1HQ3A

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
total genus 32
structure length 106
sequence length 106
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3A00
4WU8A 3AZNA 3LZ1B 5B33D 1N1JB 3AV2B 1ID3A 5B1LD 2NQBA 3REHC 3REID 5GSUC 3MGRD 4G91C 4XUJD 1P3ID 3W98D 3AV1B 2AROD 3MVDB 1HQ3C 4KHAA 3UTAD 5B1LA 1P34C 1P3KD 3REIA 3AZLC 4JJND 3R45B 5CPKC 2YFWA 1P3BD 1TZYA 4CAYB 4WV4B 4Z5TA 5CPJC 3A6NB 5JA4B 1U35C 4KGCA 5B0YC 5BNXB 3LZ1D 5B32C 3AV2D 4QLCC 4AWLB 5DNNB 1P3AC 4J8UC 4KUDB 3AZGB 1AOIA 3MGQC 2BYMA 5BT1D 3B0BA 3AV1D 4H9OA 3B6GA 1BH9A 3MVDD 4G92B 5F99B 1S32B 1P3FB 2IO5B 3W99C 5B0ZB 2F8NK 1P3OB 3UTBB 3AZEA 5JRGB 2HIOB 5AVBA 3A6ND 5AV5B 5B1MA 5AY8B 4J8XB 5B2JA 5DNMC 1P3LC 4UUZA 4Z66B 3MGPB 2PYOA 3VH5T 1EQZB 4Z2MG 5AV6C 1P3GC 5DNND 1M19B 3X1TB 4J8WB 4CAYA 4KUDD 3AZGD 1B6WA 3V9RA 3LZ0B 4DRBA 1H3OB 5C3IB 4JJNC 1M1AB 4YM6A 1P3BC 2FJ7C 5CP6C 1KX5C 5F99D 1S32D 1P3FD 5B0ZD 5CHLB 5AVCB 5GT3A 5B2IC 1P3OD 3UTBD 4KUDA 4YS3B 5JRGD 3NQJA 5FUGB 2HIOD 3LZ1C 1P3PC 3MGSA 4R8PC 3X1VA 4LD9C 3WA9B 4H9PB 5AV5D 5AY8D 3AZHB 4J8XD 3LELC 4Z66D 4H9QB 3WKJC 3MGPD 3KWQB 3AZIB 1EQZD 1TAFA 3RELA 3B6FC 1M19D 3X1TD 4H9RB 5B40B 3AV1C 4J8WD 1KX4A 4WU8B 3C1CB 3LZ0D 3AYWA 3AZNB 1ID3B 1ZLAA 5AV5A 5AY8A 2NQBB 1M1AD 2YFVA 1F66C 4CSRA 1KX3C 2F8NH 4Z66A 4WZSB 1F1EA 4J8VA 3NQUA 3X1SC 3A6NC 5AVCD 4J8WA 3C1BA 4YS3D 3AZKC 4KHAB 5B24C 5B31C 3WA9D 3AZHD 2YFWB 3W96A 1M18A 1TZYB 3O62C 3KWQD 3AZID 4Z5TB 4X23C 1P3MC 5B40D 5FUGA 5KDMA 4KGCB 4WU8D 3C1CD 3REHA 3AZND 1ID3D 4G92C 1JFIA 5BNVA 2NQBD 5F99C 1P3FC 5GSUA 5BS7C 1P3OC 3UTBC 5JRGC 3REJB 3AZFC 1AOIB 4NFTA 5GXQC 4H9SC 2BYMB 5B40A 3KUYB 1HQ3A 4H9OB 1Q9CA 3B6GB 1BH9B 3C1CA 3AZLA 3VH5A 5E5AC 3AZEB 1TZYD 3AZMC 1U35A 4Z5TD 5AVBB 1M1AC 2NZDC 5B1MB 5B32A 4KGCD 3UT9D 5B2JB 4QLCA 4UUZB 3TU4C 1P3AA 5CPID 2PYOB 4HGAC 5AV9C 3AZJC 3B0CT 3WTPC 3MGQA 4YS3C 3REJD 3WAAC 3MNNC 1AOID 3V9RB 3KUYD 4ZUXA 3UT9A 4YM6B 3B6GD 2CV5C 3REKC 3W99A 5CPIA 4XZQC 5GT3B 3REJA 3AZED 3NQJB 2HUEC 3AFAC 4NE6A 3W97A 3MGSB 3KUYA 3X1VB 5AVBD 5DNMA 5B1MD 1P3LA 3KXBA 5B2JD 5AV6A 5AV8A 1P3GA 2PYOD 1TAFB 3RELB 3KSYA 1KX4B 5B33C 2BYKA 3AYWB 5B1LC 4WU9B 1ZLAB 3REIC 2FJ7A 5CP6A 2YFVB 5GT0B 4YM6D 3MGRC 4CSRB 2CWEA 1KX5A 4XUJC 4WNNA 1P3IC 4J8VB 3NQUB 5B2IA 3W98C 2AROC 5GT3D 1P3PA 3C1BB 4R8PA 3UTAC 1P3KC 3MGSD 3LJAA 3X1VD 2F8NA 4EO5C 3LELA 3B0DB 3X1UA 3W96B 1M18B 3B6FA 3VH6W 4ZBJB 3RELD 5G49A 5KDMB 3AV2C 1KX4D 3REHB 3AYWD 3AN2A 1JFIB 1F66A 4WU9D 5BNVB 1ZLAD 1KX3A 5GSUB 4G91B 5GT0D 3X1SA 4J8VD 5BT1C 1HQ3B 1P34B 3MVDC 3C1BD 3AZLB 5B2JC 5B31A 1ULYA 4WU9A 5GT0A 3O62A 3W96D 1M18D 4X23A 1U35B 4NE3A 5B0YB 5B32B 2F8NG 4QLCB 3REHD 5BS7A 1P3AB 5GSUD 4AWLC 5DNNC 3AZFA 3MGQB 4KUDC 3AZGC 4H9SA 3X1VC 1HQ3D 4ZUXB 1R4VA 3UT9B 1P34D 3AZLD 5BO0B 5E5AA 3W99B 1S32C 5CPIB 2IO5C 5B0ZC 3AZMA 2HIOC 1KX4C 2NZDA 1U35D 1HTAA 3W97B 5AV5C 5AY8C 5B31G 5B0YD 5DNMB 1P34A 1P3LB 3KXBB 4J8XC 5B32D 3TU4A 1BFMA 4QLCD 5CPKA 4Z66C 5AV6B 5AV8B 3MGPC 5AV9A 1P3GB 1P3AD 3AZJA 1EQZC 1M19C 3X1TC 3WAAA 3MNNA 4J8WC 3MGQD 5CPJA 3C1BC 3LZ0C 2BYKB 4H9NA 5C3IC 5B0YA 2FJ7B 5CP6B 4ZUXD 2CV5A 3REKA 1KX5B 4WNNB 3W99D 4NE5A 4XZQA 4J8UA 5B2IB 1KU5A 5AVCC 1P3PB 3AFAA 4R8PB 4LD9B 1A7WA 3W97D 3LJAB 3WA9C 2F8NB 3AZHC 5DNMD 1P3LD 1WWIA 3KXBD 3LELB 5BO0A 3X1UB 3WKJB 5AV6D 5AV8D 3KWQC 3AZIC 1BH8A 1P3GD 3B6FB 2L5AA 1WWSA 4M6BA 5B40C 5G49B 5B33A 4WU8C 3C1CC 3AZNC 1ID3C 3AN2B 1F66B 2NQBC 3MGRA 3VH5W 1KX3B 2FJ7D 4XUJA 5CP6D 1P3IA 1KX5D 3W98A 2JSSA 3X1SB 2AROA 5B2ID 3AZKB 3UTAA 1P3KA 1P3PD 4R8PD 5B24B 4JJNA 4LD9D 5B31B 5B32G 3LJAD 1P3BA 2F8ND 3VH6A 3LELD 3O62B 3X1UD 3WKJD 1TZYC 4X23B 3B6FD 4Z5TC 1P3MB 3AV2A 3LZ1A 1N1JA 4ZUXC 3UT9C 4KGCC 4LD9A 3AN2D 1F66D 5CPIC 1KX3D 3WKJA 1B67A 3AZFB 3REJC 5GXQB 4Z2MH 1AOIC 3X1SD 3AV1A 3W97C 3MVDA 3KUYC 3AZKD 3B6GC 3KXBC 5B24D 3R45A 5B31D 5E5AB 5AV8C 2RVQD 4E44A 3O62D 3AZMB 3AZEC 2LY8A 3A6NA 5JA4A 4X23D 2NZDB 1P3MD 5AVBC 3AZKA 5B1MC 3WTPE 5BNXA 5B24A 3TU4B 5CPKB 4HGAB 5DNNA 2PYOC 5AV9B 3AZJB 3WTPB 3AZGA 3WAAB 3AZFD 3MNNB 5CPJB 5GXQD 1P3MA 4H9NB 3LJAC 4YM6C 2CV5B 3REKB 4DRAA 5F99A 1S32A 1P3FA 3X1UC 5B0ZA 5E5AD 4XZQB 4J8UB 1P3OA 3UTBA 5JRGA 5GT3C 3AZMD 2HIOA 5GXQA 2HUEB 3VH6T 3AFAB 3MGSC 2NZDD 3AN2C 4J8XA 3TU4D 3MGPA 5CPKD 1EQZA 1M19A 3X1TA 5AV9D 1BH8B 3AZJD 3RELC 3WTPD 3WAAD 3LZ0A 5B33B 3MNND 5B1LB 5CPJD 1H3OA 1M1AA 3REIB 3AYWC 4WU9C 1ZLAC 3MGRB 4E45A 5GT0C 4XUJB 2CV5D 2RVQC 3REKD 1P3IB 3B0CW 3W98B 4J8VC 4XZQD 5AVCA 4J8UD 2AROB 3WTPA 4YS3A 3UTAB 1P3KB 3AFAD 4JJNB 3WA9A 4H9PA 3AZHA 4EO5B 1P3BB 3B0DC 3W96C 4H9QA 3KWQA 1M18C 3AZIA 4ZBJC 4H9RA
chains in the Genus database with same CATH superfamily
4WU8A 3AZNA 3LZ1B 5B33D 1N1JB 3AV2B 1ID3A 5B1LD 2NQBA 3REHC 3REID 5GSUC 2Y2IA 3MGRD 4G91C 4XUJD 1P3ID 3W98D 3AV1B 2AROD 3MVDB 1HQ3C 4KHAA 3UTAD 5B1LA 1P34C 1P3KD 3REIA 3AZLC 4JJND 3R45B 5CPKC 2YFWA 1P3BD 1TZYA 4CAYB 4WV4B 4Z5TA 5CPJC 3A6NB 5JA4B 1U35C 4KGCA 5B0YC 5BNXB 3LZ1D 5B32C 3AV2D 4QLCC 4AWLB 5DNNB 1P3AC 4J8UC 4KUDB 3AZGB 1AOIA 3MGQC 2BYMA 3EPHA 5BT1D 3B0BA 3AV1D 4H9OA 3B6GA 1BH9A 3MVDD 4G92B 5F99B 1S32B 1P3FB 2IO5B 3W99C 5B0ZB 2F8NK 1P3OB 3UTBB 3AZEA 5JRGB 4UPKA 2HIOB 5AVBA 3A6ND 5AV5B 5B1MA 5AY8B 4J8XB 5B2JA 5DNMC 1P3LC 4UUZA 4Z66B 3MGPB 2PYOA 3VH5T 1EQZB 4Z2MG 5AV6C 3EG5B 5DNND 1P3GC 1M19B 3X1TB 4J8WB 4CAYA 2F2AC 4KUDD 3AZGD 1B6WA 3V9RA 3LZ0B 4DRBA 1H3OB 5C3IB 4JJNC 1M1AB 4YM6A 1P3BC 2FJ7C 5CP6C 1KX5C 5F99D 1S32D 1P3FD 5B0ZD 5CHLB 5AVCB 5GT3A 5B2IC 1P3OD 3UTBD 4KUDA 4YS3B 5JRGD 3NQJA 5FUGB 2HIOD 3LZ1C 1P3PC 3MGSA 4R8PC 3X1VA 4LD9C 3WA9B 4H9PB 5AV5D 5AY8D 3AZHB 2Y2KA 4J8XD 1W2EA 3LELC 4Z66D 4H9QB 3WKJC 3MGPD 3KWQB 3AZIB 1EQZD 1TAFA 3RELA 3B6FC 1M19D 3X1TD 4H9RB 5B40B 3AV1C 4J8WD 1KX4A 4WU8B 3C1CB 3LZ0D 3AYWA 3AZNB 1ID3B 1ZLAA 5AV5A 5AY8A 2NQBB 1M1AD 2YFVA 3FDDA 1F66C 3A1KA 4CSRA 1KX3C 2F8NH 4Z66A 4WZSB 1F1EA 4J8VA 3NQUA 3X1SC 2W8SA 5AVCD 3A6NC 4J8WA 3C1BA 4YS3D 3AZKC 4KHAB 5B24C 5B31C 3WA9D 3AZHD 2YFWB 3W96A 1M18A 1TZYB 3O62C 3KWQD 3AZID 4Z5TB 4X23C 1P3MC 5B40D 5FUGA 5KDMA 4KGCB 4WU8D 3C1CD 3REHA 3AZND 1ID3D 4G92C 1JFIA 5BNVA 2ZM5A 2NQBD 5F99C 1P3FC 5GSUA 5BS7C 1P3OC 3UTBC 5JRGC 3REJB 3AZFC 1AOIB 4NFTA 5GXQC 2BYMB 4H9SC 5B40A 3KUYB 1HQ3A 4H9OB 1Q9CA 3B6GB 1BH9B 3C1CA 3AZLA 3VH5A 5E5AC 3AZEB 1TZYD 3AZMC 3EPKA 1U35A 4Z5TD 5AVBB 1M1AC 2NZDC 5B1MB 3AL0C 5B32A 4KGCD 3UT9D 5B2JB 4QLCA 4UUZB 3TU4C 2ZY4A 1P3AA 5CPID 2PYOB 4HGAC 5AV9C 3AZJC 3B0CT 3WTPC 3MGQA 4YS3C 3REJD 3WAAC 3MNNC 1AOID 3V9RB 2G5HC 3KUYD 4ZUXA 3UT9A 4YM6B 3B6GD 2CV5C 3REKC 3W99A 5CPIA 3EPJA 4XZQC 2XD1A 5GT3B 2Y2MA 3REJA 3AZED 3NQJB 2HUEC 3AFAC 4NE6A 3W97A 3MGSB 3KUYA 3X1VB 5AVBD 2Y2OA 5DNMA 5B1MD 1P3LA 3KXBA 5B2JD 5AV6A 2Y2NA 5AV8A 1P3GA 2PYOD 1TAFB 3RELB 3KSYA 1KX4B 5B33C 2BYKA 3AYWB 5B1LC 4WU9B 1ZLAB 3REIC 2FJ7A 5CP6A 2YFVB 5GT0B 2Y2GA 4YM6D 3MGRC 4CSRB 2CWEA 1KX5A 4XUJC 4WNNA 1P3IC 4J8VB 3NQUB 5B2IA 3W98C 3A1IA 2AROC 5GT3D 1P3PA 3C1BB 4R8PA 3UTAC 1P3KC 1PZRA 3MGSD 3LJAA 3X1VD 2F8NA 4EO5C 3LELA 3B0DB 3X1UA 3W96B 1M18B 3B6FA 3VH6W 4ZBJB 3RELD 5G49A 5KDMB 3AV2C 1KX4D 3REHB 3AYWD 3AN2A 1JFIB 1F66A 4WU9D 5BNVB 1ZLAD 1KX3A 5GSUB 4G91B 5GT0D 3X1SA 4J8VD 5BT1C 1HQ3B 1P34B 3MVDC 3C1BD 3AZLB 5B2JC 5B31A 1ULYA 4WU9A 4DQYB 5GT0A 3O62A 3W96D 1M18D 4X23A 1U35B 4NE3A 2BG1A 5B0YB 5B32B 2F8NG 4QLCB 3REHD 3EPLA 2RIQA 5BS7A 1P3AB 5GSUD 4AWLC 5DNNC 1Z2CB 3AZFA 3MGQB 4KUDC 3AZGC 4H9SA 3X1VC 1HQ3D 4ZUXB 1R4VA 3UT9B 1P34D 3AZLD 5BO0B 5E5AA 3W99B 2G5IC 1S32C 5CPIB 2IO5C 5B0ZC 3AZMA 2HIOC 2Y2PA 1KX4C 2NZDA 1U35D 1HTAA 3W97B 5AV5C 5AY8C 5B31G 5B0YD 5DNMB 1P34A 1P3LB 3KXBB 4J8XC 5B32D 3TU4A 1BFMA 4QLCD 1T3UA 5CPKA 3KFUG 4Z66C 4WJ3C 5AV6B 5AV8B 3MGPC 5AV9A 1P3GB 1P3AD 3AZJA 1EQZC 1M19C 3X1TC 3WAAA 3MNNA 4J8WC 3MGQD 5CPJA 3C1BC 3LZ0C 2BYKB 4H9NA 5C3IC 5B0YA 2FJ7B 5CP6B 4ZUXD 2CV5A 3REKA 1KX5B 4WNNB 2FFFB 4NE5A 3W99D 4XZQA 4J8UA 5B2IB 1KU5A 5AVCC 1P3PB 3AFAA 4R8PB 4LD9B 1A7WA 2VQRA 3W97D 3LJAB 3WA9C 2F8NB 3AZHC 3H0LC 5DNMD 1P3LD 1WWIA 3KXBD 3LELB 5BO0A 3X1UB 3WKJB 5AV6D 5AV8D 3KWQC 3AZIC 1BH8A 3H0RC 1P3GD 2L5AA 2Y2QA 3B6FB 1WWSA 4M6BA 5B40C 5G49B 5B33A 2J8PA 4WU8C 3C1CC 3AZNC 1ID3C 3AN2B 1F66B 2NQBC 3MGRA 3VH5W 1KX3B 2ZY2A 4XUJA 5CP6D 2FJ7D 1P3IA 1KX5D 3W98A 2XD5A 3P5JB 2JSSA 3X1SB 2AROA 5B2ID 3AZKB 3UTAA 1P3KA 1P3PD 4R8PD 5B24B 4JJNA 4LD9D 5B31B 5B32G 3LJAD 1P3BA 2F8ND 3VH6A 3LELD 2JCHA 3O62B 3X1UD 3WKJD 1TZYC 4X23B 3B6FD 4Z5TC 1P3MB 3AV2A 3LZ1A 1N1JA 4ZUXC 3UT9C 4KGCC 4LD9A 3AN2D 1F66D 5CPIC 1KX3D 3WKJA 1B67A 3AZFB 2ZY5A 3REJC 5GXQB 4Z2MH 1AOIC 3X1SD 2DQNC 3AV1A 3W97C 3MVDA 3KUYC 3AZKD 3B6GC 3KXBC 5B24D 3R45A 5B31D 5E5AB 5AV8C 2RVQD 4E44A 3O62D 3AZMB 3AZEC 2LY8A 2Y2JA 3A6NA 5JA4A 4X23D 2NZDB 1P3MD 5AVBC 3AZKA 5B1MC 3WTPE 5BNXA 5B24A 3TU4B 5CPKB 4HGAB 5DNNA 2PYOC 5AV9B 2ZY3A 3AZJB 3WTPB 3AZGA 3WAAB 3AZFD 3MNNB 5CPJB 5GXQD 2DF4C 1P3MA 4H9NB 3LJAC 2UWXA 4YM6C 2CV5B 3REKB 4DRAA 5F99A 1S32A 1P3FA 3X1UC 5B0ZA 5E5AD 4XZQB 4J8UB 1P3OA 3UTBA 5JRGA 5GT3C 3AZMD 2HIOA 2HUEB 3VH6T 5GXQA 3AFAB 3MGSC 2NZDD 3AN2C 4J8XA 3F6TA 3TU4D 2Y2HA 3MGPA 5CPKD 1EQZA 1M19A 3H0MC 3X1TA 5AV9D 1BH8B 3AZJD 3RELC 3WTPD 3WAAD 3LZ0A 5B33B 3MNND 5B1LB 5CPJD 1H3OA 1M1AA 3REIB 3AYWC 4WU9C 1ZLAC 3MGRB 4E45A 5GT0C 4XUJB 2CV5D 2RVQC 3REKD 1P3IB 3B0CW 3W98B 4J8VC 4XZQD 5AVCA 4J8UD 2AROB 3WTPA 4YS3A 3UTAB 1P3KB 3AFAD 4JJNB 3WA9A 4H9PA 3AZHA 2Y2LA 4EO5B 3IP4C 1P3BB 2JE5A 3B0DC 3W96C 4H9QA 3KWQA 1M18C 3AZIA 4ZBJC 4H9RA
chains in the Genus database with same CATH topology
4WU8A 3AZNA 3LZ1B 5B33D 1N1JB 3AV2B 1ID3A 5B1LD 2NQBA 3REHC 3REID 5GSUC 2Y2IA 3MGRD 4G91C 4XUJD 1P3ID 3W98D 3AV1B 2AROD 3MVDB 1HQ3C 4KHAA 3UTAD 5B1LA 1P34C 1P3KD 3REIA 3AZLC 4JJND 3R45B 5CPKC 2YFWA 1P3BD 1TZYA 4CAYB 4WV4B 4Z5TA 5CPJC 3A6NB 5JA4B 1U35C 4KGCA 5B0YC 5BNXB 3LZ1D 5B32C 3AV2D 4QLCC 4AWLB 5DNNB 1P3AC 4J8UC 4KUDB 3AZGB 1AOIA 3MGQC 2BYMA 3EPHA 5BT1D 3B0BA 3AV1D 4H9OA 3B6GA 1BH9A 3MVDD 4G92B 5F99B 1S32B 1P3FB 2IO5B 3W99C 5B0ZB 2F8NK 1P3OB 3UTBB 3AZEA 5JRGB 4UPKA 2HIOB 5AVBA 3A6ND 5AV5B 5B1MA 5AY8B 4J8XB 5B2JA 5DNMC 1P3LC 4UUZA 4Z66B 3MGPB 2PYOA 3VH5T 1EQZB 4Z2MG 5AV6C 3EG5B 5DNND 1P3GC 1M19B 3X1TB 4J8WB 4CAYA 2F2AC 4KUDD 3AZGD 1B6WA 3V9RA 3LZ0B 4DRBA 1H3OB 5C3IB 4JJNC 1M1AB 4YM6A 1P3BC 2FJ7C 5CP6C 1KX5C 5F99D 1S32D 1P3FD 5B0ZD 5CHLB 5AVCB 5GT3A 5B2IC 1P3OD 3UTBD 4KUDA 4YS3B 5JRGD 3NQJA 5FUGB 2HIOD 3LZ1C 1P3PC 3MGSA 4R8PC 3X1VA 4LD9C 3WA9B 4H9PB 5AV5D 5AY8D 3AZHB 2Y2KA 4J8XD 1W2EA 3LELC 4Z66D 4H9QB 3WKJC 3MGPD 3KWQB 3AZIB 1EQZD 1TAFA 3RELA 3B6FC 1M19D 3X1TD 4H9RB 5B40B 3AV1C 4J8WD 1KX4A 4WU8B 3C1CB 3LZ0D 3AYWA 3AZNB 1ID3B 1ZLAA 5AV5A 5AY8A 2NQBB 1M1AD 2YFVA 3FDDA 1F66C 3A1KA 4CSRA 1KX3C 2F8NH 4Z66A 4WZSB 1F1EA 4J8VA 3NQUA 3X1SC 2W8SA 5AVCD 3A6NC 4J8WA 3C1BA 4YS3D 3AZKC 4KHAB 5B24C 5B31C 3WA9D 3AZHD 2YFWB 3W96A 1M18A 1TZYB 3O62C 3KWQD 3AZID 4Z5TB 4X23C 1P3MC 5B40D 5FUGA 5KDMA 4KGCB 4WU8D 3C1CD 3REHA 3AZND 1ID3D 4G92C 1JFIA 5BNVA 2ZM5A 2NQBD 5F99C 1P3FC 5GSUA 5BS7C 1P3OC 3UTBC 5JRGC 3REJB 3AZFC 1AOIB 4NFTA 5GXQC 2BYMB 4H9SC 5B40A 3KUYB 1HQ3A 4H9OB 1Q9CA 3B6GB 1BH9B 3C1CA 3AZLA 3VH5A 5E5AC 3AZEB 1TZYD 3AZMC 3EPKA 1U35A 4Z5TD 5AVBB 1M1AC 2NZDC 5B1MB 3AL0C 5B32A 4KGCD 3UT9D 5B2JB 4QLCA 4UUZB 3TU4C 2ZY4A 1P3AA 5CPID 2PYOB 4HGAC 5AV9C 3AZJC 3B0CT 3WTPC 3MGQA 4YS3C 3REJD 3WAAC 3MNNC 1AOID 3V9RB 2G5HC 3KUYD 4ZUXA 3UT9A 4YM6B 3B6GD 2CV5C 3REKC 3W99A 5CPIA 3EPJA 4XZQC 2XD1A 5GT3B 2Y2MA 3REJA 3AZED 3NQJB 2HUEC 3AFAC 4NE6A 3W97A 3MGSB 3KUYA 3X1VB 5AVBD 2Y2OA 5DNMA 5B1MD 1P3LA 3KXBA 5B2JD 5AV6A 2Y2NA 5AV8A 1P3GA 2PYOD 1TAFB 3RELB 3KSYA 1KX4B 5B33C 2BYKA 3AYWB 5B1LC 4WU9B 1ZLAB 3REIC 2FJ7A 5CP6A 2YFVB 5GT0B 2Y2GA 4YM6D 3MGRC 4CSRB 2CWEA 1KX5A 4XUJC 4WNNA 1P3IC 4J8VB 3NQUB 5B2IA 3W98C 3A1IA 2AROC 5GT3D 1P3PA 3C1BB 4R8PA 3UTAC 1P3KC 1PZRA 3MGSD 3LJAA 3X1VD 2F8NA 4EO5C 3LELA 3B0DB 3X1UA 3W96B 1M18B 3B6FA 3VH6W 4ZBJB 3RELD 5G49A 5KDMB 3AV2C 1KX4D 3REHB 3AYWD 3AN2A 1JFIB 1F66A 4WU9D 5BNVB 1ZLAD 1KX3A 5GSUB 4G91B 5GT0D 3X1SA 4J8VD 5BT1C 1HQ3B 1P34B 3MVDC 3C1BD 3AZLB 5B2JC 5B31A 1ULYA 4WU9A 4DQYB 5GT0A 3O62A 3W96D 1M18D 4X23A 1U35B 4NE3A 2BG1A 5B0YB 5B32B 2F8NG 4QLCB 3REHD 3EPLA 2RIQA 5BS7A 1P3AB 5GSUD 4AWLC 5DNNC 1Z2CB 3AZFA 3MGQB 4KUDC 3AZGC 4H9SA 3X1VC 1HQ3D 4ZUXB 1R4VA 3UT9B 1P34D 3AZLD 5BO0B 5E5AA 3W99B 2G5IC 1S32C 5CPIB 2IO5C 5B0ZC 3AZMA 2HIOC 2Y2PA 1KX4C 2NZDA 1U35D 1HTAA 3W97B 5AV5C 5AY8C 5B31G 5B0YD 5DNMB 1P34A 1P3LB 3KXBB 4J8XC 5B32D 3TU4A 1BFMA 4QLCD 1T3UA 5CPKA 3KFUG 4Z66C 4WJ3C 5AV6B 5AV8B 3MGPC 5AV9A 1P3GB 1P3AD 3AZJA 1EQZC 1M19C 3X1TC 3WAAA 3MNNA 4J8WC 3MGQD 5CPJA 3C1BC 3LZ0C 2BYKB 4H9NA 5C3IC 5B0YA 2FJ7B 5CP6B 4ZUXD 2CV5A 3REKA 1KX5B 4WNNB 2FFFB 4NE5A 3W99D 4XZQA 4J8UA 5B2IB 1KU5A 5AVCC 1P3PB 3AFAA 4R8PB 4LD9B 1A7WA 2VQRA 3W97D 3LJAB 3WA9C 2F8NB 3AZHC 3H0LC 5DNMD 1P3LD 1WWIA 3KXBD 3LELB 5BO0A 3X1UB 3WKJB 5AV6D 5AV8D 3KWQC 3AZIC 1BH8A 3H0RC 1P3GD 2L5AA 2Y2QA 3B6FB 1WWSA 4M6BA 5B40C 5G49B 5B33A 2J8PA 4WU8C 3C1CC 3AZNC 1ID3C 3AN2B 1F66B 2NQBC 3MGRA 3VH5W 1KX3B 2ZY2A 4XUJA 5CP6D 2FJ7D 1P3IA 1KX5D 3W98A 2XD5A 3P5JB 2JSSA 3X1SB 2AROA 5B2ID 3AZKB 3UTAA 1P3KA 1P3PD 4R8PD 5B24B 4JJNA 4LD9D 5B31B 5B32G 3LJAD 1P3BA 2F8ND 3VH6A 3LELD 2JCHA 3O62B 3X1UD 3WKJD 1TZYC 4X23B 3B6FD 4Z5TC 1P3MB 3AV2A 3LZ1A 1N1JA 4ZUXC 3UT9C 4KGCC 4LD9A 3AN2D 1F66D 5CPIC 1KX3D 3WKJA 1B67A 3AZFB 2ZY5A 3REJC 5GXQB 4Z2MH 1AOIC 3X1SD 2DQNC 3AV1A 3W97C 3MVDA 3KUYC 3AZKD 3B6GC 3KXBC 5B24D 3R45A 5B31D 5E5AB 5AV8C 2RVQD 4E44A 3O62D 3AZMB 3AZEC 2LY8A 2Y2JA 3A6NA 5JA4A 4X23D 2NZDB 1P3MD 5AVBC 3AZKA 5B1MC 3WTPE 5BNXA 5B24A 3TU4B 5CPKB 4HGAB 5DNNA 2PYOC 5AV9B 2ZY3A 3AZJB 3WTPB 3AZGA 3WAAB 3AZFD 3MNNB 5CPJB 5GXQD 2DF4C 1P3MA 4H9NB 3LJAC 2UWXA 4YM6C 2CV5B 3REKB 4DRAA 5F99A 1S32A 1P3FA 3X1UC 5B0ZA 5E5AD 4XZQB 4J8UB 1P3OA 3UTBA 5JRGA 5GT3C 3AZMD 2HIOA 2HUEB 3VH6T 5GXQA 3AFAB 3MGSC 2NZDD 3AN2C 4J8XA 3F6TA 3TU4D 2Y2HA 3MGPA 5CPKD 1EQZA 1M19A 3H0MC 3X1TA 5AV9D 1BH8B 3AZJD 3RELC 3WTPD 3WAAD 3LZ0A 5B33B 3MNND 5B1LB 5CPJD 1H3OA 1M1AA 3REIB 3AYWC 4WU9C 1ZLAC 3MGRB 4E45A 5GT0C 4XUJB 2CV5D 2RVQC 3REKD 1P3IB 3B0CW 3W98B 4J8VC 4XZQD 5AVCA 4J8UD 2AROB 3WTPA 4YS3A 3UTAB 1P3KB 3AFAD 4JJNB 3WA9A 4H9PA 3AZHA 2Y2LA 4EO5B 3IP4C 1P3BB 2JE5A 3B0DC 3W96C 4H9QA 3KWQA 1M18C 3AZIA 4ZBJC 4H9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 A;  3AZN A;  3LZ1 B;  5B33 D;  1N1J B;  3AV2 B;  1ID3 A;  5B1L D;  2NQB A;  3REH C;  3REI D;  5GSU C;  3MGR D;  4G91 C;  4XUJ D;  1P3I D;  3W98 D;  3AV1 B;  2ARO D;  3MVD B;  1HQ3 C;  4KHA A;  3UTA D;  5B1L A;  1P34 C;  1P3K D;  3REI A;  3AZL C;  4JJN D;  3R45 B;  5CPK C;  2YFW A;  1P3B D;  1TZY A;  4CAY B;  4WV4 B;  4Z5T A;  5CPJ C;  3A6N B;  5JA4 B;  1U35 C;  4KGC A;  5B0Y C;  5BNX B;  3LZ1 D;  5B32 C;  3AV2 D;  4QLC C;  4AWL B;  5DNN B;  1P3A C;  4J8U C;  4KUD B;  3AZG B;  1AOI A;  3MGQ C;  2BYM A;  5BT1 D;  3B0B A;  3AV1 D;  4H9O A;  3B6G A;  1BH9 A;  3MVD D;  4G92 B;  5F99 B;  1S32 B;  1P3F B;  2IO5 B;  3W99 C;  5B0Z B;  2F8N K;  1P3O B;  3UTB B;  3AZE A;  5JRG B;  2HIO B;  5AVB A;  3A6N D;  5AV5 B;  5B1M A;  5AY8 B;  4J8X B;  5B2J A;  5DNM C;  1P3L C;  4UUZ A;  4Z66 B;  3MGP B;  2PYO A;  3VH5 T;  1EQZ B;  4Z2M G;  5AV6 C;  1P3G C;  5DNN D;  1M19 B;  3X1T B;  4J8W B;  4CAY A;  4KUD D;  3AZG D;  1B6W A;  3V9R A;  3LZ0 B;  4DRB A;  1H3O B;  5C3I B;  4JJN C;  1M1A B;  4YM6 A;  1P3B C;  2FJ7 C;  5CP6 C;  1KX5 C;  5F99 D;  1S32 D;  1P3F D;  5B0Z D;  5CHL B;  5AVC B;  5GT3 A;  5B2I C;  1P3O D;  3UTB D;  4KUD A;  4YS3 B;  5JRG D;  3NQJ A;  5FUG B;  2HIO D;  3LZ1 C;  1P3P C;  3MGS A;  4R8P C;  3X1V A;  4LD9 C;  3WA9 B;  4H9P B;  5AV5 D;  5AY8 D;  3AZH B;  4J8X D;  3LEL C;  4Z66 D;  4H9Q B;  3WKJ C;  3MGP D;  3KWQ B;  3AZI B;  1EQZ D;  1TAF A;  3REL A;  3B6F C;  1M19 D;  3X1T D;  4H9R B;  5B40 B;  3AV1 C;  4J8W D;  1KX4 A;  4WU8 B;  3C1C B;  3LZ0 D;  3AYW A;  3AZN B;  1ID3 B;  1ZLA A;  5AV5 A;  5AY8 A;  2NQB B;  1M1A D;  2YFV A;  1F66 C;  4CSR A;  1KX3 C;  2F8N H;  4Z66 A;  4WZS B;  1F1E A;  4J8V A;  3NQU A;  3X1S C;  3A6N C;  5AVC D;  4J8W A;  3C1B A;  4YS3 D;  3AZK C;  4KHA B;  5B24 C;  5B31 C;  3WA9 D;  3AZH D;  2YFW B;  3W96 A;  1M18 A;  1TZY B;  3O62 C;  3KWQ D;  3AZI D;  4Z5T B;  4X23 C;  1P3M C;  5B40 D;  5FUG A;  5KDM A;  4KGC B;  4WU8 D;  3C1C D;  3REH A;  3AZN D;  1ID3 D;  4G92 C;  1JFI A;  5BNV A;  2NQB D;  5F99 C;  1P3F C;  5GSU A;  5BS7 C;  1P3O C;  3UTB C;  5JRG C;  3REJ B;  3AZF C;  1AOI B;  4NFT A;  5GXQ C;  4H9S C;  2BYM B;  5B40 A;  3KUY B;  1HQ3 A;  4H9O B;  1Q9C A;  3B6G B;  1BH9 B;  3C1C A;  3AZL A;  3VH5 A;  5E5A C;  3AZE B;  1TZY D;  3AZM C;  1U35 A;  4Z5T D;  5AVB B;  1M1A C;  2NZD C;  5B1M B;  5B32 A;  4KGC D;  3UT9 D;  5B2J B;  4QLC A;  4UUZ B;  3TU4 C;  1P3A A;  5CPI D;  2PYO B;  4HGA C;  5AV9 C;  3AZJ C;  3B0C T;  3WTP C;  3MGQ A;  4YS3 C;  3REJ D;  3WAA C;  3MNN C;  1AOI D;  3V9R B;  3KUY D;  4ZUX A;  3UT9 A;  4YM6 B;  3B6G D;  2CV5 C;  3REK C;  3W99 A;  5CPI A;  4XZQ C;  5GT3 B;  3REJ A;  3AZE D;  3NQJ B;  2HUE C;  3AFA C;  4NE6 A;  3W97 A;  3MGS B;  3KUY A;  3X1V B;  5AVB D;  5DNM A;  5B1M D;  1P3L A;  3KXB A;  5B2J D;  5AV6 A;  5AV8 A;  1P3G A;  2PYO D;  1TAF B;  3REL B;  3KSY A;  1KX4 B;  5B33 C;  2BYK A;  3AYW B;  5B1L C;  4WU9 B;  1ZLA B;  3REI C;  2FJ7 A;  5CP6 A;  2YFV B;  5GT0 B;  4YM6 D;  3MGR C;  4CSR B;  2CWE A;  1KX5 A;  4XUJ C;  4WNN A;  1P3I C;  4J8V B;  3NQU B;  5B2I A;  3W98 C;  2ARO C;  5GT3 D;  1P3P A;  3C1B B;  4R8P A;  3UTA C;  1P3K C;  3MGS D;  3LJA A;  3X1V D;  2F8N A;  4EO5 C;  3LEL A;  3B0D B;  3X1U A;  3W96 B;  1M18 B;  3B6F A;  3VH6 W;  4ZBJ B;  3REL D;  5G49 A;  5KDM B;  3AV2 C;  1KX4 D;  3REH B;  3AYW D;  3AN2 A;  1JFI B;  1F66 A;  4WU9 D;  5BNV B;  1ZLA D;  1KX3 A;  5GSU B;  4G91 B;  5GT0 D;  3X1S A;  4J8V D;  5BT1 C;  1HQ3 B;  1P34 B;  3MVD C;  3C1B D;  3AZL B;  5B2J C;  5B31 A;  1ULY A;  4WU9 A;  5GT0 A;  3O62 A;  3W96 D;  1M18 D;  4X23 A;  1U35 B;  4NE3 A;  5B0Y B;  5B32 B;  2F8N G;  4QLC B;  3REH D;  5BS7 A;  1P3A B;  5GSU D;  4AWL C;  5DNN C;  3AZF A;  3MGQ B;  4KUD C;  3AZG C;  4H9S A;  3X1V C;  1HQ3 D;  4ZUX B;  1R4V A;  3UT9 B;  1P34 D;  3AZL D;  5BO0 B;  5E5A A;  3W99 B;  1S32 C;  5CPI B;  2IO5 C;  5B0Z C;  3AZM A;  2HIO C;  1KX4 C;  2NZD A;  1U35 D;  1HTA A;  3W97 B;  5AV5 C;  5AY8 C;  5B31 G;  5B0Y D;  5DNM B;  1P34 A;  1P3L B;  3KXB B;  4J8X C;  5B32 D;  3TU4 A;  1BFM A;  4QLC D;  5CPK A;  4Z66 C;  5AV6 B;  5AV8 B;  3MGP C;  5AV9 A;  1P3G B;  1P3A D;  3AZJ A;  1EQZ C;  1M19 C;  3X1T C;  3WAA A;  3MNN A;  4J8W C;  3MGQ D;  5CPJ A;  3C1B C;  3LZ0 C;  2BYK B;  4H9N A;  5C3I C;  5B0Y A;  2FJ7 B;  5CP6 B;  4ZUX D;  2CV5 A;  3REK A;  1KX5 B;  4WNN B;  3W99 D;  4NE5 A;  4XZQ A;  4J8U A;  5B2I B;  1KU5 A;  5AVC C;  1P3P B;  3AFA A;  4R8P B;  4LD9 B;  1A7W A;  3W97 D;  3LJA B;  3WA9 C;  2F8N B;  3AZH C;  5DNM D;  1P3L D;  1WWI A;  3KXB D;  3LEL B;  5BO0 A;  3X1U B;  3WKJ B;  5AV6 D;  5AV8 D;  3KWQ C;  3AZI C;  1BH8 A;  1P3G D;  3B6F B;  2L5A A;  1WWS A;  4M6B A;  5B40 C;  5G49 B;  5B33 A;  4WU8 C;  3C1C C;  3AZN C;  1ID3 C;  3AN2 B;  1F66 B;  2NQB C;  3MGR A;  3VH5 W;  1KX3 B;  2FJ7 D;  4XUJ A;  5CP6 D;  1P3I A;  1KX5 D;  3W98 A;  2JSS A;  3X1S B;  2ARO A;  5B2I D;  3AZK B;  3UTA A;  1P3K A;  1P3P D;  4R8P D;  5B24 B;  4JJN A;  4LD9 D;  5B31 B;  5B32 G;  3LJA D;  1P3B A;  2F8N D;  3VH6 A;  3LEL D;  3O62 B;  3X1U D;  3WKJ D;  1TZY C;  4X23 B;  3B6F D;  4Z5T C;  1P3M B;  3AV2 A;  3LZ1 A;  1N1J A;  4ZUX C;  3UT9 C;  4KGC C;  4LD9 A;  3AN2 D;  1F66 D;  5CPI C;  1KX3 D;  3WKJ A;  1B67 A;  3AZF B;  3REJ C;  5GXQ B;  4Z2M H;  1AOI C;  3X1S D;  3AV1 A;  3W97 C;  3MVD A;  3KUY C;  3AZK D;  3B6G C;  3KXB C;  5B24 D;  3R45 A;  5B31 D;  5E5A B;  5AV8 C;  2RVQ D;  4E44 A;  3O62 D;  3AZM B;  3AZE C;  2LY8 A;  3A6N A;  5JA4 A;  4X23 D;  2NZD B;  1P3M D;  5AVB C;  3AZK A;  5B1M C;  3WTP E;  5BNX A;  5B24 A;  3TU4 B;  5CPK B;  4HGA B;  5DNN A;  2PYO C;  5AV9 B;  3AZJ B;  3WTP B;  3AZG A;  3WAA B;  3AZF D;  3MNN B;  5CPJ B;  5GXQ D;  1P3M A;  4H9N B;  3LJA C;  4YM6 C;  2CV5 B;  3REK B;  4DRA A;  5F99 A;  1S32 A;  1P3F A;  3X1U C;  5B0Z A;  5E5A D;  4XZQ B;  4J8U B;  1P3O A;  3UTB A;  5JRG A;  5GT3 C;  3AZM D;  2HIO A;  5GXQ A;  2HUE B;  3VH6 T;  3AFA B;  3MGS C;  2NZD D;  3AN2 C;  4J8X A;  3TU4 D;  3MGP A;  5CPK D;  1EQZ A;  1M19 A;  3X1T A;  5AV9 D;  1BH8 B;  3AZJ D;  3REL C;  3WTP D;  3WAA D;  3LZ0 A;  5B33 B;  3MNN D;  5B1L B;  5CPJ D;  1H3O A;  1M1A A;  3REI B;  3AYW C;  4WU9 C;  1ZLA C;  3MGR B;  4E45 A;  5GT0 C;  4XUJ B;  2CV5 D;  2RVQ C;  3REK D;  1P3I B;  3B0C W;  3W98 B;  4J8V C;  4XZQ D;  5AVC A;  4J8U D;  2ARO B;  3WTP A;  4YS3 A;  3UTA B;  1P3K B;  3AFA D;  4JJN B;  3WA9 A;  4H9P A;  3AZH A;  4EO5 B;  1P3B B;  3B0D C;  3W96 C;  4H9Q A;  3KWQ A;  1M18 C;  3AZI A;  4ZBJ C;  4H9R A; 
#chains in the Genus database with same CATH topology
 4WU8 A;  3AZN A;  3LZ1 B;  5B33 D;  1N1J B;  3AV2 B;  1ID3 A;  5B1L D;  2NQB A;  3REH C;  3REI D;  5GSU C;  2Y2I A;  3MGR D;  4G91 C;  4XUJ D;  1P3I D;  3W98 D;  3AV1 B;  2ARO D;  3MVD B;  1HQ3 C;  4KHA A;  3UTA D;  5B1L A;  1P34 C;  1P3K D;  3REI A;  3AZL C;  4JJN D;  3R45 B;  5CPK C;  2YFW A;  1P3B D;  1TZY A;  4CAY B;  4WV4 B;  4Z5T A;  5CPJ C;  3A6N B;  5JA4 B;  1U35 C;  4KGC A;  5B0Y C;  5BNX B;  3LZ1 D;  5B32 C;  3AV2 D;  4QLC C;  4AWL B;  5DNN B;  1P3A C;  4J8U C;  4KUD B;  3AZG B;  1AOI A;  3MGQ C;  2BYM A;  3EPH A;  5BT1 D;  3B0B A;  3AV1 D;  4H9O A;  3B6G A;  1BH9 A;  3MVD D;  4G92 B;  5F99 B;  1S32 B;  1P3F B;  2IO5 B;  3W99 C;  5B0Z B;  2F8N K;  1P3O B;  3UTB B;  3AZE A;  5JRG B;  4UPK A;  2HIO B;  5AVB A;  3A6N D;  5AV5 B;  5B1M A;  5AY8 B;  4J8X B;  5B2J A;  5DNM C;  1P3L C;  4UUZ A;  4Z66 B;  3MGP B;  2PYO A;  3VH5 T;  1EQZ B;  4Z2M G;  5AV6 C;  3EG5 B;  5DNN D;  1P3G C;  1M19 B;  3X1T B;  4J8W B;  4CAY A;  2F2A C;  4KUD D;  3AZG D;  1B6W A;  3V9R A;  3LZ0 B;  4DRB A;  1H3O B;  5C3I B;  4JJN C;  1M1A B;  4YM6 A;  1P3B C;  2FJ7 C;  5CP6 C;  1KX5 C;  5F99 D;  1S32 D;  1P3F D;  5B0Z D;  5CHL B;  5AVC B;  5GT3 A;  5B2I C;  1P3O D;  3UTB D;  4KUD A;  4YS3 B;  5JRG D;  3NQJ A;  5FUG B;  2HIO D;  3LZ1 C;  1P3P C;  3MGS A;  4R8P C;  3X1V A;  4LD9 C;  3WA9 B;  4H9P B;  5AV5 D;  5AY8 D;  3AZH B;  2Y2K A;  4J8X D;  1W2E A;  3LEL C;  4Z66 D;  4H9Q B;  3WKJ C;  3MGP D;  3KWQ B;  3AZI B;  1EQZ D;  1TAF A;  3REL A;  3B6F C;  1M19 D;  3X1T D;  4H9R B;  5B40 B;  3AV1 C;  4J8W D;  1KX4 A;  4WU8 B;  3C1C B;  3LZ0 D;  3AYW A;  3AZN B;  1ID3 B;  1ZLA A;  5AV5 A;  5AY8 A;  2NQB B;  1M1A D;  2YFV A;  3FDD A;  1F66 C;  3A1K A;  4CSR A;  1KX3 C;  2F8N H;  4Z66 A;  4WZS B;  1F1E A;  4J8V A;  3NQU A;  3X1S C;  2W8S A;  5AVC D;  3A6N C;  4J8W A;  3C1B A;  4YS3 D;  3AZK C;  4KHA B;  5B24 C;  5B31 C;  3WA9 D;  3AZH D;  2YFW B;  3W96 A;  1M18 A;  1TZY B;  3O62 C;  3KWQ D;  3AZI D;  4Z5T B;  4X23 C;  1P3M C;  5B40 D;  5FUG A;  5KDM A;  4KGC B;  4WU8 D;  3C1C D;  3REH A;  3AZN D;  1ID3 D;  4G92 C;  1JFI A;  5BNV A;  2ZM5 A;  2NQB D;  5F99 C;  1P3F C;  5GSU A;  5BS7 C;  1P3O C;  3UTB C;  5JRG C;  3REJ B;  3AZF C;  1AOI B;  4NFT A;  5GXQ C;  2BYM B;  4H9S C;  5B40 A;  3KUY B;  1HQ3 A;  4H9O B;  1Q9C A;  3B6G B;  1BH9 B;  3C1C A;  3AZL A;  3VH5 A;  5E5A C;  3AZE B;  1TZY D;  3AZM C;  3EPK A;  1U35 A;  4Z5T D;  5AVB B;  1M1A C;  2NZD C;  5B1M B;  3AL0 C;  5B32 A;  4KGC D;  3UT9 D;  5B2J B;  4QLC A;  4UUZ B;  3TU4 C;  2ZY4 A;  1P3A A;  5CPI D;  2PYO B;  4HGA C;  5AV9 C;  3AZJ C;  3B0C T;  3WTP C;  3MGQ A;  4YS3 C;  3REJ D;  3WAA C;  3MNN C;  1AOI D;  3V9R B;  2G5H C;  3KUY D;  4ZUX A;  3UT9 A;  4YM6 B;  3B6G D;  2CV5 C;  3REK C;  3W99 A;  5CPI A;  3EPJ A;  4XZQ C;  2XD1 A;  5GT3 B;  2Y2M A;  3REJ A;  3AZE D;  3NQJ B;  2HUE C;  3AFA C;  4NE6 A;  3W97 A;  3MGS B;  3KUY A;  3X1V B;  5AVB D;  2Y2O A;  5DNM A;  5B1M D;  1P3L A;  3KXB A;  5B2J D;  5AV6 A;  2Y2N A;  5AV8 A;  1P3G A;  2PYO D;  1TAF B;  3REL B;  3KSY A;  1KX4 B;  5B33 C;  2BYK A;  3AYW B;  5B1L C;  4WU9 B;  1ZLA B;  3REI C;  2FJ7 A;  5CP6 A;  2YFV B;  5GT0 B;  2Y2G A;  4YM6 D;  3MGR C;  4CSR B;  2CWE A;  1KX5 A;  4XUJ C;  4WNN A;  1P3I C;  4J8V B;  3NQU B;  5B2I A;  3W98 C;  3A1I A;  2ARO C;  5GT3 D;  1P3P A;  3C1B B;  4R8P A;  3UTA C;  1P3K C;  1PZR A;  3MGS D;  3LJA A;  3X1V D;  2F8N A;  4EO5 C;  3LEL A;  3B0D B;  3X1U A;  3W96 B;  1M18 B;  3B6F A;  3VH6 W;  4ZBJ B;  3REL D;  5G49 A;  5KDM B;  3AV2 C;  1KX4 D;  3REH B;  3AYW D;  3AN2 A;  1JFI B;  1F66 A;  4WU9 D;  5BNV B;  1ZLA D;  1KX3 A;  5GSU B;  4G91 B;  5GT0 D;  3X1S A;  4J8V D;  5BT1 C;  1HQ3 B;  1P34 B;  3MVD C;  3C1B D;  3AZL B;  5B2J C;  5B31 A;  1ULY A;  4WU9 A;  4DQY B;  5GT0 A;  3O62 A;  3W96 D;  1M18 D;  4X23 A;  1U35 B;  4NE3 A;  2BG1 A;  5B0Y B;  5B32 B;  2F8N G;  4QLC B;  3REH D;  3EPL A;  2RIQ A;  5BS7 A;  1P3A B;  5GSU D;  4AWL C;  5DNN C;  1Z2C B;  3AZF A;  3MGQ B;  4KUD C;  3AZG C;  4H9S A;  3X1V C;  1HQ3 D;  4ZUX B;  1R4V A;  3UT9 B;  1P34 D;  3AZL D;  5BO0 B;  5E5A A;  3W99 B;  2G5I C;  1S32 C;  5CPI B;  2IO5 C;  5B0Z C;  3AZM A;  2HIO C;  2Y2P A;  1KX4 C;  2NZD A;  1U35 D;  1HTA A;  3W97 B;  5AV5 C;  5AY8 C;  5B31 G;  5B0Y D;  5DNM B;  1P34 A;  1P3L B;  3KXB B;  4J8X C;  5B32 D;  3TU4 A;  1BFM A;  4QLC D;  1T3U A;  5CPK A;  3KFU G;  4Z66 C;  4WJ3 C;  5AV6 B;  5AV8 B;  3MGP C;  5AV9 A;  1P3G B;  1P3A D;  3AZJ A;  1EQZ C;  1M19 C;  3X1T C;  3WAA A;  3MNN A;  4J8W C;  3MGQ D;  5CPJ A;  3C1B C;  3LZ0 C;  2BYK B;  4H9N A;  5C3I C;  5B0Y A;  2FJ7 B;  5CP6 B;  4ZUX D;  2CV5 A;  3REK A;  1KX5 B;  4WNN B;  2FFF B;  4NE5 A;  3W99 D;  4XZQ A;  4J8U A;  5B2I B;  1KU5 A;  5AVC C;  1P3P B;  3AFA A;  4R8P B;  4LD9 B;  1A7W A;  2VQR A;  3W97 D;  3LJA B;  3WA9 C;  2F8N B;  3AZH C;  3H0L C;  5DNM D;  1P3L D;  1WWI A;  3KXB D;  3LEL B;  5BO0 A;  3X1U B;  3WKJ B;  5AV6 D;  5AV8 D;  3KWQ C;  3AZI C;  1BH8 A;  3H0R C;  1P3G D;  2L5A A;  2Y2Q A;  3B6F B;  1WWS A;  4M6B A;  5B40 C;  5G49 B;  5B33 A;  2J8P A;  4WU8 C;  3C1C C;  3AZN C;  1ID3 C;  3AN2 B;  1F66 B;  2NQB C;  3MGR A;  3VH5 W;  1KX3 B;  2ZY2 A;  4XUJ A;  5CP6 D;  2FJ7 D;  1P3I A;  1KX5 D;  3W98 A;  2XD5 A;  3P5J B;  2JSS A;  3X1S B;  2ARO A;  5B2I D;  3AZK B;  3UTA A;  1P3K A;  1P3P D;  4R8P D;  5B24 B;  4JJN A;  4LD9 D;  5B31 B;  5B32 G;  3LJA D;  1P3B A;  2F8N D;  3VH6 A;  3LEL D;  2JCH A;  3O62 B;  3X1U D;  3WKJ D;  1TZY C;  4X23 B;  3B6F D;  4Z5T C;  1P3M B;  3AV2 A;  3LZ1 A;  1N1J A;  4ZUX C;  3UT9 C;  4KGC C;  4LD9 A;  3AN2 D;  1F66 D;  5CPI C;  1KX3 D;  3WKJ A;  1B67 A;  3AZF B;  2ZY5 A;  3REJ C;  5GXQ B;  4Z2M H;  1AOI C;  3X1S D;  2DQN C;  3AV1 A;  3W97 C;  3MVD A;  3KUY C;  3AZK D;  3B6G C;  3KXB C;  5B24 D;  3R45 A;  5B31 D;  5E5A B;  5AV8 C;  2RVQ D;  4E44 A;  3O62 D;  3AZM B;  3AZE C;  2LY8 A;  2Y2J A;  3A6N A;  5JA4 A;  4X23 D;  2NZD B;  1P3M D;  5AVB C;  3AZK A;  5B1M C;  3WTP E;  5BNX A;  5B24 A;  3TU4 B;  5CPK B;  4HGA B;  5DNN A;  2PYO C;  5AV9 B;  2ZY3 A;  3AZJ B;  3WTP B;  3AZG A;  3WAA B;  3AZF D;  3MNN B;  5CPJ B;  5GXQ D;  2DF4 C;  1P3M A;  4H9N B;  3LJA C;  2UWX A;  4YM6 C;  2CV5 B;  3REK B;  4DRA A;  5F99 A;  1S32 A;  1P3F A;  3X1U C;  5B0Z A;  5E5A D;  4XZQ B;  4J8U B;  1P3O A;  3UTB A;  5JRG A;  5GT3 C;  3AZM D;  2HIO A;  2HUE B;  3VH6 T;  5GXQ A;  3AFA B;  3MGS C;  2NZD D;  3AN2 C;  4J8X A;  3F6T A;  3TU4 D;  2Y2H A;  3MGP A;  5CPK D;  1EQZ A;  1M19 A;  3H0M C;  3X1T A;  5AV9 D;  1BH8 B;  3AZJ D;  3REL C;  3WTP D;  3WAA D;  3LZ0 A;  5B33 B;  3MNN D;  5B1L B;  5CPJ D;  1H3O A;  1M1A A;  3REI B;  3AYW C;  4WU9 C;  1ZLA C;  3MGR B;  4E45 A;  5GT0 C;  4XUJ B;  2CV5 D;  2RVQ C;  3REK D;  1P3I B;  3B0C W;  3W98 B;  4J8V C;  4XZQ D;  5AVC A;  4J8U D;  2ARO B;  3WTP A;  4YS3 A;  3UTA B;  1P3K B;  3AFA D;  4JJN B;  3WA9 A;  4H9P A;  3AZH A;  2Y2L A;  4EO5 B;  3IP4 C;  1P3B B;  2JE5 A;  3B0D C;  3W96 C;  4H9Q A;  3KWQ A;  1M18 C;  3AZI A;  4ZBJ C;  4H9R A; 
#chains in the Genus database with same CATH homology
 4WU8 A;  3AZN A;  3LZ1 B;  5B33 D;  1N1J B;  3AV2 B;  1ID3 A;  5B1L D;  2NQB A;  3REH C;  3REI D;  5GSU C;  2Y2I A;  3MGR D;  4G91 C;  4XUJ D;  1P3I D;  3W98 D;  3AV1 B;  2ARO D;  3MVD B;  1HQ3 C;  4KHA A;  3UTA D;  5B1L A;  1P34 C;  1P3K D;  3REI A;  3AZL C;  4JJN D;  3R45 B;  5CPK C;  2YFW A;  1P3B D;  1TZY A;  4CAY B;  4WV4 B;  4Z5T A;  5CPJ C;  3A6N B;  5JA4 B;  1U35 C;  4KGC A;  5B0Y C;  5BNX B;  3LZ1 D;  5B32 C;  3AV2 D;  4QLC C;  4AWL B;  5DNN B;  1P3A C;  4J8U C;  4KUD B;  3AZG B;  1AOI A;  3MGQ C;  2BYM A;  3EPH A;  5BT1 D;  3B0B A;  3AV1 D;  4H9O A;  3B6G A;  1BH9 A;  3MVD D;  4G92 B;  5F99 B;  1S32 B;  1P3F B;  2IO5 B;  3W99 C;  5B0Z B;  2F8N K;  1P3O B;  3UTB B;  3AZE A;  5JRG B;  4UPK A;  2HIO B;  5AVB A;  3A6N D;  5AV5 B;  5B1M A;  5AY8 B;  4J8X B;  5B2J A;  5DNM C;  1P3L C;  4UUZ A;  4Z66 B;  3MGP B;  2PYO A;  3VH5 T;  1EQZ B;  4Z2M G;  5AV6 C;  3EG5 B;  5DNN D;  1P3G C;  1M19 B;  3X1T B;  4J8W B;  4CAY A;  2F2A C;  4KUD D;  3AZG D;  1B6W A;  3V9R A;  3LZ0 B;  4DRB A;  1H3O B;  5C3I B;  4JJN C;  1M1A B;  4YM6 A;  1P3B C;  2FJ7 C;  5CP6 C;  1KX5 C;  5F99 D;  1S32 D;  1P3F D;  5B0Z D;  5CHL B;  5AVC B;  5GT3 A;  5B2I C;  1P3O D;  3UTB D;  4KUD A;  4YS3 B;  5JRG D;  3NQJ A;  5FUG B;  2HIO D;  3LZ1 C;  1P3P C;  3MGS A;  4R8P C;  3X1V A;  4LD9 C;  3WA9 B;  4H9P B;  5AV5 D;  5AY8 D;  3AZH B;  2Y2K A;  4J8X D;  1W2E A;  3LEL C;  4Z66 D;  4H9Q B;  3WKJ C;  3MGP D;  3KWQ B;  3AZI B;  1EQZ D;  1TAF A;  3REL A;  3B6F C;  1M19 D;  3X1T D;  4H9R B;  5B40 B;  3AV1 C;  4J8W D;  1KX4 A;  4WU8 B;  3C1C B;  3LZ0 D;  3AYW A;  3AZN B;  1ID3 B;  1ZLA A;  5AV5 A;  5AY8 A;  2NQB B;  1M1A D;  2YFV A;  3FDD A;  1F66 C;  3A1K A;  4CSR A;  1KX3 C;  2F8N H;  4Z66 A;  4WZS B;  1F1E A;  4J8V A;  3NQU A;  3X1S C;  2W8S A;  5AVC D;  3A6N C;  4J8W A;  3C1B A;  4YS3 D;  3AZK C;  4KHA B;  5B24 C;  5B31 C;  3WA9 D;  3AZH D;  2YFW B;  3W96 A;  1M18 A;  1TZY B;  3O62 C;  3KWQ D;  3AZI D;  4Z5T B;  4X23 C;  1P3M C;  5B40 D;  5FUG A;  5KDM A;  4KGC B;  4WU8 D;  3C1C D;  3REH A;  3AZN D;  1ID3 D;  4G92 C;  1JFI A;  5BNV A;  2ZM5 A;  2NQB D;  5F99 C;  1P3F C;  5GSU A;  5BS7 C;  1P3O C;  3UTB C;  5JRG C;  3REJ B;  3AZF C;  1AOI B;  4NFT A;  5GXQ C;  2BYM B;  4H9S C;  5B40 A;  3KUY B;  1HQ3 A;  4H9O B;  1Q9C A;  3B6G B;  1BH9 B;  3C1C A;  3AZL A;  3VH5 A;  5E5A C;  3AZE B;  1TZY D;  3AZM C;  3EPK A;  1U35 A;  4Z5T D;  5AVB B;  1M1A C;  2NZD C;  5B1M B;  3AL0 C;  5B32 A;  4KGC D;  3UT9 D;  5B2J B;  4QLC A;  4UUZ B;  3TU4 C;  2ZY4 A;  1P3A A;  5CPI D;  2PYO B;  4HGA C;  5AV9 C;  3AZJ C;  3B0C T;  3WTP C;  3MGQ A;  4YS3 C;  3REJ D;  3WAA C;  3MNN C;  1AOI D;  3V9R B;  2G5H C;  3KUY D;  4ZUX A;  3UT9 A;  4YM6 B;  3B6G D;  2CV5 C;  3REK C;  3W99 A;  5CPI A;  3EPJ A;  4XZQ C;  2XD1 A;  5GT3 B;  2Y2M A;  3REJ A;  3AZE D;  3NQJ B;  2HUE C;  3AFA C;  4NE6 A;  3W97 A;  3MGS B;  3KUY A;  3X1V B;  5AVB D;  2Y2O A;  5DNM A;  5B1M D;  1P3L A;  3KXB A;  5B2J D;  5AV6 A;  2Y2N A;  5AV8 A;  1P3G A;  2PYO D;  1TAF B;  3REL B;  3KSY A;  1KX4 B;  5B33 C;  2BYK A;  3AYW B;  5B1L C;  4WU9 B;  1ZLA B;  3REI C;  2FJ7 A;  5CP6 A;  2YFV B;  5GT0 B;  2Y2G A;  4YM6 D;  3MGR C;  4CSR B;  2CWE A;  1KX5 A;  4XUJ C;  4WNN A;  1P3I C;  4J8V B;  3NQU B;  5B2I A;  3W98 C;  3A1I A;  2ARO C;  5GT3 D;  1P3P A;  3C1B B;  4R8P A;  3UTA C;  1P3K C;  1PZR A;  3MGS D;  3LJA A;  3X1V D;  2F8N A;  4EO5 C;  3LEL A;  3B0D B;  3X1U A;  3W96 B;  1M18 B;  3B6F A;  3VH6 W;  4ZBJ B;  3REL D;  5G49 A;  5KDM B;  3AV2 C;  1KX4 D;  3REH B;  3AYW D;  3AN2 A;  1JFI B;  1F66 A;  4WU9 D;  5BNV B;  1ZLA D;  1KX3 A;  5GSU B;  4G91 B;  5GT0 D;  3X1S A;  4J8V D;  5BT1 C;  1HQ3 B;  1P34 B;  3MVD C;  3C1B D;  3AZL B;  5B2J C;  5B31 A;  1ULY A;  4WU9 A;  4DQY B;  5GT0 A;  3O62 A;  3W96 D;  1M18 D;  4X23 A;  1U35 B;  4NE3 A;  2BG1 A;  5B0Y B;  5B32 B;  2F8N G;  4QLC B;  3REH D;  3EPL A;  2RIQ A;  5BS7 A;  1P3A B;  5GSU D;  4AWL C;  5DNN C;  1Z2C B;  3AZF A;  3MGQ B;  4KUD C;  3AZG C;  4H9S A;  3X1V C;  1HQ3 D;  4ZUX B;  1R4V A;  3UT9 B;  1P34 D;  3AZL D;  5BO0 B;  5E5A A;  3W99 B;  2G5I C;  1S32 C;  5CPI B;  2IO5 C;  5B0Z C;  3AZM A;  2HIO C;  2Y2P A;  1KX4 C;  2NZD A;  1U35 D;  1HTA A;  3W97 B;  5AV5 C;  5AY8 C;  5B31 G;  5B0Y D;  5DNM B;  1P34 A;  1P3L B;  3KXB B;  4J8X C;  5B32 D;  3TU4 A;  1BFM A;  4QLC D;  1T3U A;  5CPK A;  3KFU G;  4Z66 C;  4WJ3 C;  5AV6 B;  5AV8 B;  3MGP C;  5AV9 A;  1P3G B;  1P3A D;  3AZJ A;  1EQZ C;  1M19 C;  3X1T C;  3WAA A;  3MNN A;  4J8W C;  3MGQ D;  5CPJ A;  3C1B C;  3LZ0 C;  2BYK B;  4H9N A;  5C3I C;  5B0Y A;  2FJ7 B;  5CP6 B;  4ZUX D;  2CV5 A;  3REK A;  1KX5 B;  4WNN B;  2FFF B;  4NE5 A;  3W99 D;  4XZQ A;  4J8U A;  5B2I B;  1KU5 A;  5AVC C;  1P3P B;  3AFA A;  4R8P B;  4LD9 B;  1A7W A;  2VQR A;  3W97 D;  3LJA B;  3WA9 C;  2F8N B;  3AZH C;  3H0L C;  5DNM D;  1P3L D;  1WWI A;  3KXB D;  3LEL B;  5BO0 A;  3X1U B;  3WKJ B;  5AV6 D;  5AV8 D;  3KWQ C;  3AZI C;  1BH8 A;  3H0R C;  1P3G D;  2L5A A;  2Y2Q A;  3B6F B;  1WWS A;  4M6B A;  5B40 C;  5G49 B;  5B33 A;  2J8P A;  4WU8 C;  3C1C C;  3AZN C;  1ID3 C;  3AN2 B;  1F66 B;  2NQB C;  3MGR A;  3VH5 W;  1KX3 B;  2ZY2 A;  4XUJ A;  5CP6 D;  2FJ7 D;  1P3I A;  1KX5 D;  3W98 A;  2XD5 A;  3P5J B;  2JSS A;  3X1S B;  2ARO A;  5B2I D;  3AZK B;  3UTA A;  1P3K A;  1P3P D;  4R8P D;  5B24 B;  4JJN A;  4LD9 D;  5B31 B;  5B32 G;  3LJA D;  1P3B A;  2F8N D;  3VH6 A;  3LEL D;  2JCH A;  3O62 B;  3X1U D;  3WKJ D;  1TZY C;  4X23 B;  3B6F D;  4Z5T C;  1P3M B;  3AV2 A;  3LZ1 A;  1N1J A;  4ZUX C;  3UT9 C;  4KGC C;  4LD9 A;  3AN2 D;  1F66 D;  5CPI C;  1KX3 D;  3WKJ A;  1B67 A;  3AZF B;  2ZY5 A;  3REJ C;  5GXQ B;  4Z2M H;  1AOI C;  3X1S D;  2DQN C;  3AV1 A;  3W97 C;  3MVD A;  3KUY C;  3AZK D;  3B6G C;  3KXB C;  5B24 D;  3R45 A;  5B31 D;  5E5A B;  5AV8 C;  2RVQ D;  4E44 A;  3O62 D;  3AZM B;  3AZE C;  2LY8 A;  2Y2J A;  3A6N A;  5JA4 A;  4X23 D;  2NZD B;  1P3M D;  5AVB C;  3AZK A;  5B1M C;  3WTP E;  5BNX A;  5B24 A;  3TU4 B;  5CPK B;  4HGA B;  5DNN A;  2PYO C;  5AV9 B;  2ZY3 A;  3AZJ B;  3WTP B;  3AZG A;  3WAA B;  3AZF D;  3MNN B;  5CPJ B;  5GXQ D;  2DF4 C;  1P3M A;  4H9N B;  3LJA C;  2UWX A;  4YM6 C;  2CV5 B;  3REK B;  4DRA A;  5F99 A;  1S32 A;  1P3F A;  3X1U C;  5B0Z A;  5E5A D;  4XZQ B;  4J8U B;  1P3O A;  3UTB A;  5JRG A;  5GT3 C;  3AZM D;  2HIO A;  2HUE B;  3VH6 T;  5GXQ A;  3AFA B;  3MGS C;  2NZD D;  3AN2 C;  4J8X A;  3F6T A;  3TU4 D;  2Y2H A;  3MGP A;  5CPK D;  1EQZ A;  1M19 A;  3H0M C;  3X1T A;  5AV9 D;  1BH8 B;  3AZJ D;  3REL C;  3WTP D;  3WAA D;  3LZ0 A;  5B33 B;  3MNN D;  5B1L B;  5CPJ D;  1H3O A;  1M1A A;  3REI B;  3AYW C;  4WU9 C;  1ZLA C;  3MGR B;  4E45 A;  5GT0 C;  4XUJ B;  2CV5 D;  2RVQ C;  3REK D;  1P3I B;  3B0C W;  3W98 B;  4J8V C;  4XZQ D;  5AVC A;  4J8U D;  2ARO B;  3WTP A;  4YS3 A;  3UTA B;  1P3K B;  3AFA D;  4JJN B;  3WA9 A;  4H9P A;  3AZH A;  2Y2L A;  4EO5 B;  3IP4 C;  1P3B B;  2JE5 A;  3B0D C;  3W96 C;  4H9Q A;  3KWQ A;  1M18 C;  3AZI A;  4ZBJ C;  4H9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...