1M1AB

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aB00
3AYWA 5AV9D 2HIOD 1HQ3D 4J8UB 3X1TB 2FJ7B 2PYOD 4XUJD 3X1TC 5GSUD 4KUDD 5B24B 3AYWC 4R8PA 3WA9B 2YFWA 5B1MB 3C1CB 3O62B 3AFAB 1ID3A 3WA9C 5GXQB 4WU8A 3UT9B 1P3PB 3C1CC 1S32A 1TZYA 3O62C 3AFAC 1KX3B 3X1TD 5GXQC 1KX3C 3UT9C 1P3PC 1R4VA 5AV5A 3AV1A 4H9NA 3W96A 3B0BA 2CV5B 3AYWD 1TAFA 3KWQA 4NE3A 3C1BA 2CV5C 1F66A 1P3FB 1ID3C 3LJAB 5B32G 5CPIB 3WA9D 3WTPB 1P3FC 3C1CD 3REHA 3O62D 4HGAB 3AFAD 5CPIC 4CSRB 2NQBA 5F99B 5AV8A 5GXQD 4DRBA 3W96C 5BO0B 4CAYB 4Z66A 3KUYA 3AV1C 1P3PD 1KX3D 4KGCB 1F66B 3KWQC 2IO5C 4KGCC 1F66C 1JFIA 2CV5D 2NQBB 5JRGB 1ID3D 5AY8A 4JJNA 1P3LA 3KSYA 5B40A 3X1UB 3REHC 2NQBC 5JRGC 1P3FD 5AV8C 2NZDA 5CPID 4Z2MG 3X1UC 2YFVB 3AV1D 3W96D 1P34A 1P3KA 3KWQD 4KGCD 1F66D 3NQUA 3W99A 5B40C 5B2IB 4H9OA 4ZBJB 5AVBA 3REHD 4UUZB 2NQBD 5JRGD 5AV8D 4ZBJC 3NQJB 3X1UD 3REKA 4YM6A 1P3KC 4X23A 3WAAB 1BH9A 5CPKA 1U35A 2L5AA 5B1LA 3WAAC 1P3IA 4XZQA 4J8VB 1ZLAB 4JJND 3R45B 4Z2MH 5BNXB 3AZHA 4EO5B 5B40D 3X1SB 4J8VC 1H3OA 3AZEA 4EO5C 2BYMB 4WNNA 5B0ZB 3AZJB 4YM6C 3X1SC 5AV9A 4M6BA 4XZQB 5DNMB 1P3KD 3AZNB 3AZJC 1BH8A 1KX5B 5CP6B 2HUEB 5B32A 3AZGB 4XZQC 5DNMC 2PYOA 1P3GA 5CP6C 2HUEC 3AZLB 3W99D 3WAAD 3AZGC 3AZHC 1P3BB 3MGSB 4J8VD 3MGSC 3X1SD 4ZUXB 4J8XB 4YM6D 1P3GB 1EQZB 5KDMA 4WZSB 1HTAA 1A7WA 5B32C 5FUGA 3AZJD 4ZUXC 4J8XC 1P3GC 1EQZC 4XZQD 4J8UA 5CP6D 3X1TA 1KX4B 3AZGD 3AZHD 2FJ7A 5GT3B 3AZED 1KX4C 3MGSD 3B0CT 5GT3C 5B24A 3B0CW 4G92B 5B32D 4J8XD 3WA9A 1P3GD 1EQZD 3WTPE 4J8UC 4G92C 1WWSA 5B1MA 3O62A 3C1CA 3AFAA 2FJ7C 5GXQA 1KX3A 3UT9A 1P3PA 5DNNB 1P3OB 4H9QB 3VH5T 1KX4D 4H9RB 5B24C 5E5AB 5BNVB 5DNNC 1P3OC 3VH5W 2CV5A 4H9SA 4WU9B 5G49B 5E5AC 5B33B 5B1MC 4WU9C 4J8UD 1P3FA 3VH6T 3LJAA 5B33C 5CPIA 2FJ7D 3WTPA 3VH6W 2JSSA 4CSRA 5F99A 3MGRB 3A6NB 5B2JB 5BO0A 4CAYA 3AZKB 4KGCA 5B24D 4H9SC 1B67A 5GT0B 5DNND 3MGRC 5B2JC 3TU4B 5E5AD 3AZFB 3MVDB 2AROB 5B1MD 3LJAC 1M19B 4WU9D 5JRGA 3AZFC 3WTPC 3MVDC 2AROC 3UT9D 1M19C 3X1UA 4HGAC 5F99C 5AVCA 2YFVA 3UTBB 3AN2A 4J8WA 4KHAB 4YS3B 3MGRD 3UTBC 4YS3C 3LJAD 5AVCB 3LZ1B 5B2IA 3AN2B 4J8WB 3WTPD 3MVDD 2AROD 1M19D 3X1VB 4UUZA 5AVCC 3W98B 5F99D 2LY8A 3AN2C 4J8WC 3NQJA 3X1VC 5JA4B 4QLCB 3WAAA 2BYKA 5AV6B 3LELB 3UTBD 4LD9B 1ZLAA 1P3MB 4J8VA 3REIB 4YS3D 3LELC 5B2IC 3R45A 5BNXA 3X1SA 1P3MC 3REIC 5AVCD 2BYKB 1N1JB 2BYMA 5B0ZA 1ULYA 3AZJA 4J8WD 3AN2D 3B6FB 2F8NB 3X1VD 2F8NK 5DNMA 3AZNA 1KX5A 5CP6A 3V9RB 3AZGA 1ZLAC 3MGPB 3AZIB 3AZLA 3LELD 5B2ID 1P3BA 3MGSA 3AZIC 1P3MD 3REID 4H9PA 5B0YB 5B0ZC 3REJB 4G91B 4ZUXA 4J8XA 5B0YC 1EQZA 3AZNC 1KX5C 4G91C 2RVQC 3WKJB 3MNNB 1ZLAD 3AZLC 4H9PB 1P3BC 3WKJC 3MNNC 3KXBB 1KX4A 3AZID 3RELB 5GT3A 3KXBC 1P3AB 5B0ZD 3MGQB 5B31B 3RELC 5B0YD 5DNMD 1P3AC 3AZND 4NE5A 1KX5D 4DRAA 3MGQC 5B31C 3AZMB 2RVQD 3W97B 3AZLD 3AV2B 3AZMC 1P3BD 3WKJD 3MNND 2HIOB 3W97C 1B6WA 3AV2C 1HQ3B 3LZ0B 5BT1C 5DNNA 1P3OA 4H9QA 3KXBD 4E44A 4ZUXD 3LZ0C 4H9RA 5E5AA 4XUJB 5BS7C 5BNVA 3RELD 1AOIB 1P3AD 4WU9A 5GSUB 5G49A 3MGQD 5B33A 2F8NG 1Q9CA 1AOIC 4Z5TA 2CWEA 3W97D 5GT3D 5BT1D 3MGRA 3A6NA 5B2JA 3AZKA 3LZ0D 5GT0A 3TU4A 4Z5TB 3B6GB 3AZFA 1AOID 3MVDA 2AROA 4Z5TC 1M19A 3AYWB 3B6GC 4NFTA 1P3OD 3A6NC 3AZKC 2F8NH 3UTBA 5GT0C 3TU4C 4KHAA 4YS3A 1M18A 5B33D 5B31G 4Z5TD 4R8PB 3B6GD 3LZ1A 2YFWB 4R8PC 3X1VA 1M18B 1ID3B 3W98A 3A6ND 5B2JD 4WU8B 3AZKD 1S32B 4NE6A 1TZYB 5JA4A 1M18C 5GT0D 3TU4D 4QLCA 4WU8C 1S32C 1TZYC 5AV6A 1WWIA 5AV5B 4H9NB 3LELA 3AZFD 3AV1B 3W96B 4LD9A 1F1EA 1P3MA 3REIA 3LZ1C 5AV5C 4E45A 1TAFB 2IO5B 3KWQB 3C1BB 3VH5A 3W98C 4R8PD 1N1JA 3C1BC 3B6FA 2F8NA 3REHB 4QLCC 1M18D 5CPJA 5AV8B 5AV6C 3KUYB 4Z66B 4WU8D 4LD9C 1S32D 1TZYD 3V9RA 3MGPA 1M1AA 3VH6A 3AZIA 3KUYC 4Z66C 3LZ1D 5AV5D 1KU5A 1JFIB 5B0YA 5CPJB 4AWLB 5AY8B 4JJNB 1P3LB 3B6FC 3W98D 3REJA 3C1BD 5B40B 1M1AB 5CPJC 4AWLC 5AY8C 4JJNC 3UTAA 1P3LC 4QLCD 2NZDB 5AV6D 3MGPC 1M1AC 3WKJA 3MNNA 4LD9D 2NZDC 1P34B 1P3KB 3KUYD 4Z66D 3KXBA 1BFMA 4WV4B 1P34C 3NQUB 3UTAB 3RELA 3W99B 3REJC 1P3AA 4H9OB 3B6FD 3B0DB 5AVBB 3MGQA 5B31A 3UTAC 2F8ND 3W99C 5CPJD 5AY8D 1P3LD 3B0DC 5AVBC 3AZMA 3REKB 4YM6B 3MGPD 1M1AD 3W97A 4X23B 2NZDD 1BH9B 5CHLB 3AV2A 5CPKB 1U35B 3REKC 2HIOA 5B1LB 4X23C 1P34D 1P3IB 1HQ3A 3LZ0A 5CPKC 1U35C 5BS7A 3REJD 5B1LC 3AZHB 1P3IC 4XUJA 3UTAD 1H3OB 1AOIA 3AZEB 4WNNB 5GSUA 4KUDA 5AVBD 5AV9B 3AZEC 1BH8B 5AV9C 2HIOC 5B32B 3REKD 1HQ3C 2PYOB 4X23D 5CPKD 1U35D 5C3IB 2PYOC 4KUDB 5B1LD 4XUJC 5B31D 1P3ID 5C3IC 5GSUC 4KUDC 3AZMD 3B6GA 5KDMB 3AV2D 5FUGB
chains in the Genus database with same CATH superfamily
3AYWA 5AV9D 2HIOD 1HQ3D 4J8UB 3X1TB 2DQNC 2FJ7B 2PYOD 4XUJD 3X1TC 5GSUD 4KUDD 5B24B 2XD1A 3AYWC 4R8PA 3WA9B 2YFWA 5B1MB 3C1CB 3O62B 3AFAB 3A1IA 1ID3A 3WA9C 5GXQB 4WU8A 3UT9B 1P3PB 3C1CC 1S32A 1TZYA 3O62C 3AFAC 1KX3B 3AL0C 3X1TD 5GXQC 1KX3C 3UT9C 1P3PC 1R4VA 5AV5A 3P5JB 2Y2MA 4H9NA 3W96A 3AV1A 3B0BA 2CV5B 3AYWD 1TAFA 3KWQA 4NE3A 3C1BA 2CV5C 1F66A 1P3FB 1ID3C 3LJAB 5B32G 5CPIB 3WA9D 3WTPB 1P3FC 3C1CD 3REHA 3O62D 4HGAB 3AFAD 5CPIC 4CSRB 2NQBA 5F99B 5AV8A 5GXQD 4DRBA 3W96C 5BO0B 4CAYB 2Y2GA 4Z66A 3KUYA 3AV1C 1P3PD 1KX3D 4KGCB 1F66B 3KWQC 2IO5C 4KGCC 1F66C 1JFIA 2CV5D 2NQBB 5JRGB 1ID3D 5AY8A 4JJNA 1P3LA 3KSYA 5B40A 3X1UB 3REHC 2NQBC 5JRGC 1P3FD 5AV8C 3F6TA 2NZDA 5CPID 4Z2MG 3X1UC 2YFVB 3AV1D 3W96D 1P34A 1P3KA 2Y2NA 3H0MC 3KWQD 4KGCD 1F66D 3NQUA 3W99A 5B40C 5B2IB 4H9OA 4ZBJB 5AVBA 3REHD 4UUZB 2NQBD 5JRGD 5AV8D 4ZBJC 3NQJB 2G5HC 3X1UD 3REKA 4YM6A 1P3KC 4X23A 3WAAB 1BH9A 5CPKA 1U35A 2L5AA 5B1LA 3EPJA 3WAAC 1P3IA 4XZQA 4J8VB 1ZLAB 4JJND 3R45B 4Z2MH 5BNXB 3H0LC 3AZHA 4EO5B 5B40D 3X1SB 4J8VC 1H3OA 3AZEA 4EO5C 2BYMB 4WNNA 5B0ZB 3AZJB 4YM6C 3X1SC 5AV9A 4M6BA 4XZQB 5DNMB 1P3KD 3AZNB 3AZJC 1BH8A 1KX5B 5CP6B 2HUEB 5B32A 3AZGB 4XZQC 5DNMC 2PYOA 1P3GA 5CP6C 2HUEC 3AZLB 3W99D 3WAAD 3AZGC 3AZHC 1P3BB 3KFUG 3MGSB 4J8VD 3MGSC 2UWXA 3X1SD 4ZUXB 4J8XB 4YM6D 1P3GB 1EQZB 5KDMA 4WZSB 1HTAA 1A7WA 5B32C 5FUGA 3AZJD 4ZUXC 4J8XC 1P3GC 1EQZC 4XZQD 2VQRA 4J8UA 5CP6D 3X1TA 1KX4B 2DF4C 3AZGD 3AZHD 2FJ7A 5GT3B 3AZED 1KX4C 3MGSD 2Y2QA 3B0CT 5GT3C 5B24A 4WJ3C 4DQYB 3B0CW 4G92B 5B32D 4J8XD 3WA9A 1P3GD 1EQZD 3WTPE 4J8UC 2ZY2A 1WWSA 5B1MA 3O62A 3C1CA 3AFAA 4G92C 2FJ7C 5GXQA 1KX3A 3UT9A 1P3PA 2FFFB 5DNNB 1P3OB 4H9QB 3VH5T 1KX4D 4H9RB 5B24C 5E5AB 5BNVB 5DNNC 1P3OC 3VH5W 2CV5A 2ZY4A 4H9SA 4WU9B 5G49B 5E5AC 5B33B 1Z2CB 5B1MC 4WU9C 4J8UD 1P3FA 3VH6T 3LJAA 5B33C 5CPIA 2FJ7D 3WTPA 3VH6W 2JSSA 4CSRA 2Y2HA 5F99A 3MGRB 3A6NB 5B2JB 5BO0A 4CAYA 3AZKB 4KGCA 5B24D 4H9SC 1B67A 2ZY5A 5GT0B 5DNND 3MGRC 5B2JC 3TU4B 3FDDA 5E5AD 3AZFB 3MVDB 2AROB 5B1MD 3LJAC 1M19B 4WU9D 5JRGA 3AZFC 3WTPC 3MVDC 2AROC 3UT9D 1M19C 3X1UA 4HGAC 5F99C 5AVCA 2YFVA 3UTBB 3AN2A 4J8WA 4KHAB 4YS3B 3MGRD 3UTBC 4YS3C 3LJAD 5AVCB 3LZ1B 5B2IA 3AN2B 4J8WB 3WTPD 3MVDD 2AROD 1M19D 3X1VB 4UUZA 5AVCC 2J8PA 3W98B 5F99D 2LY8A 3AN2C 4J8WC 3NQJA 3X1VC 5JA4B 4QLCB 3WAAA 2BYKA 5AV6B 3LELB 3UTBD 4LD9B 1ZLAA 1P3MB 4J8VA 3REIB 4YS3D 3LELC 5B2IC 3R45A 5BNXA 2F2AC 3X1SA 3REIC 1P3MC 5AVCD 2BYKB 1N1JB 2BYMA 5B0ZA 1ULYA 3AZJA 4J8WD 3AN2D 3B6FB 2F8NB 3X1VD 3EG5B 2F8NK 5DNMA 3AZNA 1KX5A 5CP6A 3V9RB 3AZGA 1ZLAC 3MGPB 3AZIB 2BG1A 3AZLA 3LELD 5B2ID 1P3BA 3MGSA 3AZIC 1T3UA 1P3MD 3REID 4H9PA 5B0YB 5B0ZC 2JCHA 3REJB 4G91B 4ZUXA 4J8XA 5B0YC 1EQZA 3AZNC 1KX5C 4G91C 2RVQC 3WKJB 3MNNB 1ZLAD 3AZLC 4H9PB 1P3BC 2Y2OA 3WKJC 3MNNC 3KXBB 1KX4A 3AZID 3RELB 5GT3A 3KXBC 1P3AB 5B0ZD 3MGQB 5B31B 3RELC 5B0YD 5DNMD 1P3AC 3AZND 4NE5A 1KX5D 4DRAA 3MGQC 5B31C 3AZMB 2RVQD 3W97B 3AZLD 3AV2B 3AZMC 1P3BD 2ZY3A 2ZM5A 3WKJD 3MNND 2HIOB 3W97C 1B6WA 3AV2C 1HQ3B 3LZ0B 2Y2PA 5BT1C 5DNNA 1W2EA 4H9QA 1P3OA 3KXBD 4E44A 4ZUXD 3LZ0C 4H9RA 5E5AA 4XUJB 5BS7C 5BNVA 3RELD 1AOIB 1P3AD 4WU9A 5GSUB 5G49A 3MGQD 5B33A 2F8NG 1Q9CA 1AOIC 4Z5TA 2CWEA 3W97D 5GT3D 5BT1D 3MGRA 3A6NA 2G5IC 5B2JA 3AZKA 3LZ0D 5GT0A 3TU4A 4Z5TB 3B6GB 3AZFA 1AOID 3MVDA 2AROA 4Z5TC 1M19A 3EPKA 3AYWB 3B6GC 4NFTA 1P3OD 3A6NC 2Y2IA 3AZKC 2F8NH 3UTBA 5GT0C 3TU4C 2Y2LA 3H0RC 4KHAA 4YS3A 1M18A 5B33D 5B31G 2JE5A 4UPKA 4Z5TD 4R8PB 3B6GD 3LZ1A 2YFWB 4R8PC 3X1VA 1M18B 1ID3B 3W98A 3A6ND 5B2JD 4WU8B 3AZKD 1S32B 4NE6A 1TZYB 5JA4A 1M18C 5GT0D 3TU4D 4QLCA 4WU8C 1S32C 1TZYC 5AV6A 1WWIA 5AV5B 4H9NB 3LELA 3AZFD 3AV1B 3W96B 4LD9A 1F1EA 1P3MA 3REIA 3LZ1C 5AV5C 4E45A 1TAFB 2IO5B 3KWQB 3EPLA 3C1BB 3VH5A 3W98C 4R8PD 1N1JA 3C1BC 2Y2JA 3B6FA 2F8NA 3REHB 4QLCC 1M18D 5CPJA 5AV8B 5AV6C 3KUYB 2W8SA 4Z66B 4WU8D 1S32D 4LD9C 1TZYD 3V9RA 3MGPA 1M1AA 3VH6A 3AZIA 3KUYC 4Z66C 3LZ1D 5AV5D 1KU5A 1JFIB 5B0YA 5CPJB 4AWLB 5AY8B 4JJNB 2RIQA 1P3LB 3B6FC 3W98D 3REJA 3C1BD 5B40B 1M1AB 5CPJC 4AWLC 5AY8C 4JJNC 3UTAA 1P3LC 4QLCD 2NZDB 5AV6D 3MGPC 1M1AC 3WKJA 3MNNA 4LD9D 2NZDC 1P34B 1P3KB 3KUYD 4Z66D 3KXBA 1BFMA 4WV4B 1P34C 3NQUB 3UTAB 3RELA 3W99B 3REJC 1P3AA 4H9OB 3B6FD 3B0DB 5AVBB 1PZRA 5B31A 3MGQA 3UTAC 2F8ND 3W99C 5CPJD 5AY8D 1P3LD 3B0DC 2Y2KA 5AVBC 3AZMA 3REKB 4YM6B 3MGPD 1M1AD 3W97A 4X23B 2NZDD 1BH9B 5CHLB 3AV2A 5CPKB 1U35B 3REKC 2HIOA 5B1LB 4X23C 1P34D 1P3IB 1HQ3A 3LZ0A 3A1KA 5CPKC 1U35C 5BS7A 3REJD 5B1LC 3AZHB 1P3IC 4XUJA 3UTAD 1H3OB 1AOIA 3AZEB 4WNNB 2XD5A 5GSUA 4KUDA 5AVBD 5AV9B 3AZEC 1BH8B 3EPHA 5AV9C 2HIOC 5B32B 3REKD 1HQ3C 2PYOB 4X23D 5CPKD 1U35D 5C3IB 2PYOC 4KUDB 5B1LD 4XUJC 5B31D 1P3ID 5C3IC 5GSUC 4KUDC 3AZMD 3B6GA 3IP4C 5KDMB 3AV2D 5FUGB
chains in the Genus database with same CATH topology
3AYWA 5AV9D 2HIOD 1HQ3D 4J8UB 3X1TB 2DQNC 2FJ7B 2PYOD 4XUJD 3X1TC 5GSUD 4KUDD 5B24B 2XD1A 3AYWC 4R8PA 3WA9B 2YFWA 5B1MB 3C1CB 3O62B 3AFAB 3A1IA 1ID3A 3WA9C 5GXQB 4WU8A 3UT9B 1P3PB 3C1CC 1S32A 1TZYA 3O62C 3AFAC 1KX3B 3AL0C 3X1TD 5GXQC 1KX3C 3UT9C 1P3PC 1R4VA 5AV5A 3P5JB 2Y2MA 4H9NA 3W96A 3AV1A 3B0BA 2CV5B 3AYWD 1TAFA 3KWQA 4NE3A 3C1BA 2CV5C 1F66A 1P3FB 1ID3C 3LJAB 5B32G 5CPIB 3WA9D 3WTPB 1P3FC 3C1CD 3REHA 3O62D 4HGAB 3AFAD 5CPIC 4CSRB 2NQBA 5F99B 5AV8A 5GXQD 4DRBA 3W96C 5BO0B 4CAYB 2Y2GA 4Z66A 3KUYA 3AV1C 1P3PD 1KX3D 4KGCB 1F66B 3KWQC 2IO5C 4KGCC 1F66C 1JFIA 2CV5D 2NQBB 5JRGB 1ID3D 5AY8A 4JJNA 1P3LA 3KSYA 5B40A 3X1UB 3REHC 2NQBC 5JRGC 1P3FD 5AV8C 3F6TA 2NZDA 5CPID 4Z2MG 3X1UC 2YFVB 3AV1D 3W96D 1P34A 1P3KA 2Y2NA 3H0MC 3KWQD 4KGCD 1F66D 3NQUA 3W99A 5B40C 5B2IB 4H9OA 4ZBJB 5AVBA 3REHD 4UUZB 2NQBD 5JRGD 5AV8D 4ZBJC 3NQJB 2G5HC 3X1UD 3REKA 4YM6A 1P3KC 4X23A 3WAAB 1BH9A 5CPKA 1U35A 2L5AA 5B1LA 3EPJA 3WAAC 1P3IA 4XZQA 4J8VB 1ZLAB 4JJND 3R45B 4Z2MH 5BNXB 3H0LC 3AZHA 4EO5B 5B40D 3X1SB 4J8VC 1H3OA 3AZEA 4EO5C 2BYMB 4WNNA 5B0ZB 3AZJB 4YM6C 3X1SC 5AV9A 4M6BA 4XZQB 5DNMB 1P3KD 3AZNB 3AZJC 1BH8A 1KX5B 5CP6B 2HUEB 5B32A 3AZGB 4XZQC 5DNMC 2PYOA 1P3GA 5CP6C 2HUEC 3AZLB 3W99D 3WAAD 3AZGC 3AZHC 1P3BB 3KFUG 3MGSB 4J8VD 3MGSC 2UWXA 3X1SD 4ZUXB 4J8XB 4YM6D 1P3GB 1EQZB 5KDMA 4WZSB 1HTAA 1A7WA 5B32C 5FUGA 3AZJD 4ZUXC 4J8XC 1P3GC 1EQZC 4XZQD 2VQRA 4J8UA 5CP6D 3X1TA 1KX4B 2DF4C 3AZGD 3AZHD 2FJ7A 5GT3B 3AZED 1KX4C 3MGSD 2Y2QA 3B0CT 5GT3C 5B24A 4WJ3C 4DQYB 3B0CW 4G92B 5B32D 4J8XD 3WA9A 1P3GD 1EQZD 3WTPE 4J8UC 2ZY2A 1WWSA 5B1MA 3O62A 3C1CA 3AFAA 4G92C 2FJ7C 5GXQA 1KX3A 3UT9A 1P3PA 2FFFB 5DNNB 1P3OB 4H9QB 3VH5T 1KX4D 4H9RB 5B24C 5E5AB 5BNVB 5DNNC 1P3OC 3VH5W 2CV5A 2ZY4A 4H9SA 4WU9B 5G49B 5E5AC 5B33B 1Z2CB 5B1MC 4WU9C 4J8UD 1P3FA 3VH6T 3LJAA 5B33C 5CPIA 2FJ7D 3WTPA 3VH6W 2JSSA 4CSRA 2Y2HA 5F99A 3MGRB 3A6NB 5B2JB 5BO0A 4CAYA 3AZKB 4KGCA 5B24D 4H9SC 1B67A 2ZY5A 5GT0B 5DNND 3MGRC 5B2JC 3TU4B 3FDDA 5E5AD 3AZFB 3MVDB 2AROB 5B1MD 3LJAC 1M19B 4WU9D 5JRGA 3AZFC 3WTPC 3MVDC 2AROC 3UT9D 1M19C 3X1UA 4HGAC 5F99C 5AVCA 2YFVA 3UTBB 3AN2A 4J8WA 4KHAB 4YS3B 3MGRD 3UTBC 4YS3C 3LJAD 5AVCB 3LZ1B 5B2IA 3AN2B 4J8WB 3WTPD 3MVDD 2AROD 1M19D 3X1VB 4UUZA 5AVCC 2J8PA 3W98B 5F99D 2LY8A 3AN2C 4J8WC 3NQJA 3X1VC 5JA4B 4QLCB 3WAAA 2BYKA 5AV6B 3LELB 3UTBD 4LD9B 1ZLAA 1P3MB 4J8VA 3REIB 4YS3D 3LELC 5B2IC 3R45A 5BNXA 2F2AC 3X1SA 3REIC 1P3MC 5AVCD 2BYKB 1N1JB 2BYMA 5B0ZA 1ULYA 3AZJA 4J8WD 3AN2D 3B6FB 2F8NB 3X1VD 3EG5B 2F8NK 5DNMA 3AZNA 1KX5A 5CP6A 3V9RB 3AZGA 1ZLAC 3MGPB 3AZIB 2BG1A 3AZLA 3LELD 5B2ID 1P3BA 3MGSA 3AZIC 1T3UA 1P3MD 3REID 4H9PA 5B0YB 5B0ZC 2JCHA 3REJB 4G91B 4ZUXA 4J8XA 5B0YC 1EQZA 3AZNC 1KX5C 4G91C 2RVQC 3WKJB 3MNNB 1ZLAD 3AZLC 4H9PB 1P3BC 2Y2OA 3WKJC 3MNNC 3KXBB 1KX4A 3AZID 3RELB 5GT3A 3KXBC 1P3AB 5B0ZD 3MGQB 5B31B 3RELC 5B0YD 5DNMD 1P3AC 3AZND 4NE5A 1KX5D 4DRAA 3MGQC 5B31C 3AZMB 2RVQD 3W97B 3AZLD 3AV2B 3AZMC 1P3BD 2ZY3A 2ZM5A 3WKJD 3MNND 2HIOB 3W97C 1B6WA 3AV2C 1HQ3B 3LZ0B 2Y2PA 5BT1C 5DNNA 1W2EA 4H9QA 1P3OA 3KXBD 4E44A 4ZUXD 3LZ0C 4H9RA 5E5AA 4XUJB 5BS7C 5BNVA 3RELD 1AOIB 1P3AD 4WU9A 5GSUB 5G49A 3MGQD 5B33A 2F8NG 1Q9CA 1AOIC 4Z5TA 2CWEA 3W97D 5GT3D 5BT1D 3MGRA 3A6NA 2G5IC 5B2JA 3AZKA 3LZ0D 5GT0A 3TU4A 4Z5TB 3B6GB 3AZFA 1AOID 3MVDA 2AROA 4Z5TC 1M19A 3EPKA 3AYWB 3B6GC 4NFTA 1P3OD 3A6NC 2Y2IA 3AZKC 2F8NH 3UTBA 5GT0C 3TU4C 2Y2LA 3H0RC 4KHAA 4YS3A 1M18A 5B33D 5B31G 2JE5A 4UPKA 4Z5TD 4R8PB 3B6GD 3LZ1A 2YFWB 4R8PC 3X1VA 1M18B 1ID3B 3W98A 3A6ND 5B2JD 4WU8B 3AZKD 1S32B 4NE6A 1TZYB 5JA4A 1M18C 5GT0D 3TU4D 4QLCA 4WU8C 1S32C 1TZYC 5AV6A 1WWIA 5AV5B 4H9NB 3LELA 3AZFD 3AV1B 3W96B 4LD9A 1F1EA 1P3MA 3REIA 3LZ1C 5AV5C 4E45A 1TAFB 2IO5B 3KWQB 3EPLA 3C1BB 3VH5A 3W98C 4R8PD 1N1JA 3C1BC 2Y2JA 3B6FA 2F8NA 3REHB 4QLCC 1M18D 5CPJA 5AV8B 5AV6C 3KUYB 2W8SA 4Z66B 4WU8D 1S32D 4LD9C 1TZYD 3V9RA 3MGPA 1M1AA 3VH6A 3AZIA 3KUYC 4Z66C 3LZ1D 5AV5D 1KU5A 1JFIB 5B0YA 5CPJB 4AWLB 5AY8B 4JJNB 2RIQA 1P3LB 3B6FC 3W98D 3REJA 3C1BD 5B40B 1M1AB 5CPJC 4AWLC 5AY8C 4JJNC 3UTAA 1P3LC 4QLCD 2NZDB 5AV6D 3MGPC 1M1AC 3WKJA 3MNNA 4LD9D 2NZDC 1P34B 1P3KB 3KUYD 4Z66D 3KXBA 1BFMA 4WV4B 1P34C 3NQUB 3UTAB 3RELA 3W99B 3REJC 1P3AA 4H9OB 3B6FD 3B0DB 5AVBB 1PZRA 5B31A 3MGQA 3UTAC 2F8ND 3W99C 5CPJD 5AY8D 1P3LD 3B0DC 2Y2KA 5AVBC 3AZMA 3REKB 4YM6B 3MGPD 1M1AD 3W97A 4X23B 2NZDD 1BH9B 5CHLB 3AV2A 5CPKB 1U35B 3REKC 2HIOA 5B1LB 4X23C 1P34D 1P3IB 1HQ3A 3LZ0A 3A1KA 5CPKC 1U35C 5BS7A 3REJD 5B1LC 3AZHB 1P3IC 4XUJA 3UTAD 1H3OB 1AOIA 3AZEB 4WNNB 2XD5A 5GSUA 4KUDA 5AVBD 5AV9B 3AZEC 1BH8B 3EPHA 5AV9C 2HIOC 5B32B 3REKD 1HQ3C 2PYOB 4X23D 5CPKD 1U35D 5C3IB 2PYOC 4KUDB 5B1LD 4XUJC 5B31D 1P3ID 5C3IC 5GSUC 4KUDC 3AZMD 3B6GA 3IP4C 5KDMB 3AV2D 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW A;  5AV9 D;  2HIO D;  1HQ3 D;  4J8U B;  3X1T B;  2FJ7 B;  2PYO D;  4XUJ D;  3X1T C;  5GSU D;  4KUD D;  5B24 B;  3AYW C;  4R8P A;  3WA9 B;  2YFW A;  5B1M B;  3C1C B;  3O62 B;  3AFA B;  1ID3 A;  3WA9 C;  5GXQ B;  4WU8 A;  3UT9 B;  1P3P B;  3C1C C;  1S32 A;  1TZY A;  3O62 C;  3AFA C;  1KX3 B;  3X1T D;  5GXQ C;  1KX3 C;  3UT9 C;  1P3P C;  1R4V A;  5AV5 A;  3AV1 A;  4H9N A;  3W96 A;  3B0B A;  2CV5 B;  3AYW D;  1TAF A;  3KWQ A;  4NE3 A;  3C1B A;  2CV5 C;  1F66 A;  1P3F B;  1ID3 C;  3LJA B;  5B32 G;  5CPI B;  3WA9 D;  3WTP B;  1P3F C;  3C1C D;  3REH A;  3O62 D;  4HGA B;  3AFA D;  5CPI C;  4CSR B;  2NQB A;  5F99 B;  5AV8 A;  5GXQ D;  4DRB A;  3W96 C;  5BO0 B;  4CAY B;  4Z66 A;  3KUY A;  3AV1 C;  1P3P D;  1KX3 D;  4KGC B;  1F66 B;  3KWQ C;  2IO5 C;  4KGC C;  1F66 C;  1JFI A;  2CV5 D;  2NQB B;  5JRG B;  1ID3 D;  5AY8 A;  4JJN A;  1P3L A;  3KSY A;  5B40 A;  3X1U B;  3REH C;  2NQB C;  5JRG C;  1P3F D;  5AV8 C;  2NZD A;  5CPI D;  4Z2M G;  3X1U C;  2YFV B;  3AV1 D;  3W96 D;  1P34 A;  1P3K A;  3KWQ D;  4KGC D;  1F66 D;  3NQU A;  3W99 A;  5B40 C;  5B2I B;  4H9O A;  4ZBJ B;  5AVB A;  3REH D;  4UUZ B;  2NQB D;  5JRG D;  5AV8 D;  4ZBJ C;  3NQJ B;  3X1U D;  3REK A;  4YM6 A;  1P3K C;  4X23 A;  3WAA B;  1BH9 A;  5CPK A;  1U35 A;  2L5A A;  5B1L A;  3WAA C;  1P3I A;  4XZQ A;  4J8V B;  1ZLA B;  4JJN D;  3R45 B;  4Z2M H;  5BNX B;  3AZH A;  4EO5 B;  5B40 D;  3X1S B;  4J8V C;  1H3O A;  3AZE A;  4EO5 C;  2BYM B;  4WNN A;  5B0Z B;  3AZJ B;  4YM6 C;  3X1S C;  5AV9 A;  4M6B A;  4XZQ B;  5DNM B;  1P3K D;  3AZN B;  3AZJ C;  1BH8 A;  1KX5 B;  5CP6 B;  2HUE B;  5B32 A;  3AZG B;  4XZQ C;  5DNM C;  2PYO A;  1P3G A;  5CP6 C;  2HUE C;  3AZL B;  3W99 D;  3WAA D;  3AZG C;  3AZH C;  1P3B B;  3MGS B;  4J8V D;  3MGS C;  3X1S D;  4ZUX B;  4J8X B;  4YM6 D;  1P3G B;  1EQZ B;  5KDM A;  4WZS B;  1HTA A;  1A7W A;  5B32 C;  5FUG A;  3AZJ D;  4ZUX C;  4J8X C;  1P3G C;  1EQZ C;  4XZQ D;  4J8U A;  5CP6 D;  3X1T A;  1KX4 B;  3AZG D;  3AZH D;  2FJ7 A;  5GT3 B;  3AZE D;  1KX4 C;  3MGS D;  3B0C T;  5GT3 C;  5B24 A;  3B0C W;  4G92 B;  5B32 D;  4J8X D;  3WA9 A;  1P3G D;  1EQZ D;  3WTP E;  4J8U C;  4G92 C;  1WWS A;  5B1M A;  3O62 A;  3C1C A;  3AFA A;  2FJ7 C;  5GXQ A;  1KX3 A;  3UT9 A;  1P3P A;  5DNN B;  1P3O B;  4H9Q B;  3VH5 T;  1KX4 D;  4H9R B;  5B24 C;  5E5A B;  5BNV B;  5DNN C;  1P3O C;  3VH5 W;  2CV5 A;  4H9S A;  4WU9 B;  5G49 B;  5E5A C;  5B33 B;  5B1M C;  4WU9 C;  4J8U D;  1P3F A;  3VH6 T;  3LJA A;  5B33 C;  5CPI A;  2FJ7 D;  3WTP A;  3VH6 W;  2JSS A;  4CSR A;  5F99 A;  3MGR B;  3A6N B;  5B2J B;  5BO0 A;  4CAY A;  3AZK B;  4KGC A;  5B24 D;  4H9S C;  1B67 A;  5GT0 B;  5DNN D;  3MGR C;  5B2J C;  3TU4 B;  5E5A D;  3AZF B;  3MVD B;  2ARO B;  5B1M D;  3LJA C;  1M19 B;  4WU9 D;  5JRG A;  3AZF C;  3WTP C;  3MVD C;  2ARO C;  3UT9 D;  1M19 C;  3X1U A;  4HGA C;  5F99 C;  5AVC A;  2YFV A;  3UTB B;  3AN2 A;  4J8W A;  4KHA B;  4YS3 B;  3MGR D;  3UTB C;  4YS3 C;  3LJA D;  5AVC B;  3LZ1 B;  5B2I A;  3AN2 B;  4J8W B;  3WTP D;  3MVD D;  2ARO D;  1M19 D;  3X1V B;  4UUZ A;  5AVC C;  3W98 B;  5F99 D;  2LY8 A;  3AN2 C;  4J8W C;  3NQJ A;  3X1V C;  5JA4 B;  4QLC B;  3WAA A;  2BYK A;  5AV6 B;  3LEL B;  3UTB D;  4LD9 B;  1ZLA A;  1P3M B;  4J8V A;  3REI B;  4YS3 D;  3LEL C;  5B2I C;  3R45 A;  5BNX A;  3X1S A;  1P3M C;  3REI C;  5AVC D;  2BYK B;  1N1J B;  2BYM A;  5B0Z A;  1ULY A;  3AZJ A;  4J8W D;  3AN2 D;  3B6F B;  2F8N B;  3X1V D;  2F8N K;  5DNM A;  3AZN A;  1KX5 A;  5CP6 A;  3V9R B;  3AZG A;  1ZLA C;  3MGP B;  3AZI B;  3AZL A;  3LEL D;  5B2I D;  1P3B A;  3MGS A;  3AZI C;  1P3M D;  3REI D;  4H9P A;  5B0Y B;  5B0Z C;  3REJ B;  4G91 B;  4ZUX A;  4J8X A;  5B0Y C;  1EQZ A;  3AZN C;  1KX5 C;  4G91 C;  2RVQ C;  3WKJ B;  3MNN B;  1ZLA D;  3AZL C;  4H9P B;  1P3B C;  3WKJ C;  3MNN C;  3KXB B;  1KX4 A;  3AZI D;  3REL B;  5GT3 A;  3KXB C;  1P3A B;  5B0Z D;  3MGQ B;  5B31 B;  3REL C;  5B0Y D;  5DNM D;  1P3A C;  3AZN D;  4NE5 A;  1KX5 D;  4DRA A;  3MGQ C;  5B31 C;  3AZM B;  2RVQ D;  3W97 B;  3AZL D;  3AV2 B;  3AZM C;  1P3B D;  3WKJ D;  3MNN D;  2HIO B;  3W97 C;  1B6W A;  3AV2 C;  1HQ3 B;  3LZ0 B;  5BT1 C;  5DNN A;  1P3O A;  4H9Q A;  3KXB D;  4E44 A;  4ZUX D;  3LZ0 C;  4H9R A;  5E5A A;  4XUJ B;  5BS7 C;  5BNV A;  3REL D;  1AOI B;  1P3A D;  4WU9 A;  5GSU B;  5G49 A;  3MGQ D;  5B33 A;  2F8N G;  1Q9C A;  1AOI C;  4Z5T A;  2CWE A;  3W97 D;  5GT3 D;  5BT1 D;  3MGR A;  3A6N A;  5B2J A;  3AZK A;  3LZ0 D;  5GT0 A;  3TU4 A;  4Z5T B;  3B6G B;  3AZF A;  1AOI D;  3MVD A;  2ARO A;  4Z5T C;  1M19 A;  3AYW B;  3B6G C;  4NFT A;  1P3O D;  3A6N C;  3AZK C;  2F8N H;  3UTB A;  5GT0 C;  3TU4 C;  4KHA A;  4YS3 A;  1M18 A;  5B33 D;  5B31 G;  4Z5T D;  4R8P B;  3B6G D;  3LZ1 A;  2YFW B;  4R8P C;  3X1V A;  1M18 B;  1ID3 B;  3W98 A;  3A6N D;  5B2J D;  4WU8 B;  3AZK D;  1S32 B;  4NE6 A;  1TZY B;  5JA4 A;  1M18 C;  5GT0 D;  3TU4 D;  4QLC A;  4WU8 C;  1S32 C;  1TZY C;  5AV6 A;  1WWI A;  5AV5 B;  4H9N B;  3LEL A;  3AZF D;  3AV1 B;  3W96 B;  4LD9 A;  1F1E A;  1P3M A;  3REI A;  3LZ1 C;  5AV5 C;  4E45 A;  1TAF B;  2IO5 B;  3KWQ B;  3C1B B;  3VH5 A;  3W98 C;  4R8P D;  1N1J A;  3C1B C;  3B6F A;  2F8N A;  3REH B;  4QLC C;  1M18 D;  5CPJ A;  5AV8 B;  5AV6 C;  3KUY B;  4Z66 B;  4WU8 D;  4LD9 C;  1S32 D;  1TZY D;  3V9R A;  3MGP A;  1M1A A;  3VH6 A;  3AZI A;  3KUY C;  4Z66 C;  3LZ1 D;  5AV5 D;  1KU5 A;  1JFI B;  5B0Y A;  5CPJ B;  4AWL B;  5AY8 B;  4JJN B;  1P3L B;  3B6F C;  3W98 D;  3REJ A;  3C1B D;  5B40 B;  1M1A B;  5CPJ C;  4AWL C;  5AY8 C;  4JJN C;  3UTA A;  1P3L C;  4QLC D;  2NZD B;  5AV6 D;  3MGP C;  1M1A C;  3WKJ A;  3MNN A;  4LD9 D;  2NZD C;  1P34 B;  1P3K B;  3KUY D;  4Z66 D;  3KXB A;  1BFM A;  4WV4 B;  1P34 C;  3NQU B;  3UTA B;  3REL A;  3W99 B;  3REJ C;  1P3A A;  4H9O B;  3B6F D;  3B0D B;  5AVB B;  3MGQ A;  5B31 A;  3UTA C;  2F8N D;  3W99 C;  5CPJ D;  5AY8 D;  1P3L D;  3B0D C;  5AVB C;  3AZM A;  3REK B;  4YM6 B;  3MGP D;  1M1A D;  3W97 A;  4X23 B;  2NZD D;  1BH9 B;  5CHL B;  3AV2 A;  5CPK B;  1U35 B;  3REK C;  2HIO A;  5B1L B;  4X23 C;  1P34 D;  1P3I B;  1HQ3 A;  3LZ0 A;  5CPK C;  1U35 C;  5BS7 A;  3REJ D;  5B1L C;  3AZH B;  1P3I C;  4XUJ A;  3UTA D;  1H3O B;  1AOI A;  3AZE B;  4WNN B;  5GSU A;  4KUD A;  5AVB D;  5AV9 B;  3AZE C;  1BH8 B;  5AV9 C;  2HIO C;  5B32 B;  3REK D;  1HQ3 C;  2PYO B;  4X23 D;  5CPK D;  1U35 D;  5C3I B;  2PYO C;  4KUD B;  5B1L D;  4XUJ C;  5B31 D;  1P3I D;  5C3I C;  5GSU C;  4KUD C;  3AZM D;  3B6G A;  5KDM B;  3AV2 D;  5FUG B; 
#chains in the Genus database with same CATH topology
 3AYW A;  5AV9 D;  2HIO D;  1HQ3 D;  4J8U B;  3X1T B;  2DQN C;  2FJ7 B;  2PYO D;  4XUJ D;  3X1T C;  5GSU D;  4KUD D;  5B24 B;  2XD1 A;  3AYW C;  4R8P A;  3WA9 B;  2YFW A;  5B1M B;  3C1C B;  3O62 B;  3AFA B;  3A1I A;  1ID3 A;  3WA9 C;  5GXQ B;  4WU8 A;  3UT9 B;  1P3P B;  3C1C C;  1S32 A;  1TZY A;  3O62 C;  3AFA C;  1KX3 B;  3AL0 C;  3X1T D;  5GXQ C;  1KX3 C;  3UT9 C;  1P3P C;  1R4V A;  5AV5 A;  3P5J B;  2Y2M A;  4H9N A;  3W96 A;  3AV1 A;  3B0B A;  2CV5 B;  3AYW D;  1TAF A;  3KWQ A;  4NE3 A;  3C1B A;  2CV5 C;  1F66 A;  1P3F B;  1ID3 C;  3LJA B;  5B32 G;  5CPI B;  3WA9 D;  3WTP B;  1P3F C;  3C1C D;  3REH A;  3O62 D;  4HGA B;  3AFA D;  5CPI C;  4CSR B;  2NQB A;  5F99 B;  5AV8 A;  5GXQ D;  4DRB A;  3W96 C;  5BO0 B;  4CAY B;  2Y2G A;  4Z66 A;  3KUY A;  3AV1 C;  1P3P D;  1KX3 D;  4KGC B;  1F66 B;  3KWQ C;  2IO5 C;  4KGC C;  1F66 C;  1JFI A;  2CV5 D;  2NQB B;  5JRG B;  1ID3 D;  5AY8 A;  4JJN A;  1P3L A;  3KSY A;  5B40 A;  3X1U B;  3REH C;  2NQB C;  5JRG C;  1P3F D;  5AV8 C;  3F6T A;  2NZD A;  5CPI D;  4Z2M G;  3X1U C;  2YFV B;  3AV1 D;  3W96 D;  1P34 A;  1P3K A;  2Y2N A;  3H0M C;  3KWQ D;  4KGC D;  1F66 D;  3NQU A;  3W99 A;  5B40 C;  5B2I B;  4H9O A;  4ZBJ B;  5AVB A;  3REH D;  4UUZ B;  2NQB D;  5JRG D;  5AV8 D;  4ZBJ C;  3NQJ B;  2G5H C;  3X1U D;  3REK A;  4YM6 A;  1P3K C;  4X23 A;  3WAA B;  1BH9 A;  5CPK A;  1U35 A;  2L5A A;  5B1L A;  3EPJ A;  3WAA C;  1P3I A;  4XZQ A;  4J8V B;  1ZLA B;  4JJN D;  3R45 B;  4Z2M H;  5BNX B;  3H0L C;  3AZH A;  4EO5 B;  5B40 D;  3X1S B;  4J8V C;  1H3O A;  3AZE A;  4EO5 C;  2BYM B;  4WNN A;  5B0Z B;  3AZJ B;  4YM6 C;  3X1S C;  5AV9 A;  4M6B A;  4XZQ B;  5DNM B;  1P3K D;  3AZN B;  3AZJ C;  1BH8 A;  1KX5 B;  5CP6 B;  2HUE B;  5B32 A;  3AZG B;  4XZQ C;  5DNM C;  2PYO A;  1P3G A;  5CP6 C;  2HUE C;  3AZL B;  3W99 D;  3WAA D;  3AZG C;  3AZH C;  1P3B B;  3KFU G;  3MGS B;  4J8V D;  3MGS C;  2UWX A;  3X1S D;  4ZUX B;  4J8X B;  4YM6 D;  1P3G B;  1EQZ B;  5KDM A;  4WZS B;  1HTA A;  1A7W A;  5B32 C;  5FUG A;  3AZJ D;  4ZUX C;  4J8X C;  1P3G C;  1EQZ C;  4XZQ D;  2VQR A;  4J8U A;  5CP6 D;  3X1T A;  1KX4 B;  2DF4 C;  3AZG D;  3AZH D;  2FJ7 A;  5GT3 B;  3AZE D;  1KX4 C;  3MGS D;  2Y2Q A;  3B0C T;  5GT3 C;  5B24 A;  4WJ3 C;  4DQY B;  3B0C W;  4G92 B;  5B32 D;  4J8X D;  3WA9 A;  1P3G D;  1EQZ D;  3WTP E;  4J8U C;  2ZY2 A;  1WWS A;  5B1M A;  3O62 A;  3C1C A;  3AFA A;  4G92 C;  2FJ7 C;  5GXQ A;  1KX3 A;  3UT9 A;  1P3P A;  2FFF B;  5DNN B;  1P3O B;  4H9Q B;  3VH5 T;  1KX4 D;  4H9R B;  5B24 C;  5E5A B;  5BNV B;  5DNN C;  1P3O C;  3VH5 W;  2CV5 A;  2ZY4 A;  4H9S A;  4WU9 B;  5G49 B;  5E5A C;  5B33 B;  1Z2C B;  5B1M C;  4WU9 C;  4J8U D;  1P3F A;  3VH6 T;  3LJA A;  5B33 C;  5CPI A;  2FJ7 D;  3WTP A;  3VH6 W;  2JSS A;  4CSR A;  2Y2H A;  5F99 A;  3MGR B;  3A6N B;  5B2J B;  5BO0 A;  4CAY A;  3AZK B;  4KGC A;  5B24 D;  4H9S C;  1B67 A;  2ZY5 A;  5GT0 B;  5DNN D;  3MGR C;  5B2J C;  3TU4 B;  3FDD A;  5E5A D;  3AZF B;  3MVD B;  2ARO B;  5B1M D;  3LJA C;  1M19 B;  4WU9 D;  5JRG A;  3AZF C;  3WTP C;  3MVD C;  2ARO C;  3UT9 D;  1M19 C;  3X1U A;  4HGA C;  5F99 C;  5AVC A;  2YFV A;  3UTB B;  3AN2 A;  4J8W A;  4KHA B;  4YS3 B;  3MGR D;  3UTB C;  4YS3 C;  3LJA D;  5AVC B;  3LZ1 B;  5B2I A;  3AN2 B;  4J8W B;  3WTP D;  3MVD D;  2ARO D;  1M19 D;  3X1V B;  4UUZ A;  5AVC C;  2J8P A;  3W98 B;  5F99 D;  2LY8 A;  3AN2 C;  4J8W C;  3NQJ A;  3X1V C;  5JA4 B;  4QLC B;  3WAA A;  2BYK A;  5AV6 B;  3LEL B;  3UTB D;  4LD9 B;  1ZLA A;  1P3M B;  4J8V A;  3REI B;  4YS3 D;  3LEL C;  5B2I C;  3R45 A;  5BNX A;  2F2A C;  3X1S A;  3REI C;  1P3M C;  5AVC D;  2BYK B;  1N1J B;  2BYM A;  5B0Z A;  1ULY A;  3AZJ A;  4J8W D;  3AN2 D;  3B6F B;  2F8N B;  3X1V D;  3EG5 B;  2F8N K;  5DNM A;  3AZN A;  1KX5 A;  5CP6 A;  3V9R B;  3AZG A;  1ZLA C;  3MGP B;  3AZI B;  2BG1 A;  3AZL A;  3LEL D;  5B2I D;  1P3B A;  3MGS A;  3AZI C;  1T3U A;  1P3M D;  3REI D;  4H9P A;  5B0Y B;  5B0Z C;  2JCH A;  3REJ B;  4G91 B;  4ZUX A;  4J8X A;  5B0Y C;  1EQZ A;  3AZN C;  1KX5 C;  4G91 C;  2RVQ C;  3WKJ B;  3MNN B;  1ZLA D;  3AZL C;  4H9P B;  1P3B C;  2Y2O A;  3WKJ C;  3MNN C;  3KXB B;  1KX4 A;  3AZI D;  3REL B;  5GT3 A;  3KXB C;  1P3A B;  5B0Z D;  3MGQ B;  5B31 B;  3REL C;  5B0Y D;  5DNM D;  1P3A C;  3AZN D;  4NE5 A;  1KX5 D;  4DRA A;  3MGQ C;  5B31 C;  3AZM B;  2RVQ D;  3W97 B;  3AZL D;  3AV2 B;  3AZM C;  1P3B D;  2ZY3 A;  2ZM5 A;  3WKJ D;  3MNN D;  2HIO B;  3W97 C;  1B6W A;  3AV2 C;  1HQ3 B;  3LZ0 B;  2Y2P A;  5BT1 C;  5DNN A;  1W2E A;  4H9Q A;  1P3O A;  3KXB D;  4E44 A;  4ZUX D;  3LZ0 C;  4H9R A;  5E5A A;  4XUJ B;  5BS7 C;  5BNV A;  3REL D;  1AOI B;  1P3A D;  4WU9 A;  5GSU B;  5G49 A;  3MGQ D;  5B33 A;  2F8N G;  1Q9C A;  1AOI C;  4Z5T A;  2CWE A;  3W97 D;  5GT3 D;  5BT1 D;  3MGR A;  3A6N A;  2G5I C;  5B2J A;  3AZK A;  3LZ0 D;  5GT0 A;  3TU4 A;  4Z5T B;  3B6G B;  3AZF A;  1AOI D;  3MVD A;  2ARO A;  4Z5T C;  1M19 A;  3EPK A;  3AYW B;  3B6G C;  4NFT A;  1P3O D;  3A6N C;  2Y2I A;  3AZK C;  2F8N H;  3UTB A;  5GT0 C;  3TU4 C;  2Y2L A;  3H0R C;  4KHA A;  4YS3 A;  1M18 A;  5B33 D;  5B31 G;  2JE5 A;  4UPK A;  4Z5T D;  4R8P B;  3B6G D;  3LZ1 A;  2YFW B;  4R8P C;  3X1V A;  1M18 B;  1ID3 B;  3W98 A;  3A6N D;  5B2J D;  4WU8 B;  3AZK D;  1S32 B;  4NE6 A;  1TZY B;  5JA4 A;  1M18 C;  5GT0 D;  3TU4 D;  4QLC A;  4WU8 C;  1S32 C;  1TZY C;  5AV6 A;  1WWI A;  5AV5 B;  4H9N B;  3LEL A;  3AZF D;  3AV1 B;  3W96 B;  4LD9 A;  1F1E A;  1P3M A;  3REI A;  3LZ1 C;  5AV5 C;  4E45 A;  1TAF B;  2IO5 B;  3KWQ B;  3EPL A;  3C1B B;  3VH5 A;  3W98 C;  4R8P D;  1N1J A;  3C1B C;  2Y2J A;  3B6F A;  2F8N A;  3REH B;  4QLC C;  1M18 D;  5CPJ A;  5AV8 B;  5AV6 C;  3KUY B;  2W8S A;  4Z66 B;  4WU8 D;  1S32 D;  4LD9 C;  1TZY D;  3V9R A;  3MGP A;  1M1A A;  3VH6 A;  3AZI A;  3KUY C;  4Z66 C;  3LZ1 D;  5AV5 D;  1KU5 A;  1JFI B;  5B0Y A;  5CPJ B;  4AWL B;  5AY8 B;  4JJN B;  2RIQ A;  1P3L B;  3B6F C;  3W98 D;  3REJ A;  3C1B D;  5B40 B;  1M1A B;  5CPJ C;  4AWL C;  5AY8 C;  4JJN C;  3UTA A;  1P3L C;  4QLC D;  2NZD B;  5AV6 D;  3MGP C;  1M1A C;  3WKJ A;  3MNN A;  4LD9 D;  2NZD C;  1P34 B;  1P3K B;  3KUY D;  4Z66 D;  3KXB A;  1BFM A;  4WV4 B;  1P34 C;  3NQU B;  3UTA B;  3REL A;  3W99 B;  3REJ C;  1P3A A;  4H9O B;  3B6F D;  3B0D B;  5AVB B;  1PZR A;  5B31 A;  3MGQ A;  3UTA C;  2F8N D;  3W99 C;  5CPJ D;  5AY8 D;  1P3L D;  3B0D C;  2Y2K A;  5AVB C;  3AZM A;  3REK B;  4YM6 B;  3MGP D;  1M1A D;  3W97 A;  4X23 B;  2NZD D;  1BH9 B;  5CHL B;  3AV2 A;  5CPK B;  1U35 B;  3REK C;  2HIO A;  5B1L B;  4X23 C;  1P34 D;  1P3I B;  1HQ3 A;  3LZ0 A;  3A1K A;  5CPK C;  1U35 C;  5BS7 A;  3REJ D;  5B1L C;  3AZH B;  1P3I C;  4XUJ A;  3UTA D;  1H3O B;  1AOI A;  3AZE B;  4WNN B;  2XD5 A;  5GSU A;  4KUD A;  5AVB D;  5AV9 B;  3AZE C;  1BH8 B;  3EPH A;  5AV9 C;  2HIO C;  5B32 B;  3REK D;  1HQ3 C;  2PYO B;  4X23 D;  5CPK D;  1U35 D;  5C3I B;  2PYO C;  4KUD B;  5B1L D;  4XUJ C;  5B31 D;  1P3I D;  5C3I C;  5GSU C;  4KUD C;  3AZM D;  3B6G A;  3IP4 C;  5KDM B;  3AV2 D;  5FUG B; 
#chains in the Genus database with same CATH homology
 3AYW A;  5AV9 D;  2HIO D;  1HQ3 D;  4J8U B;  3X1T B;  2DQN C;  2FJ7 B;  2PYO D;  4XUJ D;  3X1T C;  5GSU D;  4KUD D;  5B24 B;  2XD1 A;  3AYW C;  4R8P A;  3WA9 B;  2YFW A;  5B1M B;  3C1C B;  3O62 B;  3AFA B;  3A1I A;  1ID3 A;  3WA9 C;  5GXQ B;  4WU8 A;  3UT9 B;  1P3P B;  3C1C C;  1S32 A;  1TZY A;  3O62 C;  3AFA C;  1KX3 B;  3AL0 C;  3X1T D;  5GXQ C;  1KX3 C;  3UT9 C;  1P3P C;  1R4V A;  5AV5 A;  3P5J B;  2Y2M A;  4H9N A;  3W96 A;  3AV1 A;  3B0B A;  2CV5 B;  3AYW D;  1TAF A;  3KWQ A;  4NE3 A;  3C1B A;  2CV5 C;  1F66 A;  1P3F B;  1ID3 C;  3LJA B;  5B32 G;  5CPI B;  3WA9 D;  3WTP B;  1P3F C;  3C1C D;  3REH A;  3O62 D;  4HGA B;  3AFA D;  5CPI C;  4CSR B;  2NQB A;  5F99 B;  5AV8 A;  5GXQ D;  4DRB A;  3W96 C;  5BO0 B;  4CAY B;  2Y2G A;  4Z66 A;  3KUY A;  3AV1 C;  1P3P D;  1KX3 D;  4KGC B;  1F66 B;  3KWQ C;  2IO5 C;  4KGC C;  1F66 C;  1JFI A;  2CV5 D;  2NQB B;  5JRG B;  1ID3 D;  5AY8 A;  4JJN A;  1P3L A;  3KSY A;  5B40 A;  3X1U B;  3REH C;  2NQB C;  5JRG C;  1P3F D;  5AV8 C;  3F6T A;  2NZD A;  5CPI D;  4Z2M G;  3X1U C;  2YFV B;  3AV1 D;  3W96 D;  1P34 A;  1P3K A;  2Y2N A;  3H0M C;  3KWQ D;  4KGC D;  1F66 D;  3NQU A;  3W99 A;  5B40 C;  5B2I B;  4H9O A;  4ZBJ B;  5AVB A;  3REH D;  4UUZ B;  2NQB D;  5JRG D;  5AV8 D;  4ZBJ C;  3NQJ B;  2G5H C;  3X1U D;  3REK A;  4YM6 A;  1P3K C;  4X23 A;  3WAA B;  1BH9 A;  5CPK A;  1U35 A;  2L5A A;  5B1L A;  3EPJ A;  3WAA C;  1P3I A;  4XZQ A;  4J8V B;  1ZLA B;  4JJN D;  3R45 B;  4Z2M H;  5BNX B;  3H0L C;  3AZH A;  4EO5 B;  5B40 D;  3X1S B;  4J8V C;  1H3O A;  3AZE A;  4EO5 C;  2BYM B;  4WNN A;  5B0Z B;  3AZJ B;  4YM6 C;  3X1S C;  5AV9 A;  4M6B A;  4XZQ B;  5DNM B;  1P3K D;  3AZN B;  3AZJ C;  1BH8 A;  1KX5 B;  5CP6 B;  2HUE B;  5B32 A;  3AZG B;  4XZQ C;  5DNM C;  2PYO A;  1P3G A;  5CP6 C;  2HUE C;  3AZL B;  3W99 D;  3WAA D;  3AZG C;  3AZH C;  1P3B B;  3KFU G;  3MGS B;  4J8V D;  3MGS C;  2UWX A;  3X1S D;  4ZUX B;  4J8X B;  4YM6 D;  1P3G B;  1EQZ B;  5KDM A;  4WZS B;  1HTA A;  1A7W A;  5B32 C;  5FUG A;  3AZJ D;  4ZUX C;  4J8X C;  1P3G C;  1EQZ C;  4XZQ D;  2VQR A;  4J8U A;  5CP6 D;  3X1T A;  1KX4 B;  2DF4 C;  3AZG D;  3AZH D;  2FJ7 A;  5GT3 B;  3AZE D;  1KX4 C;  3MGS D;  2Y2Q A;  3B0C T;  5GT3 C;  5B24 A;  4WJ3 C;  4DQY B;  3B0C W;  4G92 B;  5B32 D;  4J8X D;  3WA9 A;  1P3G D;  1EQZ D;  3WTP E;  4J8U C;  2ZY2 A;  1WWS A;  5B1M A;  3O62 A;  3C1C A;  3AFA A;  4G92 C;  2FJ7 C;  5GXQ A;  1KX3 A;  3UT9 A;  1P3P A;  2FFF B;  5DNN B;  1P3O B;  4H9Q B;  3VH5 T;  1KX4 D;  4H9R B;  5B24 C;  5E5A B;  5BNV B;  5DNN C;  1P3O C;  3VH5 W;  2CV5 A;  2ZY4 A;  4H9S A;  4WU9 B;  5G49 B;  5E5A C;  5B33 B;  1Z2C B;  5B1M C;  4WU9 C;  4J8U D;  1P3F A;  3VH6 T;  3LJA A;  5B33 C;  5CPI A;  2FJ7 D;  3WTP A;  3VH6 W;  2JSS A;  4CSR A;  2Y2H A;  5F99 A;  3MGR B;  3A6N B;  5B2J B;  5BO0 A;  4CAY A;  3AZK B;  4KGC A;  5B24 D;  4H9S C;  1B67 A;  2ZY5 A;  5GT0 B;  5DNN D;  3MGR C;  5B2J C;  3TU4 B;  3FDD A;  5E5A D;  3AZF B;  3MVD B;  2ARO B;  5B1M D;  3LJA C;  1M19 B;  4WU9 D;  5JRG A;  3AZF C;  3WTP C;  3MVD C;  2ARO C;  3UT9 D;  1M19 C;  3X1U A;  4HGA C;  5F99 C;  5AVC A;  2YFV A;  3UTB B;  3AN2 A;  4J8W A;  4KHA B;  4YS3 B;  3MGR D;  3UTB C;  4YS3 C;  3LJA D;  5AVC B;  3LZ1 B;  5B2I A;  3AN2 B;  4J8W B;  3WTP D;  3MVD D;  2ARO D;  1M19 D;  3X1V B;  4UUZ A;  5AVC C;  2J8P A;  3W98 B;  5F99 D;  2LY8 A;  3AN2 C;  4J8W C;  3NQJ A;  3X1V C;  5JA4 B;  4QLC B;  3WAA A;  2BYK A;  5AV6 B;  3LEL B;  3UTB D;  4LD9 B;  1ZLA A;  1P3M B;  4J8V A;  3REI B;  4YS3 D;  3LEL C;  5B2I C;  3R45 A;  5BNX A;  2F2A C;  3X1S A;  3REI C;  1P3M C;  5AVC D;  2BYK B;  1N1J B;  2BYM A;  5B0Z A;  1ULY A;  3AZJ A;  4J8W D;  3AN2 D;  3B6F B;  2F8N B;  3X1V D;  3EG5 B;  2F8N K;  5DNM A;  3AZN A;  1KX5 A;  5CP6 A;  3V9R B;  3AZG A;  1ZLA C;  3MGP B;  3AZI B;  2BG1 A;  3AZL A;  3LEL D;  5B2I D;  1P3B A;  3MGS A;  3AZI C;  1T3U A;  1P3M D;  3REI D;  4H9P A;  5B0Y B;  5B0Z C;  2JCH A;  3REJ B;  4G91 B;  4ZUX A;  4J8X A;  5B0Y C;  1EQZ A;  3AZN C;  1KX5 C;  4G91 C;  2RVQ C;  3WKJ B;  3MNN B;  1ZLA D;  3AZL C;  4H9P B;  1P3B C;  2Y2O A;  3WKJ C;  3MNN C;  3KXB B;  1KX4 A;  3AZI D;  3REL B;  5GT3 A;  3KXB C;  1P3A B;  5B0Z D;  3MGQ B;  5B31 B;  3REL C;  5B0Y D;  5DNM D;  1P3A C;  3AZN D;  4NE5 A;  1KX5 D;  4DRA A;  3MGQ C;  5B31 C;  3AZM B;  2RVQ D;  3W97 B;  3AZL D;  3AV2 B;  3AZM C;  1P3B D;  2ZY3 A;  2ZM5 A;  3WKJ D;  3MNN D;  2HIO B;  3W97 C;  1B6W A;  3AV2 C;  1HQ3 B;  3LZ0 B;  2Y2P A;  5BT1 C;  5DNN A;  1W2E A;  4H9Q A;  1P3O A;  3KXB D;  4E44 A;  4ZUX D;  3LZ0 C;  4H9R A;  5E5A A;  4XUJ B;  5BS7 C;  5BNV A;  3REL D;  1AOI B;  1P3A D;  4WU9 A;  5GSU B;  5G49 A;  3MGQ D;  5B33 A;  2F8N G;  1Q9C A;  1AOI C;  4Z5T A;  2CWE A;  3W97 D;  5GT3 D;  5BT1 D;  3MGR A;  3A6N A;  2G5I C;  5B2J A;  3AZK A;  3LZ0 D;  5GT0 A;  3TU4 A;  4Z5T B;  3B6G B;  3AZF A;  1AOI D;  3MVD A;  2ARO A;  4Z5T C;  1M19 A;  3EPK A;  3AYW B;  3B6G C;  4NFT A;  1P3O D;  3A6N C;  2Y2I A;  3AZK C;  2F8N H;  3UTB A;  5GT0 C;  3TU4 C;  2Y2L A;  3H0R C;  4KHA A;  4YS3 A;  1M18 A;  5B33 D;  5B31 G;  2JE5 A;  4UPK A;  4Z5T D;  4R8P B;  3B6G D;  3LZ1 A;  2YFW B;  4R8P C;  3X1V A;  1M18 B;  1ID3 B;  3W98 A;  3A6N D;  5B2J D;  4WU8 B;  3AZK D;  1S32 B;  4NE6 A;  1TZY B;  5JA4 A;  1M18 C;  5GT0 D;  3TU4 D;  4QLC A;  4WU8 C;  1S32 C;  1TZY C;  5AV6 A;  1WWI A;  5AV5 B;  4H9N B;  3LEL A;  3AZF D;  3AV1 B;  3W96 B;  4LD9 A;  1F1E A;  1P3M A;  3REI A;  3LZ1 C;  5AV5 C;  4E45 A;  1TAF B;  2IO5 B;  3KWQ B;  3EPL A;  3C1B B;  3VH5 A;  3W98 C;  4R8P D;  1N1J A;  3C1B C;  2Y2J A;  3B6F A;  2F8N A;  3REH B;  4QLC C;  1M18 D;  5CPJ A;  5AV8 B;  5AV6 C;  3KUY B;  2W8S A;  4Z66 B;  4WU8 D;  1S32 D;  4LD9 C;  1TZY D;  3V9R A;  3MGP A;  1M1A A;  3VH6 A;  3AZI A;  3KUY C;  4Z66 C;  3LZ1 D;  5AV5 D;  1KU5 A;  1JFI B;  5B0Y A;  5CPJ B;  4AWL B;  5AY8 B;  4JJN B;  2RIQ A;  1P3L B;  3B6F C;  3W98 D;  3REJ A;  3C1B D;  5B40 B;  1M1A B;  5CPJ C;  4AWL C;  5AY8 C;  4JJN C;  3UTA A;  1P3L C;  4QLC D;  2NZD B;  5AV6 D;  3MGP C;  1M1A C;  3WKJ A;  3MNN A;  4LD9 D;  2NZD C;  1P34 B;  1P3K B;  3KUY D;  4Z66 D;  3KXB A;  1BFM A;  4WV4 B;  1P34 C;  3NQU B;  3UTA B;  3REL A;  3W99 B;  3REJ C;  1P3A A;  4H9O B;  3B6F D;  3B0D B;  5AVB B;  1PZR A;  5B31 A;  3MGQ A;  3UTA C;  2F8N D;  3W99 C;  5CPJ D;  5AY8 D;  1P3L D;  3B0D C;  2Y2K A;  5AVB C;  3AZM A;  3REK B;  4YM6 B;  3MGP D;  1M1A D;  3W97 A;  4X23 B;  2NZD D;  1BH9 B;  5CHL B;  3AV2 A;  5CPK B;  1U35 B;  3REK C;  2HIO A;  5B1L B;  4X23 C;  1P34 D;  1P3I B;  1HQ3 A;  3LZ0 A;  3A1K A;  5CPK C;  1U35 C;  5BS7 A;  3REJ D;  5B1L C;  3AZH B;  1P3I C;  4XUJ A;  3UTA D;  1H3O B;  1AOI A;  3AZE B;  4WNN B;  2XD5 A;  5GSU A;  4KUD A;  5AVB D;  5AV9 B;  3AZE C;  1BH8 B;  3EPH A;  5AV9 C;  2HIO C;  5B32 B;  3REK D;  1HQ3 C;  2PYO B;  4X23 D;  5CPK D;  1U35 D;  5C3I B;  2PYO C;  4KUD B;  5B1L D;  4XUJ C;  5B31 D;  1P3I D;  5C3I C;  5GSU C;  4KUD C;  3AZM D;  3B6G A;  3IP4 C;  5KDM B;  3AV2 D;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...