KX5D 1P34D 2F8NH 5DNND 3AZID 2FJ7C 1BH8A 1U35D 1KX3B 3TU4B 3MGRC 3LZ1B 2ZY3A 3REHD 1M19A 4ZBJB 4X23B 3AYWB 4WU9A 5B32C 2HIOD 3AZJA 3C1BD 1P3IC 5AV6C 1S32A 2PYOD 3VH6W 5CPKA 4Z66D 1ID3D 2Y2IA 3AFAC 3AZND 3LJAC 1P3KA 1P3LD 1P3FD 5GXQD 3KWQB 1M19C 5B24B 3A6NB 3AZFA 3MGPA 3TU4D 5BNXB 3MVDB 3KUYA 2YFWA 2Y2HA 4H9QB 4X23D 3AYWD 3H0LC 3AV2B 5GSUB 4H9RA 5E5AB 4R8PB 4JJNB 3VH6T 5AV9A 3REIB 3AV1C 1P3PA 2NQBD 5B40B 3MGSC 1M1AA 4KUDA 3NQJA 2Y2KA 3MGPC 3AZFC 4KHAB 5FUGA 4Z5TC 3W96B 3KWQD 1KX5A 2NZDC 2ZY2A 1P34A 4YS3B 3WA9D 4Z2MH 5DNNA 3AZIA 5AV9C 5AV8C 3KXBC 2HUEB 3MVDD 3REHA 4KGCA 3AV2D 5GSUD 1M1AC 5E5AD 4R8PD 2HIOA 4H9NA 4WNNB 3C1BA 1KX4A 5CP6C 3A1KA 2PYOA 1KX5C 5B0ZD 1P34C 3AZIC 4Z66A 4J8XC 1U35C 3F6TA 5CPJC 3AZNA 4DQYB 3W96D 2XD1A 4WZSB 3REHC 1T3UA 3WAAB 2HIOC 5B1LB 4E44A 3EPLA 2PYOC 1JFIB 4Z66C 4LD9B 1ID3C 1ZLAB 2NQBA 1P3LC 1P3FC 5BT1D 5GXQC 1A7WA 1P3GA 1HQ3A 1TZYB 2W8SA 1KX3C 3TU4C 5CPIB 5F99B 3LZ1C 3KWQA 4ZBJC 4X23C 3AYWC 1F66B 3WA9A 5B33B 5BNXA 5B1LD 2AROB 2L5AA 2FJ7D 5GSUA 4NE6A 5E5AA 4R8PA 1PZRA 5JRGB 2UWXA 3X1VB 1ZLAD 3W99B 3B6GA 3KWQC 5B0ZA 1TZYD 4KHAA 5CPID 5F99D 3MVDC 4H9PB 5DNMB 4J8WB 4J8VB 1BFMA 1F66D 3AV2C 5GSUC 3REIC 5E5AC 4R8PC 5B33D 3AFAD 3UT9B 2Y2NA 4XUJB 2AROD 2RVQC 5BNVA 5B40C 5B0ZC 5GT3A 5JRGD 3X1VD 3C1CB 3W96C 3AZEB 1BH9B 3REJD 1F1EA 3H0MC 3AV1D 2YFVA 5AV5B 3FDDA 4ZUXA 2HUEC 3MGSD 5DNMD 4J8VD 4J8WD 1H3OB 3AZMB 3X1SB 4Z5TD 2ZY4A 4EO5B 4AWLB 3LZ0B 4XUJD 3A1IA 3X1UB 2FJ7A 5AV8D 3VH5A 5C3IB 5BO0A 3KXBD 1Q9CA 3C1CD 2CWEA 1ZLAA 5B0YB 5B31B 3REKB 3AZKB 5AV5D 1P3BD 4QLCB 4HGAB 5CP6D 1TZYA 1P3IA 2F8NK 5B1LC 5F99A 2F2AC 4NE3A 1N1JB 3AZMD 3X1SD 4J8XD 3MNNB 5CPJD 3AFAA 5G49B 3LJAA 4LD9C 1ZLAC 4E45A 4WU8B 3X1TB 3X1UD 1AOIB 3W98B 4J8UB 5JRGA 1TZYC 2J8PA 3R45A 5B0YD 5B31D 3REKD 5CPIC 5F99C 4M6BA 3REJA 3AV1A 1F66C 5B33C 4H9PA 3MGSA 1W2EA 2AROC 4J8WA 3AZGB 1P3AB 4G91B 4H9OA 1KX3D 3WKJB 5JRGC 4Z5TA 3X1VC 3LZ1D 4G92B 4WU8D 4XUJA 3X1TD 2NZDA 3REJC 2RIQA 1AOID 3W98D 4J8UD 3V9RA 5AV8A 3KXBA 3C1CA 3AN2B 5KDMA 3LELB 3WTPB 2BYKB 5DNMC 4J8WC 4J8VC 3RELB 1P3BA 2G5IC 5CHLB 3UT9C 5CP6A 2XD5A 4XUJC 5B24D 3A6ND 1P3AD 4UPKA 2JSSA 3AZMA 3WKJD 4J8XA 1U35A 5CPJA 3C1CC 3NQUA 3REID 4JJND 5AV5C 1P3BC 3AL0C 5B2IB 3LELD 2RVQD 5B40D 5B31A 5B0YA 3WTPD 4XZQB 3RELD 2F8NG 3AZMC 3X1SC 1P3MB 1ID3A 3KFUG 3UTAB 2LY8A 4EO5C 1P3FA 4AWLC 4DRAA 1R4VA 2Y2MA 5GXQA 1P3LA 4YS3D 4CSRB 3X1UC 2Y2QA 5C3IC 1KX3A 3TU4A 3LZ1A 5B0YC 5B31C 3REKC 4X23A 3AYWA 3X1TA 3AZKC 5AVCB 4HGAC 5B2ID 4J8UA 3W98A 4NFTA 3VH5W 4UUZB 4WJ3C 3MNNC 5B32G 3UTAD 4WU8C 5B24A 4YM6B 3A6NA 3X1TC 1M18B 1P3OB 3WAAD 1AOIC 3W98C 4J8UC 3AZHB 1WWSA 3MVDA 2DQNC 4H9QA 3AV2A 3REIA 5AVCD 4JJNA 4LD9D 3VH5T 2ZM5A 5B40A 4CAYB 5B24C 3A6NC 3RELA 3AZGC 1P3AC 4G91C 3WKJC 5B32B 1TAFB 2BYMB 3W96A 4G92C 4YM6D 1M18D 5JA4B 5AVBB 5AV6B 4YS3A 1P3OD 4JJNC 3AZLB 3AZHD 1BH8B 3LELC 3WTPC 1Z2CB 3RELC 4WNNA 4WU9B 5B2IA 3W99D 3AZJB 2IO5B 4YS3C 1S32B 1P3KB 5AVBD 5GT0B 3WAAA 3UT9D 2G5HC 3AZLD 5B2IC 5B1LA 3MGPB 4XZQC 2Y2PA 3KUYB 3O62B 2YFWB 4WU9D 1JFIA 5AVCA 1P3MC 4H9RB 4LD9A 5AV9B 3MGQB 3UTAC 3AZED 1P3PB 3EPJA 1HTAA 3EPKA 3WAAC 4NE5A 1WWIA 1M1AB 4KUDB 3NQJB 5CPIA 1EQZB 5FUGB 1P3KD 1M18A 5GT0D 1P3OA 1F66A 5B33A 5AVCC 5DNNB 3AZIB 3LZ0D 2AROA 3O62D 3REHB 4KGCB 5AY8B 3W97B 3X1VA 2HIOB 4H9NB 3MGQD 3B6FB 3C1BB 1P3PD 3W99A 1KX4B 4KUDC 2Y2GA 3AZKD 3IP4C 4YM6C 1M18C 4QLCD 1P3OC 4KUDD 1TAFA 4Z66B 1EQZD 3AZHC 5B1MB 5DNMA 4J8VA 3AZNB 3B0DB 3MNND 3UT9A 3AZLA 3W99C 4KGCD 5AY8D 3W97D 3B6FD 1KX4D 5BS7A 3AZEA 1BH9A 2NQBB 5AV5A 5AVBC 1P3GB 3AZLC 1HQ3B 5B1MD 3AZGD 1H3OA 5GT0A 3X1SA 4WU9C 3WA9B 3AZJC 3LZ0A 5BS7C 3AZEC 3EG5B 3X1UA 2IO5C 3O62A 1S32C 3AN2D 2DF4C 3MGQA 3REKA 3AZKA 1P3KC 3B6GB 3UTBB 4QLCA 5GT0C 1P3GD 5B0ZB 1HQ3D 2ZY5A 1EQZA 3LZ0C 5B2JB 1N1JA 3KUYC 3O62C 3MNNA 5G49A 3MGQC 4WU8A 1P3PC 5BNVB 4QLCC 5AY8A 1AOIA 3B6FA 3W97A 2CV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 B;  1EQZ C;  4XZQ D;  2F8N B;  3B6G D;  3UTB D;  1P3M D;  2YFV B;  5DNN C;  5B2J D;  5B1M A;  3AZG A;  4ZUX B;  1P3A A;  3WKJ A;  4KGC C;  5AY8 C;  3W97 C;  3B6F C;  3C1B C;  1KX4 C;  4H9S A;  1ULY A;  3VH6 A;  2CV5 D;  2FJ7 B;  3AN2 A;  5BO0 B;  5GT3 D;  3LEL A;  3WTP A;  3MGR B;  2BYK A;  2F8N D;  5B1M C;  3AZN C;  3B0D C;  4DRB A;  4Z2M G;  1KU5 A;  1P3I B;  4ZUX D;  4H9S C;  1B67 A;  3AN2 C;  3AFA B;  3LJA B;  2NQB C;  1M19 B;  3B0C W;  1P3G C;  1HQ3 C;  3MGR D;  4XZQ A;  3R45 B;  3UTB A;  5B32 D;  3REJ B;  5CPK B;  1P3M A;  3AV1 B;  3UTA A;  3WA9 C;  1P3I D;  5B2J A;  5AV6 D;  4CSR A;  3B0B A;  3MGS B;  4H9O B;  3AZF B;  3B0C T;  4Z5T B;  3LJA D;  3KSY A;  3WTP E;  1M19 D;  3B6G C;  3UTB C;  2NZD B;  3AZJ D;  2CV5 A;  3V9R B;  5AV8 B;  1B6W A;  3KXB B;  5B2J C;  5KDM B;  1S32 D;  2F8N A;  5CPK D;  4UUZ A;  5B31 G;  1P3B B;  5CP6 B;  4YM6 A;  4WV4 B;  1KX5 B;  1P34 B;  3AZF D;  3MGP D;  3AZH A;  4J8X B;  2CV5 C;  5GT3 C;  1U35 B;  5CPJ B;  3KUY D;  3NQU B;  2NZD D;  5BT1 C;  5AV9 D;  3MGR A;  4CAY A;  4ZUX C;  2PYO B;  1M1A D;  5B32 A;  2BYM A;  1ID3 B;  5JA4 A;  5AV6 A;  5AVB A;  1P3L B;  5GXQ B;  1P3F B;  1KX5 D;  2F8N H;  1P34 D;  5DNN D;  3AZI D;  2FJ7 C;  1BH8 A;  1U35 D;  1KX3 B;  3TU4 B;  3MGR C;  3LZ1 B;  3REH D;  1M19 A;  4ZBJ B;  4X23 B;  3AYW B;  4WU9 A;  5B32 C;  2HIO D;  3AZJ A;  3C1B D;  1P3I C;  5AV6 C;  1S32 A;  2PYO D;  3VH6 W;  5CPK A;  4Z66 D;  1ID3 D;  3AFA C;  3AZN D;  3LJA C;  1P3K A;  1P3L D;  1P3F D;  5GXQ D;  3KWQ B;  1M19 C;  5B24 B;  3A6N B;  3AZF A;  3MGP A;  3TU4 D;  5BNX B;  3MVD B;  3KUY A;  2YFW A;  4X23 D;  4H9Q B;  3AYW D;  5CPK C;  3AV2 B;  5GSU B;  4H9R A;  5E5A B;  4R8P B;  4JJN B;  3VH6 T;  5AV9 A;  3REI B;  3AV1 C;  1P3P A;  2NQB D;  5B40 B;  3MGS C;  1M1A A;  4KUD A;  3NQJ A;  3AZF C;  3MGP C;  4KHA B;  5FUG A;  4Z5T C;  3W96 B;  3KWQ D;  1KX5 A;  2NZD C;  1P34 A;  4YS3 B;  3WA9 D;  4Z2M H;  5DNN A;  3AZI A;  5AV9 C;  5AV8 C;  3KXB C;  2HUE B;  3MVD D;  3REH A;  4KGC A;  3AV2 D;  5GSU D;  1M1A C;  5E5A D;  4R8P D;  2HIO A;  4H9N A;  4WNN B;  3C1B A;  1KX4 A;  5CP6 C;  2PYO A;  1KX5 C;  5B0Z D;  1P34 C;  3AZI C;  4Z66 A;  4J8X C;  1U35 C;  5CPJ C;  3AZN A;  3W96 D;  4WZS B;  3REH C;  3WAA B;  2HIO C;  5B1L B;  4E44 A;  2PYO C;  1JFI B;  4Z66 C;  4LD9 B;  1ID3 C;  1ZLA B;  2NQB A;  1P3L C;  1P3F C;  5BT1 D;  5GXQ C;  1A7W A;  1P3G A;  1HQ3 A;  1TZY B;  1KX3 C;  3TU4 C;  5CPI B;  5F99 B;  3LZ1 C;  3KWQ A;  4ZBJ C;  4X23 C;  3AYW C;  1F66 B;  3WA9 A;  5B33 B;  5BNX A;  5B1L D;  2ARO B;  2L5A A;  2FJ7 D;  5GSU A;  4NE6 A;  5E5A A;  4R8P A;  5JRG B;  3X1V B;  1ZLA D;  3W99 B;  3B6G A;  3KWQ C;  5B0Z A;  1TZY D;  4KHA A;  5CPI D;  5F99 D;  3MVD C;  4H9P B;  5DNM B;  4J8W B;  4J8V B;  1BFM A;  1F66 D;  3AV2 C;  5GSU C;  3REI C;  5E5A C;  4R8P C;  5B33 D;  3AFA D;  3UT9 B;  4XUJ B;  2ARO D;  2RVQ C;  5BNV A;  5B40 C;  5B0Z C;  5GT3 A;  5JRG D;  3X1V D;  3C1C B;  3W96 C;  3AZE B;  1BH9 B;  3REJ D;  1F1E A;  3AV1 D;  2YFV A;  5AV5 B;  4ZUX A;  2HUE C;  3MGS D;  5DNM D;  4J8V D;  4J8W D;  1H3O B;  3AZM B;  3X1S B;  4Z5T D;  4EO5 B;  4AWL B;  3LZ0 B;  4XUJ D;  3X1U B;  2FJ7 A;  5AV8 D;  3VH5 A;  5C3I B;  5BO0 A;  3KXB D;  1Q9C A;  3C1C D;  2CWE A;  1ZLA A;  5B0Y B;  5B31 B;  3REK B;  3AZK B;  5AV5 D;  1P3B D;  4QLC B;  4HGA B;  5CP6 D;  1TZY A;  1P3I A;  2F8N K;  5B1L C;  5F99 A;  4NE3 A;  1N1J B;  3AZM D;  3X1S D;  4J8X D;  3MNN B;  5CPJ D;  3AFA A;  5G49 B;  3LJA A;  4LD9 C;  1ZLA C;  4E45 A;  4WU8 B;  3X1T B;  3X1U D;  1AOI B;  3W98 B;  4J8U B;  5JRG A;  1TZY C;  3R45 A;  5B0Y D;  5B31 D;  3REK D;  5CPI C;  5F99 C;  4M6B A;  3REJ A;  3AV1 A;  1F66 C;  5B33 C;  4H9P A;  3MGS A;  2ARO C;  4J8W A;  3AZG B;  1P3A B;  4G91 B;  4H9O A;  1KX3 D;  3WKJ B;  5JRG C;  4Z5T A;  3X1V C;  3LZ1 D;  4G92 B;  4WU8 D;  4XUJ A;  3X1T D;  2NZD A;  3REJ C;  1AOI D;  3W98 D;  4J8U D;  3V9R A;  5AV8 A;  3KXB A;  3C1C A;  3AN2 B;  5KDM A;  3LEL B;  3WTP B;  2BYK B;  5DNM C;  4J8W C;  4J8V C;  3REL B;  1P3B A;  5CHL B;  3UT9 C;  5CP6 A;  4XUJ C;  5B24 D;  3A6N D;  1P3A D;  2JSS A;  3AZM A;  3WKJ D;  4J8X A;  1U35 A;  5CPJ A;  3C1C C;  3NQU A;  3REI D;  4JJN D;  5AV5 C;  1P3B C;  5B2I B;  3LEL D;  2RVQ D;  5B40 D;  5B31 A;  5B0Y A;  3WTP D;  4XZQ B;  3REL D;  2F8N G;  3AZM C;  3X1S C;  1P3M B;  1ID3 A;  3UTA B;  2LY8 A;  4EO5 C;  1P3F A;  4AWL C;  4DRA A;  1R4V A;  5GXQ A;  1P3L A;  4YS3 D;  4CSR B;  3X1U C;  5C3I C;  1KX3 A;  3TU4 A;  3LZ1 A;  5B0Y C;  5B31 C;  3REK C;  4X23 A;  3AYW A;  3X1T A;  3AZK C;  5AVC B;  4HGA C;  5B2I D;  4J8U A;  3W98 A;  4NFT A;  3VH5 W;  4UUZ B;  3MNN C;  5B32 G;  3UTA D;  4WU8 C;  5B24 A;  4YM6 B;  3A6N A;  3X1T C;  1M18 B;  1P3O B;  3WAA D;  1AOI C;  3W98 C;  4J8U C;  3AZH B;  1WWS A;  3MVD A;  4H9Q A;  3AV2 A;  3REI A;  5AVC D;  4JJN A;  4LD9 D;  3VH5 T;  5B40 A;  4CAY B;  5B24 C;  3A6N C;  3REL A;  3AZG C;  1P3A C;  4G91 C;  3WKJ C;  5B32 B;  1TAF B;  2BYM B;  3W96 A;  4G92 C;  4YM6 D;  1M18 D;  5JA4 B;  5AVB B;  5AV6 B;  4YS3 A;  1P3O D;  4JJN C;  3AZL B;  3AZH D;  1BH8 B;  3LEL C;  3WTP C;  3REL C;  4WNN A;  4WU9 B;  5B2I A;  3W99 D;  3AZJ B;  2IO5 B;  4YS3 C;  1S32 B;  1P3K B;  5AVB D;  5GT0 B;  3WAA A;  3UT9 D;  3AZL D;  5B2I C;  5B1L A;  3MGP B;  4XZQ C;  3KUY B;  3O62 B;  2YFW B;  4WU9 D;  1JFI A;  5AVC A;  1P3M C;  4H9R B;  4LD9 A;  5AV9 B;  3MGQ B;  3UTA C;  3AZE D;  1P3P B;  1HTA A;  3WAA C;  4NE5 A;  1WWI A;  1M1A B;  4KUD B;  3NQJ B;  5CPI A;  1EQZ B;  5FUG B;  1P3K D;  1M18 A;  5GT0 D;  1P3O A;  1F66 A;  5B33 A;  5AVC C;  5DNN B;  3AZI B;  3LZ0 D;  2ARO A;  3O62 D;  3REH B;  4KGC B;  5AY8 B;  3W97 B;  3X1V A;  2HIO B;  4H9N B;  3MGQ D;  3B6F B;  3C1B B;  1P3P D;  3W99 A;  1KX4 B;  4KUD C;  3AZK D;  4YM6 C;  1M18 C;  4QLC D;  1P3O C;  4KUD D;  1TAF A;  4Z66 B;  1EQZ D;  3AZH C;  5B1M B;  5DNM A;  4J8V A;  3AZN B;  3B0D B;  3MNN D;  3UT9 A;  3AZL A;  3W99 C;  4KGC D;  5AY8 D;  3W97 D;  3B6F D;  1KX4 D;  5BS7 A;  3AZE A;  1BH9 A;  2NQB B;  5AV5 A;  5AVB C;  1P3G B;  3AZL C;  1HQ3 B;  5B1M D;  3AZG D;  1H3O A;  5GT0 A;  3X1S A;  4WU9 C;  3WA9 B;  3AZJ C;  3LZ0 A;  5BS7 C;  3AZE C;  3X1U A;  2IO5 C;  3O62 A;  1S32 C;  3AN2 D;  3MGQ A;  3REK A;  3AZK A;  1P3K C;  3B6G B;  3UTB B;  4QLC A;  5GT0 C;  1P3G D;  5B0Z B;  1HQ3 D;  1EQZ A;  3LZ0 C;  5B2J B;  1N1J A;  3KUY C;  3O62 C;  3MNN A;  5G49 A;  3MGQ C;  4WU8 A;  1P3P C;  5BNV B;  4QLC C;  5AY8 A;  1AOI A;  3B6F A;  3W97 A;  2CV5 B; 
#chains in the Genus database with same CATH topology
 5GT3 B;  1EQZ C;  4XZQ D;  2F8N B;  3B6G D;  3UTB D;  1P3M D;  2YFV B;  5DNN C;  5B2J D;  5B1M A;  3AZG A;  4ZUX B;  1P3A A;  3WKJ A;  4KGC C;  5AY8 C;  3W97 C;  3B6F C;  3C1B C;  1KX4 C;  5CPK C;  4H9S A;  3H0R C;  3P5J B;  1ULY A;  3VH6 A;  2CV5 D;  2FJ7 B;  3AN2 A;  5BO0 B;  5GT3 D;  3LEL A;  3WTP A;  3MGR B;  2BYK A;  2F8N D;  5B1M C;  3AZN C;  3B0D C;  4DRB A;  4Z2M G;  1KU5 A;  2JCH A;  1P3I B;  4ZUX D;  4H9S C;  3EPH A;  1B67 A;  3AN2 C;  3AFA B;  3LJA B;  2NQB C;  1M19 B;  3B0C W;  1P3G C;  1HQ3 C;  3MGR D;  4XZQ A;  3R45 B;  3UTB A;  2JE5 A;  5B32 D;  3REJ B;  5CPK B;  2BG1 A;  3AV1 B;  1P3M A;  3UTA A;  3WA9 C;  1P3I D;  5B2J A;  5AV6 D;  4CSR A;  3B0B A;  3MGS B;  4H9O B;  3AZF B;  3B0C T;  4Z5T B;  3LJA D;  3KSY A;  3WTP E;  1M19 D;  3B6G C;  3UTB C;  2NZD B;  2Y2J A;  3AZJ D;  2CV5 A;  2FFF B;  3V9R B;  5AV8 B;  1B6W A;  3KXB B;  5B2J C;  5KDM B;  1S32 D;  2VQR A;  2F8N A;  5CPK D;  4UUZ A;  5B31 G;  1P3B B;  5CP6 B;  4YM6 A;  4WV4 B;  1KX5 B;  1P34 B;  3AZF D;  3MGP D;  3AZH A;  4J8X B;  2CV5 C;  5GT3 C;  1U35 B;  5CPJ B;  3KUY D;  3NQU B;  2NZD D;  5BT1 C;  2Y2O A;  5AV9 D;  3MGR A;  4CAY A;  4ZUX C;  2PYO B;  1M1A D;  5B32 A;  2BYM A;  1ID3 B;  5JA4 A;  5AV6 A;  5AVB A;  2Y2L A;  5GXQ B;  1P3L B;  1P3F B;  1KX5 D;  1P34 D;  2F8N H;  5DNN D;  3AZI D;  2FJ7 C;  1BH8 A;  1U35 D;  1KX3 B;  3TU4 B;  3MGR C;  3LZ1 B;  2ZY3 A;  3REH D;  1M19 A;  4ZBJ B;  4X23 B;  3AYW B;  4WU9 A;  5B32 C;  2HIO D;  3AZJ A;  3C1B D;  1P3I C;  5AV6 C;  1S32 A;  2PYO D;  3VH6 W;  5CPK A;  4Z66 D;  1ID3 D;  2Y2I A;  3AFA C;  3AZN D;  3LJA C;  1P3K A;  1P3L D;  1P3F D;  5GXQ D;  3KWQ B;  1M19 C;  5B24 B;  3A6N B;  3AZF A;  3MGP A;  3TU4 D;  5BNX B;  3MVD B;  3KUY A;  2YFW A;  2Y2H A;  4H9Q B;  4X23 D;  3AYW D;  3H0L C;  3AV2 B;  5GSU B;  4H9R A;  5E5A B;  4R8P B;  4JJN B;  3VH6 T;  5AV9 A;  3REI B;  3AV1 C;  1P3P A;  2NQB D;  5B40 B;  3MGS C;  1M1A A;  4KUD A;  3NQJ A;  2Y2K A;  3MGP C;  3AZF C;  4KHA B;  5FUG A;  4Z5T C;  3W96 B;  3KWQ D;  1KX5 A;  2NZD C;  2ZY2 A;  1P34 A;  4YS3 B;  3WA9 D;  4Z2M H;  5DNN A;  3AZI A;  5AV9 C;  5AV8 C;  3KXB C;  2HUE B;  3MVD D;  3REH A;  4KGC A;  3AV2 D;  5GSU D;  1M1A C;  5E5A D;  4R8P D;  2HIO A;  4H9N A;  4WNN B;  3C1B A;  1KX4 A;  5CP6 C;  3A1K A;  2PYO A;  1KX5 C;  5B0Z D;  1P34 C;  3AZI C;  4Z66 A;  4J8X C;  1U35 C;  3F6T A;  5CPJ C;  3AZN A;  4DQY B;  3W96 D;  2XD1 A;  4WZS B;  3REH C;  1T3U A;  3WAA B;  2HIO C;  5B1L B;  4E44 A;  3EPL A;  2PYO C;  1JFI B;  4Z66 C;  4LD9 B;  1ID3 C;  1ZLA B;  2NQB A;  1P3L C;  1P3F C;  5BT1 D;  5GXQ C;  1A7W A;  1P3G A;  1HQ3 A;  1TZY B;  2W8S A;  1KX3 C;  3TU4 C;  5CPI B;  5F99 B;  3LZ1 C;  3KWQ A;  4ZBJ C;  4X23 C;  3AYW C;  1F66 B;  3WA9 A;  5B33 B;  5BNX A;  5B1L D;  2ARO B;  2L5A A;  2FJ7 D;  5GSU A;  4NE6 A;  5E5A A;  4R8P A;  1PZR A;  5JRG B;  2UWX A;  3X1V B;  1ZLA D;  3W99 B;  3B6G A;  3KWQ C;  5B0Z A;  1TZY D;  4KHA A;  5CPI D;  5F99 D;  3MVD C;  4H9P B;  5DNM B;  4J8W B;  4J8V B;  1BFM A;  1F66 D;  3AV2 C;  5GSU C;  3REI C;  5E5A C;  4R8P C;  5B33 D;  3AFA D;  3UT9 B;  2Y2N A;  4XUJ B;  2ARO D;  2RVQ C;  5BNV A;  5B40 C;  5B0Z C;  5GT3 A;  5JRG D;  3X1V D;  3C1C B;  3W96 C;  3AZE B;  1BH9 B;  3REJ D;  1F1E A;  3H0M C;  3AV1 D;  2YFV A;  5AV5 B;  3FDD A;  4ZUX A;  2HUE C;  3MGS D;  5DNM D;  4J8V D;  4J8W D;  1H3O B;  3AZM B;  3X1S B;  4Z5T D;  2ZY4 A;  4EO5 B;  4AWL B;  3LZ0 B;  4XUJ D;  3A1I A;  3X1U B;  2FJ7 A;  5AV8 D;  3VH5 A;  5C3I B;  5BO0 A;  3KXB D;  1Q9C A;  3C1C D;  2CWE A;  1ZLA A;  5B0Y B;  5B31 B;  3REK B;  3AZK B;  5AV5 D;  1P3B D;  4QLC B;  4HGA B;  5CP6 D;  1TZY A;  1P3I A;  2F8N K;  5B1L C;  5F99 A;  2F2A C;  4NE3 A;  1N1J B;  3AZM D;  3X1S D;  4J8X D;  3MNN B;  5CPJ D;  3AFA A;  5G49 B;  3LJA A;  4LD9 C;  1ZLA C;  4E45 A;  4WU8 B;  3X1T B;  3X1U D;  1AOI B;  3W98 B;  4J8U B;  5JRG A;  1TZY C;  2J8P A;  3R45 A;  5B0Y D;  5B31 D;  3REK D;  5CPI C;  5F99 C;  4M6B A;  3REJ A;  3AV1 A;  1F66 C;  5B33 C;  4H9P A;  3MGS A;  1W2E A;  2ARO C;  4J8W A;  3AZG B;  1P3A B;  4G91 B;  4H9O A;  1KX3 D;  3WKJ B;  5JRG C;  4Z5T A;  3X1V C;  3LZ1 D;  4G92 B;  4WU8 D;  4XUJ A;  3X1T D;  2NZD A;  3REJ C;  2RIQ A;  1AOI D;  3W98 D;  4J8U D;  3V9R A;  5AV8 A;  3KXB A;  3C1C A;  3AN2 B;  5KDM A;  3LEL B;  3WTP B;  2BYK B;  5DNM C;  4J8W C;  4J8V C;  3REL B;  1P3B A;  2G5I C;  5CHL B;  3UT9 C;  5CP6 A;  2XD5 A;  4XUJ C;  5B24 D;  3A6N D;  1P3A D;  4UPK A;  2JSS A;  3AZM A;  3WKJ D;  4J8X A;  1U35 A;  5CPJ A;  3C1C C;  3NQU A;  3REI D;  4JJN D;  5AV5 C;  1P3B C;  3AL0 C;  5B2I B;  3LEL D;  2RVQ D;  5B40 D;  5B31 A;  5B0Y A;  3WTP D;  4XZQ B;  3REL D;  2F8N G;  3AZM C;  3X1S C;  1P3M B;  1ID3 A;  3KFU G;  3UTA B;  2LY8 A;  4EO5 C;  1P3F A;  4AWL C;  4DRA A;  1R4V A;  2Y2M A;  5GXQ A;  1P3L A;  4YS3 D;  4CSR B;  3X1U C;  2Y2Q A;  5C3I C;  1KX3 A;  3TU4 A;  3LZ1 A;  5B0Y C;  5B31 C;  3REK C;  4X23 A;  3AYW A;  3X1T A;  3AZK C;  5AVC B;  4HGA C;  5B2I D;  4J8U A;  3W98 A;  4NFT A;  3VH5 W;  4UUZ B;  4WJ3 C;  3MNN C;  5B32 G;  3UTA D;  4WU8 C;  5B24 A;  4YM6 B;  3A6N A;  3X1T C;  1M18 B;  1P3O B;  3WAA D;  1AOI C;  3W98 C;  4J8U C;  3AZH B;  1WWS A;  3MVD A;  2DQN C;  4H9Q A;  3AV2 A;  3REI A;  5AVC D;  4JJN A;  4LD9 D;  3VH5 T;  2ZM5 A;  5B40 A;  4CAY B;  5B24 C;  3A6N C;  3REL A;  3AZG C;  1P3A C;  4G91 C;  3WKJ C;  5B32 B;  1TAF B;  2BYM B;  3W96 A;  4G92 C;  4YM6 D;  1M18 D;  5JA4 B;  5AVB B;  5AV6 B;  4YS3 A;  1P3O D;  4JJN C;  3AZL B;  3AZH D;  1BH8 B;  3LEL C;  3WTP C;  1Z2C B;  3REL C;  4WNN A;  4WU9 B;  5B2I A;  3W99 D;  3AZJ B;  2IO5 B;  4YS3 C;  1S32 B;  1P3K B;  5AVB D;  5GT0 B;  3WAA A;  3UT9 D;  2G5H C;  3AZL D;  5B2I C;  5B1L A;  3MGP B;  4XZQ C;  2Y2P A;  3KUY B;  3O62 B;  2YFW B;  4WU9 D;  1JFI A;  5AVC A;  1P3M C;  4H9R B;  4LD9 A;  5AV9 B;  3MGQ B;  3UTA C;  3AZE D;  1P3P B;  3EPJ A;  1HTA A;  3EPK A;  3WAA C;  4NE5 A;  1WWI A;  1M1A B;  4KUD B;  3NQJ B;  5CPI A;  1EQZ B;  5FUG B;  1P3K D;  1M18 A;  5GT0 D;  1P3O A;  1F66 A;  5B33 A;  5AVC C;  5DNN B;  3AZI B;  3LZ0 D;  2ARO A;  3O62 D;  3REH B;  4KGC B;  5AY8 B;  3W97 B;  3X1V A;  2HIO B;  4H9N B;  3MGQ D;  3B6F B;  3C1B B;  1P3P D;  3W99 A;  1KX4 B;  4KUD C;  2Y2G A;  3AZK D;  3IP4 C;  4YM6 C;  1M18 C;  4QLC D;  1P3O C;  4KUD D;  1TAF A;  4Z66 B;  1EQZ D;  3AZH C;  5B1M B;  5DNM A;  4J8V A;  3AZN B;  3B0D B;  3MNN D;  3UT9 A;  3AZL A;  3W99 C;  4KGC D;  5AY8 D;  3W97 D;  3B6F D;  1KX4 D;  5BS7 A;  3AZE A;  1BH9 A;  2NQB B;  5AV5 A;  5AVB C;  1P3G B;  3AZL C;  1HQ3 B;  5B1M D;  3AZG D;  1H3O A;  5GT0 A;  3X1S A;  4WU9 C;  3WA9 B;  3AZJ C;  3LZ0 A;  5BS7 C;  3AZE C;  3EG5 B;  3X1U A;  2IO5 C;  3O62 A;  1S32 C;  3AN2 D;  2DF4 C;  3MGQ A;  3REK A;  3AZK A;  1P3K C;  3B6G B;  3UTB B;  4QLC A;  5GT0 C;  1P3G D;  5B0Z B;  1HQ3 D;  2ZY5 A;  1EQZ A;  3LZ0 C;  5B2J B;  1N1J A;  3KUY C;  3O62 C;  3MNN A;  5G49 A;  3MGQ C;  4WU8 A;  1P3P C;  5BNV B;  4QLC C;  5AY8 A;  1AOI A;  3B6F A;  3W97 A;  2CV5 B; 
#chains in the Genus database with same CATH homology
 5GT3 B;  1EQZ C;  4XZQ D;  2F8N B;  3B6G D;  3UTB D;  1P3M D;  2YFV B;  5DNN C;  5B2J D;  5B1M A;  3AZG A;  4ZUX B;  1P3A A;  3WKJ A;  4KGC C;  5AY8 C;  3W97 C;  3B6F C;  3C1B C;  1KX4 C;  5CPK C;  4H9S A;  3H0R C;  3P5J B;  1ULY A;  3VH6 A;  2CV5 D;  2FJ7 B;  3AN2 A;  5BO0 B;  5GT3 D;  3LEL A;  3WTP A;  3MGR B;  2BYK A;  2F8N D;  5B1M C;  3AZN C;  3B0D C;  4DRB A;  4Z2M G;  1KU5 A;  2JCH A;  1P3I B;  4ZUX D;  4H9S C;  3EPH A;  1B67 A;  3AN2 C;  3AFA B;  3LJA B;  2NQB C;  1M19 B;  3B0C W;  1P3G C;  1HQ3 C;  3MGR D;  4XZQ A;  3R45 B;  3UTB A;  2JE5 A;  5B32 D;  3REJ B;  5CPK B;  2BG1 A;  3AV1 B;  1P3M A;  3UTA A;  3WA9 C;  1P3I D;  5B2J A;  5AV6 D;  4CSR A;  3B0B A;  3MGS B;  4H9O B;  3AZF B;  3B0C T;  4Z5T B;  3LJA D;  3KSY A;  3WTP E;  1M19 D;  3B6G C;  3UTB C;  2NZD B;  2Y2J A;  3AZJ D;  2CV5 A;  2FFF B;  3V9R B;  5AV8 B;  1B6W A;  3KXB B;  5B2J C;  5KDM B;  1S32 D;  2VQR A;  2F8N A;  5CPK D;  4UUZ A;  5B31 G;  1P3B B;  5CP6 B;  4YM6 A;  4WV4 B;  1KX5 B;  1P34 B;  3AZF D;  3MGP D;  3AZH A;  4J8X B;  2CV5 C;  5GT3 C;  1U35 B;  5CPJ B;  3KUY D;  3NQU B;  2NZD D;  5BT1 C;  2Y2O A;  5AV9 D;  3MGR A;  4CAY A;  4ZUX C;  2PYO B;  1M1A D;  5B32 A;  2BYM A;  1ID3 B;  5JA4 A;  5AV6 A;  5AVB A;  2Y2L A;  5GXQ B;  1P3L B;  1P3F B;  1KX5 D;  1P34 D;  2F8N H;  5DNN D;  3AZI D;  2FJ7 C;  1BH8 A;  1U35 D;  1KX3 B;  3TU4 B;  3MGR C;  3LZ1 B;  2ZY3 A;  3REH D;  1M19 A;  4ZBJ B;  4X23 B;  3AYW B;  4WU9 A;  5B32 C;  2HIO D;  3AZJ A;  3C1B D;  1P3I C;  5AV6 C;  1S32 A;  2PYO D;  3VH6 W;  5CPK A;  4Z66 D;  1ID3 D;  2Y2I A;  3AFA C;  3AZN D;  3LJA C;  1P3K A;  1P3L D;  1P3F D;  5GXQ D;  3KWQ B;  1M19 C;  5B24 B;  3A6N B;  3AZF A;  3MGP A;  3TU4 D;  5BNX B;  3MVD B;  3KUY A;  2YFW A;  2Y2H A;  4H9Q B;  4X23 D;  3AYW D;  3H0L C;  3AV2 B;  5GSU B;  4H9R A;  5E5A B;  4R8P B;  4JJN B;  3VH6 T;  5AV9 A;  3REI B;  3AV1 C;  1P3P A;  2NQB D;  5B40 B;  3MGS C;  1M1A A;  4KUD A;  3NQJ A;  2Y2K A;  3MGP C;  3AZF C;  4KHA B;  5FUG A;  4Z5T C;  3W96 B;  3KWQ D;  1KX5 A;  2NZD C;  2ZY2 A;  1P34 A;  4YS3 B;  3WA9 D;  4Z2M H;  5DNN A;  3AZI A;  5AV9 C;  5AV8 C;  3KXB C;  2HUE B;  3MVD D;  3REH A;  4KGC A;  3AV2 D;  5GSU D;  1M1A C;  5E5A D;  4R8P D;  2HIO A;  4H9N A;  4WNN B;  3C1B A;  1KX4 A;  5CP6 C;  3A1K A;  2PYO A;  1KX5 C;  5B0Z D;  1P34 C;  3AZI C;  4Z66 A;  4J8X C;  1U35 C;  3F6T A;  5CPJ C;  3AZN A;  4DQY B;  3W96 D;  2XD1 A;  4WZS B;  3REH C;  1T3U A;  3WAA B;  2HIO C;  5B1L B;  4E44 A;  3EPL A;  2PYO C;  1JFI B;  4Z66 C;  4LD9 B;  1ID3 C;  1ZLA B;  2NQB A;  1P3L C;  1P3F C;  5BT1 D;  5GXQ C;  1A7W A;  1P3G A;  1HQ3 A;  1TZY B;  2W8S A;  1KX3 C;  3TU4 C;  5CPI B;  5F99 B;  3LZ1 C;  3KWQ A;  4ZBJ C;  4X23 C;  3AYW C;  1F66 B;  3WA9 A;  5B33 B;  5BNX A;  5B1L D;  2ARO B;  2L5A A;  2FJ7 D;  5GSU A;  4NE6 A;  5E5A A;  4R8P A;  1PZR A;  5JRG B;  2UWX A;  3X1V B;  1ZLA D;  3W99 B;  3B6G A;  3KWQ C;  5B0Z A;  1TZY D;  4KHA A;  5CPI D;  5F99 D;  3MVD C;  4H9P B;  5DNM B;  4J8W B;  4J8V B;  1BFM A;  1F66 D;  3AV2 C;  5GSU C;  3REI C;  5E5A C;  4R8P C;  5B33 D;  3AFA D;  3UT9 B;  2Y2N A;  4XUJ B;  2ARO D;  2RVQ C;  5BNV A;  5B40 C;  5B0Z C;  5GT3 A;  5JRG D;  3X1V D;  3C1C B;  3W96 C;  3AZE B;  1BH9 B;  3REJ D;  1F1E A;  3H0M C;  3AV1 D;  2YFV A;  5AV5 B;  3FDD A;  4ZUX A;  2HUE C;  3MGS D;  5DNM D;  4J8V D;  4J8W D;  1H3O B;  3AZM B;  3X1S B;  4Z5T D;  2ZY4 A;  4EO5 B;  4AWL B;  3LZ0 B;  4XUJ D;  3A1I A;  3X1U B;  2FJ7 A;  5AV8 D;  3VH5 A;  5C3I B;  5BO0 A;  3KXB D;  1Q9C A;  3C1C D;  2CWE A;  1ZLA A;  5B0Y B;  5B31 B;  3REK B;  3AZK B;  5AV5 D;  1P3B D;  4QLC B;  4HGA B;  5CP6 D;  1TZY A;  1P3I A;  2F8N K;  5B1L C;  5F99 A;  2F2A C;  4NE3 A;  1N1J B;  3AZM D;  3X1S D;  4J8X D;  3MNN B;  5CPJ D;  3AFA A;  5G49 B;  3LJA A;  4LD9 C;  1ZLA C;  4E45 A;  4WU8 B;  3X1T B;  3X1U D;  1AOI B;  3W98 B;  4J8U B;  5JRG A;  1TZY C;  2J8P A;  3R45 A;  5B0Y D;  5B31 D;  3REK D;  5CPI C;  5F99 C;  4M6B A;  3REJ A;  3AV1 A;  1F66 C;  5B33 C;  4H9P A;  3MGS A;  1W2E A;  2ARO C;  4J8W A;  3AZG B;  1P3A B;  4G91 B;  4H9O A;  1KX3 D;  3WKJ B;  5JRG C;  4Z5T A;  3X1V C;  3LZ1 D;  4G92 B;  4WU8 D;  4XUJ A;  3X1T D;  2NZD A;  3REJ C;  2RIQ A;  1AOI D;  3W98 D;  4J8U D;  3V9R A;  5AV8 A;  3KXB A;  3C1C A;  3AN2 B;  5KDM A;  3LEL B;  3WTP B;  2BYK B;  5DNM C;  4J8W C;  4J8V C;  3REL B;  1P3B A;  2G5I C;  5CHL B;  3UT9 C;  5CP6 A;  2XD5 A;  4XUJ C;  5B24 D;  3A6N D;  1P3A D;  4UPK A;  2JSS A;  3AZM A;  3WKJ D;  4J8X A;  1U35 A;  5CPJ A;  3C1C C;  3NQU A;  3REI D;  4JJN D;  5AV5 C;  1P3B C;  3AL0 C;  5B2I B;  3LEL D;  2RVQ D;  5B40 D;  5B31 A;  5B0Y A;  3WTP D;  4XZQ B;  3REL D;  2F8N G;  3AZM C;  3X1S C;  1P3M B;  1ID3 A;  3KFU G;  3UTA B;  2LY8 A;  4EO5 C;  1P3F A;  4AWL C;  4DRA A;  1R4V A;  2Y2M A;  5GXQ A;  1P3L A;  4YS3 D;  4CSR B;  3X1U C;  2Y2Q A;  5C3I C;  1KX3 A;  3TU4 A;  3LZ1 A;  5B0Y C;  5B31 C;  3REK C;  4X23 A;  3AYW A;  3X1T A;  3AZK C;  5AVC B;  4HGA C;  5B2I D;  4J8U A;  3W98 A;  4NFT A;  3VH5 W;  4UUZ B;  4WJ3 C;  3MNN C;  5B32 G;  3UTA D;  4WU8 C;  5B24 A;  4YM6 B;  3A6N A;  3X1T C;  1M18 B;  1P3O B;  3WAA D;  1AOI C;  3W98 C;  4J8U C;  3AZH B;  1WWS A;  3MVD A;  2DQN C;  4H9Q A;  3AV2 A;  3REI A;  5AVC D;  4JJN A;  4LD9 D;  3VH5 T;  2ZM5 A;  5B40 A;  4CAY B;  5B24 C;  3A6N C;  3REL A;  3AZG C;  1P3A C;  4G91 C;  3WKJ C;  5B32 B;  1TAF B;  2BYM B;  3W96 A;  4G92 C;  4YM6 D;  1M18 D;  5JA4 B;  5AVB B;  5AV6 B;  4YS3 A;  1P3O D;  4JJN C;  3AZL B;  3AZH D;  1BH8 B;  3LEL C;  3WTP C;  1Z2C B;  3REL C;  4WNN A;  4WU9 B;  5B2I A;  3W99 D;  3AZJ B;  2IO5 B;  4YS3 C;  1S32 B;  1P3K B;  5AVB D;  5GT0 B;  3WAA A;  3UT9 D;  2G5H C;  3AZL D;  5B2I C;  5B1L A;  3MGP B;  4XZQ C;  2Y2P A;  3KUY B;  3O62 B;  2YFW B;  4WU9 D;  1JFI A;  5AVC A;  1P3M C;  4H9R B;  4LD9 A;  5AV9 B;  3MGQ B;  3UTA C;  3AZE D;  1P3P B;  3EPJ A;  1HTA A;  3EPK A;  3WAA C;  4NE5 A;  1WWI A;  1M1A B;  4KUD B;  3NQJ B;  5CPI A;  1EQZ B;  5FUG B;  1P3K D;  1M18 A;  5GT0 D;  1P3O A;  1F66 A;  5B33 A;  5AVC C;  5DNN B;  3AZI B;  3LZ0 D;  2ARO A;  3O62 D;  3REH B;  4KGC B;  5AY8 B;  3W97 B;  3X1V A;  2HIO B;  4H9N B;  3MGQ D;  3B6F B;  3C1B B;  1P3P D;  3W99 A;  1KX4 B;  4KUD C;  2Y2G A;  3AZK D;  3IP4 C;  4YM6 C;  1M18 C;  4QLC D;  1P3O C;  4KUD D;  1TAF A;  4Z66 B;  1EQZ D;  3AZH C;  5B1M B;  5DNM A;  4J8V A;  3AZN B;  3B0D B;  3MNN D;  3UT9 A;  3AZL A;  3W99 C;  4KGC D;  5AY8 D;  3W97 D;  3B6F D;  1KX4 D;  5BS7 A;  3AZE A;  1BH9 A;  2NQB B;  5AV5 A;  5AVB C;  1P3G B;  3AZL C;  1HQ3 B;  5B1M D;  3AZG D;  1H3O A;  5GT0 A;  3X1S A;  4WU9 C;  3WA9 B;  3AZJ C;  3LZ0 A;  5BS7 C;  3AZE C;  3EG5 B;  3X1U A;  2IO5 C;  3O62 A;  1S32 C;  3AN2 D;  2DF4 C;  3MGQ A;  3REK A;  3AZK A;  1P3K C;  3B6G B;  3UTB B;  4QLC A;  5GT0 C;  1P3G D;  5B0Z B;  1HQ3 D;  2ZY5 A;  1EQZ A;  3LZ0 C;  5B2J B;  1N1J A;  3KUY C;  3O62 C;  3MNN A;  5G49 A;  3MGQ C;  4WU8 A;  1P3P C;  5BNV B;  4QLC C;  5AY8 A;  1AOI A;  3B6F A;  3W97 A;  2CV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...