1M1AB

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aB00
5F99B 5B24A 3MNNC 5GXQB 4ZBJC 4DRAA 1B6WA 2LY8A 1S32A 1B67A 3RELC 5DNNB 3O62C 3TU4B 5B2IC 3AFAB 3W98A 4E44A 4DRBA 3W99C 1P3OD 3MVDC 3AZFB 1KX5C 2HUEC 3X1TB 2JSSA 5JRGD 5B31B 4J8WB 4J8VA 4ZUXB 3UTBB 4H9SC 3B0DB 4Z2MG 2CWEA 1M1AD 4CAYB 5CPIB 1P3IB 3W98C 3AZGC 3UT9D 3WKJD 1P3OA 4Z5TD 3AZIB 5CPKD 4H9RA 3W96B 5B33B 2NQBA 4J8UA 3KWQD 2RVQD 2PYOD 1P3AB 4UUZA 2FJ7A 5AVCA 1KX4D 4XZQA 3B0BA 3C1BA 3AZND 1A7WA 3WA9B 2BYKA 4QLCB 3MGPA 1P3GB 3NQJA 4H9PA 4X23B 1M1AA 3X1UA 3TU4D 5GT3B 3NQUB 4JJNA 5CPKA 5KDMA 5DNMD 1P3OC 3KWQA 1EQZA 3MNNB 5AV5B 5BNXA 5JRGC 4ZBJB 3KUYA 2FJ7C 5AVCC 3C1CB 3RELB 3AZNA 3REID 4XUJD 5B2IB 4KHAB 1P34D 2YFVA 3AZJD 3W99B 1M1AC 1M19D 3UT9C 3WTPD 3WKJC 4Z5TC 3MVDB 5CPKC 1KX5B 4WV4B 3AZID 3KWQC 2HUEB 2RVQC 2PYOC 5B33D 3AZLD 3X1VA 1KX4C 3REIA 4XUJA 3AZNC 3AZJA 1M19A 3KXBD 3W98B 3TU4C 3WTPA 2CV5D 5DNMC 3UTAD 4YS3A 4J8VB 5AV5D 3C1CD 3REIC 4XUJC 3REHA 1P34C 1BH8A 3AZJC 1TZYD 1M19C 4R8PD 3B0CW 4NE5A 3WTPC 1P3OB 3X1SD 1HTAA 3UTAA 4H9RB 3V9RA 3WAAA 3AZIC 3R45A 5B31G 5JRGB 5B33C 2F8NA 4YM6A 5B0YD 4UUZB 2BYMB 5AVCB 2FJ7B 3AZLC 5B24D 1S32D 5AV9D 3C1BB 2BYKB 2IO5C 3MGPB 5CP6A 3NQJB 4H9PB 1M1AB 3KXBC 4R8PA 1Q9CA 3WKJB 2CV5C 3X1SA 5CPKB 5KDMB 3KWQB 5AV6D 3MGRD 3UTAC 2PYOB 3VH5W 3AV1D 5CPJA 5B0YA 3MGQD 1KX4B 5AV5C 4J8VD 5AV9A 4H9NB 3C1CC 3AZNB 1U35D 4G92C 2YFVB 3AZMA 3VH6W 4Z66D 1TZYC 4R8PC 5E5AD 5B0ZD 4EO5C 3AZHA 5DNMB 5AV6A 3X1SC 3MGRA 3AV1A 5BO0B 3LJAD 3MGQA 1P3FA 2NQBD 4J8UD 5B0YC 4KUDD 2L5AA 5BS7A 5B24C 2FJ7D 5AVCD 1U35A 3REIB 4XUJB 4H9QA 1S32C 1P34B 5AV9C 4XZQD 3AZJB 4Z66A 1M19B 5AVBA 3C1BD 5E5AA 5B0ZA 3MGPD 3WTPB 4WU9D 3X1UD 4WZSB 3LZ1D 3LJAA 5AV6C 4JJND 3MGRC 3AV1C 1EQZD 5B32A 3MGQC 4KUDA 4NE3A 3REJD 3AZLB 3AV2A 1HQ3D 4J8VC 3KUYD 1U35C 2IO5B 3KXBB 1P3KD 1BH8B 4Z66C 4WU9A 2CV5B 2YFWA 5E5AC 5B0ZC 3LZ1A 2F8NH 5JA4A 3UTAB 2NZDA 1P3LA 3WAAB 3LJAC 3R45B 3AZED 2F8NB 3REJA 2NQBC 5B2JA 4YM6B 4J8UC 1HQ3A 1F66A 5B1LA 4AWLC 4KUDC 1M18A 3B0CT 3W97D 3X1VD 4G92B 1BFMA 4XZQC 1P3KA 1JFIA 1TZYB 3C1BC 4R8PB 3MGPC 4EO5B 4WU9C 1ID3A 3X1UC 3X1SB 5AV8A 3LZ1C 3VH5A 4JJNC 3AZEA 5CPJB 5B0YB 5BNVA 1EQZC 3KSYA 3REJC 4YS3D 1ZLAD 3B6FA 1HQ3C 5B24B 3W97A 1F1EA 1S32B 5AV9B 3KUYC 3A6ND 1N1JA 5GT0D 2HIOA 3VH6A 5C3IC 1P3KC 3VH5T 3REHD 5AV6B 3MGRB 3AV1B 3MGQB 3AZEC 5B1MD 3WAAD 4WU8D 1ZLAA 2F8ND 3VH6T 5FUGA 4YM6D 1WWSA 1WWIA 1P3MD 3W97C 4WNNA 3X1VC 3A6NA 1U35B 5GT0A 3X1TA 4Z66B 5E5AB 5B0ZB 5CP6D 4CAYA 3LJAB 5CPIA 1AOIA 2NQBB 5AY8D 5B1MA 4J8UB 4WU8A 1P3BD 4AWLB 4NFTA 4KUDB 5CPJD 4YS3C 1ZLAC 1P3MA 5B40A 3B6GD 4LD9D 4XZQB 4E45A 3A6NC 5GT0C 1TAFA 4CSRA 3REHC 5GSUD 2YFWB 4WU9B 3X1UB 3AZMD 3LZ1B 4QLCA 4X23A 4JJNB 5JA4B 3AZHD 5AY8A 1EQZB 1P3BA 3MGSA 3REJB 5B1MC 3WAAC 1P3PA 4WU8C 1HQ3B 5B1LB 1P3FD 5BNXB 4YM6C 4G91C 3B6GA 4LD9A 3KUYB 1P3MC 1H3OA 5C3IB 1P3KB 1JFIB 5GSUA 2AROD 3O62A 5CP6C 5AVBD 5AV8B 3LZ0D 3AN2D 1KU5A 3LELD 3AZEB 2F8NG 5AY8C 4H9OA 5BNVB 1P3BC 5CPJC 1KX5A 5B32D 3W97B 3X1VB 3AV2D 3B6GC 4LD9C 1N1JB 4J8XD 2HIOB 3AZKD 1R4VA 2AROA 4H9SA 1BH9A 5GSUC 3AZMC 3REKD 3LZ0A 3AN2A 5BT1D 5G49A 3LELA 3AZGA 4NE6A 3AZHC 2NZDD 1P3LD 4YS3B 1ZLAB 2F8NK 1P3FC 5B2JD 5FUGB 1F66D 5B1LD 4WNNB 3A6NB 5BS7C 5GT0B 4J8XA 3AYWD 1M18D 3AZKA 3REHB 4KGCD 3REKA 2AROC 5AVBC 3LZ0C 3AN2C 1ID3D 3LELC 5AV8D 1AOIB 3V9RB 5B1MB 4WU8B 1KX3D 4G91B 5B32C 1P3MB 3AYWA 5B40B 3AV2C 5JRGA 3B6FD 5F99D 2BYMA 4J8XC 1TAFB 3AZKC 4KGCA 5GXQD 4CSRB 2HIOD 5CHLB 5CP6B 3REKC 5BT1C 5DNND 5AY8B 3UT9A 3WKJA 5B32G 3AFAD 1P3BB 1KX3A 2NZDC 4Z5TA 3MGSB 1P3LC 1P3PB 4HGAC 5B2JC 2PYOA 3B6GB 1F66C 4LD9B 5B1LC 5F99A 3AYWC 3AZFD 1M18C 1KX4A 1H3OB 3X1TD 5GXQA 5B31D 5GSUB 4J8WD 3AZMB 4KGCC 4ZUXD 4H9NA 3O62B 4Z2MH 3UTBD 5DNNA 3AZHB 3TU4A 1ID3C 3AFAA 5AV8C 4M6BA 4H9OB 5CPID 5DNMA 1P3ID 1AOID 1P3FB 1KX3C 5BO0A 3AZFA 3B6FC 3W96D 5B40D 5F99C 5B31A 4H9QB 4J8WA 1P3AD 4ZUXA 2AROB 5GXQC 2HIOC 5AVBB 1BH9B 1ULYA 1P34A 3UTBA 3LZ0B 3AN2B 5G49B 3LELB 5DNNC 3AZGB 3WA9D 4QLCD 1P3GD 4X23D 1P3IA 3AFAC 5GT3D 5B32B 3MGSD 3AZIA 3AV2B 3W96A 5B33A 1P3PD 4J8XB 3AZFC 3AZLA 1P3AA 3AZKB 3MNND 3X1TC 5B31C 4J8WC 3REKB 4ZUXC 3RELD 3KXBA 3O62D 3UTBC 3WA9A 1P3GA 3B0DC 5B2ID 2CV5A 2NZDB 1P3LB 3W99D 5GT3A 4HGAB 3NQUA 5CPIC 1P3IC 1AOIC 5B2JB 1F66B 3MVDD 1M18B 3AYWB 3W96C 1KX5D 3MNNA 5AV5A 5B40C 1P3AC 4KGCB 3C1CA 3RELA 3WTPE 5B2IA 4KHAA 1ID3B 1TZYA 3W99A 4QLCC 3UT9B 1P3GC 3WA9C 4X23C 3W98D 3AZGD 1KX3B 4Z5TB 5GT3C 3MGSC 3MVDA 1P3PC 3B6FB
chains in the Genus database with same CATH superfamily
5F99B 5B24A 3MNNC 5GXQB 4ZBJC 4DRAA 1B6WA 2LY8A 1S32A 1B67A 3RELC 5DNNB 3O62C 3TU4B 5B2IC 3AFAB 3W98A 4E44A 3A1IA 4DRBA 3W99C 2ZY3A 3A1KA 1P3OD 2Y2GA 3MVDC 3AZFB 1KX5C 2HUEC 3X1TB 2JSSA 5JRGD 5B31B 4J8WB 4J8VA 4ZUXB 3UTBB 4H9SC 3B0DB 4Z2MG 3FDDA 2CWEA 1M1AD 4CAYB 5CPIB 1P3IB 3W98C 3AZGC 3UT9D 3WKJD 1P3OA 4Z5TD 3AZIB 5CPKD 4H9RA 3W96B 5B33B 2NQBA 4J8UA 3KWQD 2RVQD 2PYOD 1P3AB 4UUZA 2FJ7A 5AVCA 1KX4D 4XZQA 3B0BA 3EPJA 3C1BA 3EPKA 1A7WA 2XD1A 3AZND 2BYKA 4QLCB 3MGPA 1P3GB 3NQJA 4H9PA 4X23B 1M1AA 3WA9B 3X1UA 3TU4D 5GT3B 3NQUB 4JJNA 5CPKA 5KDMA 5DNMD 1P3OC 3KWQA 1EQZA 3MNNB 5AV5B 5BNXA 5JRGC 4ZBJB 3KUYA 2FJ7C 5AVCC 3C1CB 3RELB 2Y2LA 3AZNA 3REID 4XUJD 5B2IB 4KHAB 1P34D 2YFVA 3AZJD 3W99B 1M1AC 1M19D 3UT9C 3WTPD 3WKJC 2XD5A 4Z5TC 3MVDB 5CPKC 1KX5B 4WV4B 3AZID 3KWQC 2HUEB 2RVQC 2PYOC 5B33D 3AZLD 3X1VA 1KX4C 3REIA 4XUJA 2Y2JA 3AZNC 3AZJA 1M19A 3KXBD 3W98B 3TU4C 3WTPA 2CV5D 2F2AC 2ZY2A 5DNMC 2Y2IA 3UTAD 4YS3A 4J8VB 5AV5D 3C1CD 3REIC 4XUJC 3REHA 1P34C 1BH8A 3AZJC 1TZYD 1M19C 4R8PD 3B0CW 4NE5A 3WTPC 1P3OB 3X1SD 1HTAA 3UTAA 2ZY5A 4H9RB 3V9RA 3WAAA 3AZIC 3R45A 5B31G 5JRGB 5B33C 2F8NA 4YM6A 5B0YD 4UUZB 2BYMB 5AVCB 2FJ7B 3AZLC 5B24D 1S32D 5AV9D 3C1BB 2BYKB 2IO5C 3MGPB 5CP6A 3NQJB 4H9PB 1M1AB 3KXBC 4R8PA 1Q9CA 3WKJB 2CV5C 3X1SA 5CPKB 5KDMB 3KWQB 5AV6D 3MGRD 3UTAC 2PYOB 2G5IC 3VH5W 3AV1D 5CPJA 5B0YA 3MGQD 1KX4B 5AV5C 4J8VD 5AV9A 4H9NB 3C1CC 4DQYB 3AZNB 4G92C 1U35D 2YFVB 3AZMA 3VH6W 4Z66D 1TZYC 4R8PC 5E5AD 5B0ZD 4EO5C 3AZHA 3H0MC 5DNMB 2BG1A 5AV6A 3X1SC 3MGRA 3AV1A 5BO0B 3LJAD 3MGQA 1P3FA 2NQBD 4J8UD 5B0YC 4KUDD 2Y2MA 2L5AA 5BS7A 5B24C 2FJ7D 5AVCD 1U35A 3REIB 4XUJB 4H9QA 1S32C 1P34B 5AV9C 4XZQD 3AZJB 4Z66A 1M19B 5AVBA 3C1BD 3EG5B 5E5AA 5B0ZA 3MGPD 3WTPB 4WU9D 3X1UD 3H0RC 4WZSB 3LZ1D 3LJAA 5AV6C 4JJND 3MGRC 3AV1C 1EQZD 5B32A 3MGQC 4KUDA 4NE3A 3REJD 3AZLB 3AV2A 1HQ3D 4J8VC 3KUYD 1U35C 2IO5B 1T3UA 3KXBB 1P3KD 1BH8B 4Z66C 4WU9A 2CV5B 2YFWA 5E5AC 5B0ZC 3LZ1A 2F8NH 5JA4A 3UTAB 2NZDA 2J8PA 1P3LA 3WAAB 3LJAC 3R45B 3AZED 2F8NB 3REJA 2NQBC 5B2JA 4YM6B 4J8UC 1HQ3A 1F66A 5B1LA 4AWLC 4KUDC 1M18A 3B0CT 3W97D 3X1VD 4G92B 1BFMA 4XZQC 1P3KA 3P5JB 1JFIA 1TZYB 3C1BC 4R8PB 3MGPC 4EO5B 4WU9C 2W8SA 1ID3A 3X1UC 3X1SB 5AV8A 3LZ1C 3VH5A 4JJNC 3AZEA 5CPJB 5BNVA 5B0YB 1EQZC 3KSYA 3REJC 4YS3D 1ZLAD 3B6FA 1HQ3C 5B24B 3W97A 1F1EA 1S32B 5AV9B 3KUYC 3A6ND 1N1JA 5GT0D 2HIOA 3VH6A 5C3IC 1P3KC 3VH5T 3REHD 5AV6B 3MGRB 3AV1B 3MGQB 3AZEC 5B1MD 3WAAD 4WU8D 1ZLAA 2F8ND 3VH6T 5FUGA 4YM6D 1WWSA 1WWIA 1P3MD 3W97C 4WNNA 3X1VC 3A6NA 3F6TA 5GT0A 3X1TA 1U35B 2VQRA 4Z66B 5E5AB 5B0ZB 5CP6D 4CAYA 3LJAB 5CPIA 1AOIA 2NQBB 5AY8D 5B1MA 4J8UB 4WU8A 1P3BD 4AWLB 4NFTA 4KUDB 5CPJD 4YS3C 1ZLAC 1P3MA 2G5HC 5B40A 3B6GD 4LD9D 1Z2CB 4XZQB 4E45A 3A6NC 5GT0C 1TAFA 2Y2QA 4CSRA 3REHC 5GSUD 2YFWB 4WU9B 3X1UB 3AZMD 2Y2OA 3LZ1B 4QLCA 4X23A 4JJNB 5JA4B 3AZHD 5AY8A 1EQZB 1P3BA 3MGSA 3REJB 5B1MC 3WAAC 1P3PA 4WU8C 1HQ3B 5B1LB 1P3FD 5BNXB 4YM6C 4G91C 3H0LC 3B6GA 4LD9A 3KUYB 1P3MC 1H3OA 5C3IB 1P3KB 1JFIB 5GSUA 2Y2HA 2AROD 3O62A 5CP6C 5AVBD 5AV8B 3LZ0D 3AN2D 1KU5A 3LELD 3AZEB 2F8NG 5AY8C 4H9OA 5BNVB 1P3BC 5CPJC 1KX5A 5B32D 3W97B 3X1VB 3AV2D 3B6GC 4LD9C 1N1JB 4J8XD 2HIOB 2Y2KA 3AZKD 1R4VA 2AROA 4H9SA 1BH9A 5GSUC 3AZMC 3REKD 3LZ0A 3AN2A 5BT1D 5G49A 3LELA 3AZGA 4NE6A 3AZHC 2NZDD 1P3LD 2DF4C 4YS3B 1ZLAB 2F8NK 1P3FC 5B2JD 5FUGB 1F66D 5B1LD 4UPKA 4WNNB 3A6NB 5BS7C 5GT0B 4J8XA 3AYWD 1M18D 3AZKA 4WJ3C 3REHB 4KGCD 3REKA 2AROC 5AVBC 3LZ0C 3AN2C 1ID3D 3LELC 5AV8D 1AOIB 3V9RB 5B1MB 4WU8B 1KX3D 4G91B 5B32C 1P3MB 3KFUG 3AYWA 5B40B 3AV2C 5JRGA 3B6FD 5F99D 2BYMA 4J8XC 1TAFB 3AZKC 4KGCA 5GXQD 4CSRB 2HIOD 5CHLB 5CP6B 2Y2NA 3EPLA 3REKC 5BT1C 5DNND 5AY8B 3UT9A 1PZRA 3WKJA 5B32G 3AFAD 1P3BB 1KX3A 2NZDC 4Z5TA 3MGSB 1P3LC 1P3PB 4HGAC 2UWXA 5B2JC 2PYOA 3B6GB 1F66C 4LD9B 5B1LC 5F99A 3AYWC 3AZFD 1M18C 1KX4A 1H3OB 3X1TD 5GXQA 5B31D 5GSUB 4J8WD 3AZMB 4KGCC 4ZUXD 4H9NA 3O62B 4Z2MH 3UTBD 5DNNA 3AZHB 3TU4A 1ID3C 3AFAA 5AV8C 4M6BA 4H9OB 5CPID 5DNMA 1P3ID 1AOID 1P3FB 1KX3C 5BO0A 3AZFA 3B6FC 3W96D 5B40D 5F99C 5B31A 4H9QB 4J8WA 1P3AD 4ZUXA 2AROB 5GXQC 2HIOC 5AVBB 1BH9B 1ULYA 1P34A 3UTBA 3LZ0B 3AN2B 5G49B 2ZM5A 3LELB 5DNNC 3AZGB 3WA9D 4QLCD 1P3GD 3EPHA 4X23D 1P3IA 3AFAC 5GT3D 5B32B 3MGSD 3AZIA 3AV2B 3W96A 5B33A 1P3PD 4J8XB 3AZFC 3AZLA 1P3AA 3AZKB 2JE5A 3MNND 3X1TC 5B31C 4J8WC 2JCHA 4ZUXC 3REKB 3RELD 3IP4C 2FFFB 3KXBA 3O62D 3UTBC 3WA9A 1P3GA 3B0DC 5B2ID 2CV5A 1W2EA 2NZDB 1P3LB 3W99D 5GT3A 3AL0C 4HGAB 3NQUA 5CPIC 1P3IC 1AOIC 5B2JB 1F66B 3MVDD 1M18B 3AYWB 3W96C 1KX5D 3MNNA 5AV5A 5B40C 1P3AC 4KGCB 2DQNC 3C1CA 3RELA 3WTPE 5B2IA 4KHAA 1ID3B 1TZYA 2Y2PA 2ZY4A 4QLCC 3UT9B 1P3GC 4X23C 3W99A 3WA9C 3W98D 3AZGD 1KX3B 4Z5TB 5GT3C 3MGSC 3MVDA 1P3PC 3B6FB 2RIQA
chains in the Genus database with same CATH topology
5F99B 5B24A 3MNNC 5GXQB 4ZBJC 4DRAA 1B6WA 2LY8A 1S32A 1B67A 3RELC 5DNNB 3O62C 3TU4B 5B2IC 3AFAB 3W98A 4E44A 3A1IA 4DRBA 3W99C 2ZY3A 3A1KA 1P3OD 2Y2GA 3MVDC 3AZFB 1KX5C 2HUEC 3X1TB 2JSSA 5JRGD 5B31B 4J8WB 4J8VA 4ZUXB 3UTBB 4H9SC 3B0DB 4Z2MG 3FDDA 2CWEA 1M1AD 4CAYB 5CPIB 1P3IB 3W98C 3AZGC 3UT9D 3WKJD 1P3OA 4Z5TD 3AZIB 5CPKD 4H9RA 3W96B 5B33B 2NQBA 4J8UA 3KWQD 2RVQD 2PYOD 1P3AB 4UUZA 2FJ7A 5AVCA 1KX4D 4XZQA 3B0BA 3EPJA 3C1BA 3EPKA 1A7WA 2XD1A 3AZND 2BYKA 4QLCB 3MGPA 1P3GB 3NQJA 4H9PA 4X23B 1M1AA 3WA9B 3X1UA 3TU4D 5GT3B 3NQUB 4JJNA 5CPKA 5KDMA 5DNMD 1P3OC 3KWQA 1EQZA 3MNNB 5AV5B 5BNXA 5JRGC 4ZBJB 3KUYA 2FJ7C 5AVCC 3C1CB 3RELB 2Y2LA 3AZNA 3REID 4XUJD 5B2IB 4KHAB 1P34D 2YFVA 3AZJD 3W99B 1M1AC 1M19D 3UT9C 3WTPD 3WKJC 2XD5A 4Z5TC 3MVDB 5CPKC 1KX5B 4WV4B 3AZID 3KWQC 2HUEB 2RVQC 2PYOC 5B33D 3AZLD 3X1VA 1KX4C 3REIA 4XUJA 2Y2JA 3AZNC 3AZJA 1M19A 3KXBD 3W98B 3TU4C 3WTPA 2CV5D 2F2AC 2ZY2A 5DNMC 2Y2IA 3UTAD 4YS3A 4J8VB 5AV5D 3C1CD 3REIC 4XUJC 3REHA 1P34C 1BH8A 3AZJC 1TZYD 1M19C 4R8PD 3B0CW 4NE5A 3WTPC 1P3OB 3X1SD 1HTAA 3UTAA 2ZY5A 4H9RB 3V9RA 3WAAA 3AZIC 3R45A 5B31G 5JRGB 5B33C 2F8NA 4YM6A 5B0YD 4UUZB 2BYMB 5AVCB 2FJ7B 3AZLC 5B24D 1S32D 5AV9D 3C1BB 2BYKB 2IO5C 3MGPB 5CP6A 3NQJB 4H9PB 1M1AB 3KXBC 4R8PA 1Q9CA 3WKJB 2CV5C 3X1SA 5CPKB 5KDMB 3KWQB 5AV6D 3MGRD 3UTAC 2PYOB 2G5IC 3VH5W 3AV1D 5CPJA 5B0YA 3MGQD 1KX4B 5AV5C 4J8VD 5AV9A 4H9NB 3C1CC 4DQYB 3AZNB 4G92C 1U35D 2YFVB 3AZMA 3VH6W 4Z66D 1TZYC 4R8PC 5E5AD 5B0ZD 4EO5C 3AZHA 3H0MC 5DNMB 2BG1A 5AV6A 3X1SC 3MGRA 3AV1A 5BO0B 3LJAD 3MGQA 1P3FA 2NQBD 4J8UD 5B0YC 4KUDD 2Y2MA 2L5AA 5BS7A 5B24C 2FJ7D 5AVCD 1U35A 3REIB 4XUJB 4H9QA 1S32C 1P34B 5AV9C 4XZQD 3AZJB 4Z66A 1M19B 5AVBA 3C1BD 3EG5B 5E5AA 5B0ZA 3MGPD 3WTPB 4WU9D 3X1UD 3H0RC 4WZSB 3LZ1D 3LJAA 5AV6C 4JJND 3MGRC 3AV1C 1EQZD 5B32A 3MGQC 4KUDA 4NE3A 3REJD 3AZLB 3AV2A 1HQ3D 4J8VC 3KUYD 1U35C 2IO5B 1T3UA 3KXBB 1P3KD 1BH8B 4Z66C 4WU9A 2CV5B 2YFWA 5E5AC 5B0ZC 3LZ1A 2F8NH 5JA4A 3UTAB 2NZDA 2J8PA 1P3LA 3WAAB 3LJAC 3R45B 3AZED 2F8NB 3REJA 2NQBC 5B2JA 4YM6B 4J8UC 1HQ3A 1F66A 5B1LA 4AWLC 4KUDC 1M18A 3B0CT 3W97D 3X1VD 4G92B 1BFMA 4XZQC 1P3KA 3P5JB 1JFIA 1TZYB 3C1BC 4R8PB 3MGPC 4EO5B 4WU9C 2W8SA 1ID3A 3X1UC 3X1SB 5AV8A 3LZ1C 3VH5A 4JJNC 3AZEA 5CPJB 5BNVA 5B0YB 1EQZC 3KSYA 3REJC 4YS3D 1ZLAD 3B6FA 1HQ3C 5B24B 3W97A 1F1EA 1S32B 5AV9B 3KUYC 3A6ND 1N1JA 5GT0D 2HIOA 3VH6A 5C3IC 1P3KC 3VH5T 3REHD 5AV6B 3MGRB 3AV1B 3MGQB 3AZEC 5B1MD 3WAAD 4WU8D 1ZLAA 2F8ND 3VH6T 5FUGA 4YM6D 1WWSA 1WWIA 1P3MD 3W97C 4WNNA 3X1VC 3A6NA 3F6TA 5GT0A 3X1TA 1U35B 2VQRA 4Z66B 5E5AB 5B0ZB 5CP6D 4CAYA 3LJAB 5CPIA 1AOIA 2NQBB 5AY8D 5B1MA 4J8UB 4WU8A 1P3BD 4AWLB 4NFTA 4KUDB 5CPJD 4YS3C 1ZLAC 1P3MA 2G5HC 5B40A 3B6GD 4LD9D 1Z2CB 4XZQB 4E45A 3A6NC 5GT0C 1TAFA 2Y2QA 4CSRA 3REHC 5GSUD 2YFWB 4WU9B 3X1UB 3AZMD 2Y2OA 3LZ1B 4QLCA 4X23A 4JJNB 5JA4B 3AZHD 5AY8A 1EQZB 1P3BA 3MGSA 3REJB 5B1MC 3WAAC 1P3PA 4WU8C 1HQ3B 5B1LB 1P3FD 5BNXB 4YM6C 4G91C 3H0LC 3B6GA 4LD9A 3KUYB 1P3MC 1H3OA 5C3IB 1P3KB 1JFIB 5GSUA 2Y2HA 2AROD 3O62A 5CP6C 5AVBD 5AV8B 3LZ0D 3AN2D 1KU5A 3LELD 3AZEB 2F8NG 5AY8C 4H9OA 5BNVB 1P3BC 5CPJC 1KX5A 5B32D 3W97B 3X1VB 3AV2D 3B6GC 4LD9C 1N1JB 4J8XD 2HIOB 2Y2KA 3AZKD 1R4VA 2AROA 4H9SA 1BH9A 5GSUC 3AZMC 3REKD 3LZ0A 3AN2A 5BT1D 5G49A 3LELA 3AZGA 4NE6A 3AZHC 2NZDD 1P3LD 2DF4C 4YS3B 1ZLAB 2F8NK 1P3FC 5B2JD 5FUGB 1F66D 5B1LD 4UPKA 4WNNB 3A6NB 5BS7C 5GT0B 4J8XA 3AYWD 1M18D 3AZKA 4WJ3C 3REHB 4KGCD 3REKA 2AROC 5AVBC 3LZ0C 3AN2C 1ID3D 3LELC 5AV8D 1AOIB 3V9RB 5B1MB 4WU8B 1KX3D 4G91B 5B32C 1P3MB 3KFUG 3AYWA 5B40B 3AV2C 5JRGA 3B6FD 5F99D 2BYMA 4J8XC 1TAFB 3AZKC 4KGCA 5GXQD 4CSRB 2HIOD 5CHLB 5CP6B 2Y2NA 3EPLA 3REKC 5BT1C 5DNND 5AY8B 3UT9A 1PZRA 3WKJA 5B32G 3AFAD 1P3BB 1KX3A 2NZDC 4Z5TA 3MGSB 1P3LC 1P3PB 4HGAC 2UWXA 5B2JC 2PYOA 3B6GB 1F66C 4LD9B 5B1LC 5F99A 3AYWC 3AZFD 1M18C 1KX4A 1H3OB 3X1TD 5GXQA 5B31D 5GSUB 4J8WD 3AZMB 4KGCC 4ZUXD 4H9NA 3O62B 4Z2MH 3UTBD 5DNNA 3AZHB 3TU4A 1ID3C 3AFAA 5AV8C 4M6BA 4H9OB 5CPID 5DNMA 1P3ID 1AOID 1P3FB 1KX3C 5BO0A 3AZFA 3B6FC 3W96D 5B40D 5F99C 5B31A 4H9QB 4J8WA 1P3AD 4ZUXA 2AROB 5GXQC 2HIOC 5AVBB 1BH9B 1ULYA 1P34A 3UTBA 3LZ0B 3AN2B 5G49B 2ZM5A 3LELB 5DNNC 3AZGB 3WA9D 4QLCD 1P3GD 3EPHA 4X23D 1P3IA 3AFAC 5GT3D 5B32B 3MGSD 3AZIA 3AV2B 3W96A 5B33A 1P3PD 4J8XB 3AZFC 3AZLA 1P3AA 3AZKB 2JE5A 3MNND 3X1TC 5B31C 4J8WC 2JCHA 4ZUXC 3REKB 3RELD 3IP4C 2FFFB 3KXBA 3O62D 3UTBC 3WA9A 1P3GA 3B0DC 5B2ID 2CV5A 1W2EA 2NZDB 1P3LB 3W99D 5GT3A 3AL0C 4HGAB 3NQUA 5CPIC 1P3IC 1AOIC 5B2JB 1F66B 3MVDD 1M18B 3AYWB 3W96C 1KX5D 3MNNA 5AV5A 5B40C 1P3AC 4KGCB 2DQNC 3C1CA 3RELA 3WTPE 5B2IA 4KHAA 1ID3B 1TZYA 2Y2PA 2ZY4A 4QLCC 3UT9B 1P3GC 4X23C 3W99A 3WA9C 3W98D 3AZGD 1KX3B 4Z5TB 5GT3C 3MGSC 3MVDA 1P3PC 3B6FB 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 B;  5B24 A;  3MNN C;  5GXQ B;  4ZBJ C;  4DRA A;  1B6W A;  2LY8 A;  1S32 A;  1B67 A;  3REL C;  5DNN B;  3O62 C;  3TU4 B;  5B2I C;  3AFA B;  3W98 A;  4E44 A;  4DRB A;  3W99 C;  1P3O D;  3MVD C;  3AZF B;  1KX5 C;  2HUE C;  3X1T B;  2JSS A;  5JRG D;  5B31 B;  4J8W B;  4J8V A;  4ZUX B;  3UTB B;  4H9S C;  3B0D B;  4Z2M G;  2CWE A;  1M1A D;  4CAY B;  5CPI B;  1P3I B;  3W98 C;  3AZG C;  3UT9 D;  3WKJ D;  1P3O A;  4Z5T D;  3AZI B;  5CPK D;  4H9R A;  3W96 B;  5B33 B;  2NQB A;  4J8U A;  3KWQ D;  2RVQ D;  2PYO D;  1P3A B;  4UUZ A;  2FJ7 A;  5AVC A;  1KX4 D;  4XZQ A;  3B0B A;  3C1B A;  3AZN D;  1A7W A;  3WA9 B;  2BYK A;  4QLC B;  3MGP A;  1P3G B;  3NQJ A;  4H9P A;  4X23 B;  1M1A A;  3X1U A;  3TU4 D;  5GT3 B;  3NQU B;  4JJN A;  5CPK A;  5KDM A;  5DNM D;  1P3O C;  3KWQ A;  1EQZ A;  3MNN B;  5AV5 B;  5BNX A;  5JRG C;  4ZBJ B;  3KUY A;  2FJ7 C;  5AVC C;  3C1C B;  3REL B;  3AZN A;  3REI D;  4XUJ D;  5B2I B;  4KHA B;  1P34 D;  2YFV A;  3AZJ D;  3W99 B;  1M1A C;  1M19 D;  3UT9 C;  3WTP D;  3WKJ C;  4Z5T C;  3MVD B;  5CPK C;  1KX5 B;  4WV4 B;  3AZI D;  3KWQ C;  2HUE B;  2RVQ C;  2PYO C;  5B33 D;  3AZL D;  3X1V A;  1KX4 C;  3REI A;  4XUJ A;  3AZN C;  3AZJ A;  1M19 A;  3KXB D;  3W98 B;  3TU4 C;  3WTP A;  2CV5 D;  5DNM C;  3UTA D;  4YS3 A;  4J8V B;  5AV5 D;  3C1C D;  3REI C;  4XUJ C;  3REH A;  1P34 C;  1BH8 A;  3AZJ C;  1TZY D;  1M19 C;  4R8P D;  3B0C W;  4NE5 A;  3WTP C;  1P3O B;  3X1S D;  1HTA A;  3UTA A;  4H9R B;  3V9R A;  3WAA A;  3AZI C;  3R45 A;  5B31 G;  5JRG B;  5B33 C;  2F8N A;  4YM6 A;  5B0Y D;  4UUZ B;  2BYM B;  5AVC B;  2FJ7 B;  3AZL C;  5B24 D;  1S32 D;  5AV9 D;  3C1B B;  2BYK B;  2IO5 C;  3MGP B;  5CP6 A;  3NQJ B;  4H9P B;  1M1A B;  3KXB C;  4R8P A;  1Q9C A;  3WKJ B;  2CV5 C;  3X1S A;  5CPK B;  5KDM B;  3KWQ B;  5AV6 D;  3MGR D;  3UTA C;  2PYO B;  3VH5 W;  3AV1 D;  5CPJ A;  5B0Y A;  3MGQ D;  1KX4 B;  5AV5 C;  4J8V D;  5AV9 A;  4H9N B;  3C1C C;  3AZN B;  1U35 D;  4G92 C;  2YFV B;  3AZM A;  3VH6 W;  4Z66 D;  1TZY C;  4R8P C;  5E5A D;  5B0Z D;  4EO5 C;  3AZH A;  5DNM B;  5AV6 A;  3X1S C;  3MGR A;  3AV1 A;  5BO0 B;  3LJA D;  3MGQ A;  1P3F A;  2NQB D;  4J8U D;  5B0Y C;  4KUD D;  2L5A A;  5BS7 A;  5B24 C;  2FJ7 D;  5AVC D;  1U35 A;  3REI B;  4XUJ B;  4H9Q A;  1S32 C;  1P34 B;  5AV9 C;  4XZQ D;  3AZJ B;  4Z66 A;  1M19 B;  5AVB A;  3C1B D;  5E5A A;  5B0Z A;  3MGP D;  3WTP B;  4WU9 D;  3X1U D;  4WZS B;  3LZ1 D;  3LJA A;  5AV6 C;  4JJN D;  3MGR C;  3AV1 C;  1EQZ D;  5B32 A;  3MGQ C;  4KUD A;  4NE3 A;  3REJ D;  3AZL B;  3AV2 A;  1HQ3 D;  4J8V C;  3KUY D;  1U35 C;  2IO5 B;  3KXB B;  1P3K D;  1BH8 B;  4Z66 C;  4WU9 A;  2CV5 B;  2YFW A;  5E5A C;  5B0Z C;  3LZ1 A;  2F8N H;  5JA4 A;  3UTA B;  2NZD A;  1P3L A;  3WAA B;  3LJA C;  3R45 B;  3AZE D;  2F8N B;  3REJ A;  2NQB C;  5B2J A;  4YM6 B;  4J8U C;  1HQ3 A;  1F66 A;  5B1L A;  4AWL C;  4KUD C;  1M18 A;  3B0C T;  3W97 D;  3X1V D;  4G92 B;  1BFM A;  4XZQ C;  1P3K A;  1JFI A;  1TZY B;  3C1B C;  4R8P B;  3MGP C;  4EO5 B;  4WU9 C;  1ID3 A;  3X1U C;  3X1S B;  5AV8 A;  3LZ1 C;  3VH5 A;  4JJN C;  3AZE A;  5CPJ B;  5B0Y B;  5BNV A;  1EQZ C;  3KSY A;  3REJ C;  4YS3 D;  1ZLA D;  3B6F A;  1HQ3 C;  5B24 B;  3W97 A;  1F1E A;  1S32 B;  5AV9 B;  3KUY C;  3A6N D;  1N1J A;  5GT0 D;  2HIO A;  3VH6 A;  5C3I C;  1P3K C;  3VH5 T;  3REH D;  5AV6 B;  3MGR B;  3AV1 B;  3MGQ B;  3AZE C;  5B1M D;  3WAA D;  4WU8 D;  1ZLA A;  2F8N D;  3VH6 T;  5FUG A;  4YM6 D;  1WWS A;  1WWI A;  1P3M D;  3W97 C;  4WNN A;  3X1V C;  3A6N A;  1U35 B;  5GT0 A;  3X1T A;  4Z66 B;  5E5A B;  5B0Z B;  5CP6 D;  4CAY A;  3LJA B;  5CPI A;  1AOI A;  2NQB B;  5AY8 D;  5B1M A;  4J8U B;  4WU8 A;  1P3B D;  4AWL B;  4NFT A;  4KUD B;  5CPJ D;  4YS3 C;  1ZLA C;  1P3M A;  5B40 A;  3B6G D;  4LD9 D;  4XZQ B;  4E45 A;  3A6N C;  5GT0 C;  1TAF A;  4CSR A;  3REH C;  5GSU D;  2YFW B;  4WU9 B;  3X1U B;  3AZM D;  3LZ1 B;  4QLC A;  4X23 A;  4JJN B;  5JA4 B;  3AZH D;  5AY8 A;  1EQZ B;  1P3B A;  3MGS A;  3REJ B;  5B1M C;  3WAA C;  1P3P A;  4WU8 C;  1HQ3 B;  5B1L B;  1P3F D;  5BNX B;  4YM6 C;  4G91 C;  3B6G A;  4LD9 A;  3KUY B;  1P3M C;  1H3O A;  5C3I B;  1P3K B;  1JFI B;  5GSU A;  2ARO D;  3O62 A;  5CP6 C;  5AVB D;  5AV8 B;  3LZ0 D;  3AN2 D;  1KU5 A;  3LEL D;  3AZE B;  2F8N G;  5AY8 C;  4H9O A;  5BNV B;  1P3B C;  5CPJ C;  1KX5 A;  5B32 D;  3W97 B;  3X1V B;  3AV2 D;  3B6G C;  4LD9 C;  1N1J B;  4J8X D;  2HIO B;  3AZK D;  1R4V A;  2ARO A;  4H9S A;  1BH9 A;  5GSU C;  3AZM C;  3REK D;  3LZ0 A;  3AN2 A;  5BT1 D;  5G49 A;  3LEL A;  3AZG A;  4NE6 A;  3AZH C;  2NZD D;  1P3L D;  4YS3 B;  1ZLA B;  2F8N K;  1P3F C;  5B2J D;  5FUG B;  1F66 D;  5B1L D;  4WNN B;  3A6N B;  5BS7 C;  5GT0 B;  4J8X A;  3AYW D;  1M18 D;  3AZK A;  3REH B;  4KGC D;  3REK A;  2ARO C;  5AVB C;  3LZ0 C;  3AN2 C;  1ID3 D;  3LEL C;  5AV8 D;  1AOI B;  3V9R B;  5B1M B;  4WU8 B;  1KX3 D;  4G91 B;  5B32 C;  1P3M B;  3AYW A;  5B40 B;  3AV2 C;  5JRG A;  3B6F D;  5F99 D;  2BYM A;  4J8X C;  1TAF B;  3AZK C;  4KGC A;  5GXQ D;  4CSR B;  2HIO D;  5CHL B;  5CP6 B;  3REK C;  5BT1 C;  5DNN D;  5AY8 B;  3UT9 A;  3WKJ A;  5B32 G;  3AFA D;  1P3B B;  1KX3 A;  2NZD C;  4Z5T A;  3MGS B;  1P3L C;  1P3P B;  4HGA C;  5B2J C;  2PYO A;  3B6G B;  1F66 C;  4LD9 B;  5B1L C;  5F99 A;  3AYW C;  3AZF D;  1M18 C;  1KX4 A;  1H3O B;  3X1T D;  5GXQ A;  5B31 D;  5GSU B;  4J8W D;  3AZM B;  4KGC C;  4ZUX D;  4H9N A;  3O62 B;  4Z2M H;  3UTB D;  5DNN A;  3AZH B;  3TU4 A;  1ID3 C;  3AFA A;  5AV8 C;  4M6B A;  4H9O B;  5CPI D;  5DNM A;  1P3I D;  1AOI D;  1P3F B;  1KX3 C;  5BO0 A;  3AZF A;  3B6F C;  3W96 D;  5B40 D;  5F99 C;  5B31 A;  4H9Q B;  4J8W A;  1P3A D;  4ZUX A;  2ARO B;  5GXQ C;  2HIO C;  5AVB B;  1BH9 B;  1ULY A;  1P34 A;  3UTB A;  3LZ0 B;  3AN2 B;  5G49 B;  3LEL B;  5DNN C;  3AZG B;  3WA9 D;  4QLC D;  1P3G D;  4X23 D;  1P3I A;  3AFA C;  5GT3 D;  5B32 B;  3MGS D;  3AZI A;  3AV2 B;  3W96 A;  5B33 A;  1P3P D;  4J8X B;  3AZF C;  3AZL A;  1P3A A;  3AZK B;  3MNN D;  3X1T C;  5B31 C;  4J8W C;  3REK B;  4ZUX C;  3REL D;  3KXB A;  3O62 D;  3UTB C;  3WA9 A;  1P3G A;  3B0D C;  5B2I D;  2CV5 A;  2NZD B;  1P3L B;  3W99 D;  5GT3 A;  4HGA B;  3NQU A;  5CPI C;  1P3I C;  1AOI C;  5B2J B;  1F66 B;  3MVD D;  1M18 B;  3AYW B;  3W96 C;  1KX5 D;  3MNN A;  5AV5 A;  5B40 C;  1P3A C;  4KGC B;  3C1C A;  3REL A;  3WTP E;  5B2I A;  4KHA A;  1ID3 B;  1TZY A;  3W99 A;  4QLC C;  3UT9 B;  1P3G C;  3WA9 C;  4X23 C;  3W98 D;  3AZG D;  1KX3 B;  4Z5T B;  5GT3 C;  3MGS C;  3MVD A;  1P3P C;  3B6F B; 
#chains in the Genus database with same CATH topology
 5F99 B;  5B24 A;  3MNN C;  5GXQ B;  4ZBJ C;  4DRA A;  1B6W A;  2LY8 A;  1S32 A;  1B67 A;  3REL C;  5DNN B;  3O62 C;  3TU4 B;  5B2I C;  3AFA B;  3W98 A;  4E44 A;  3A1I A;  4DRB A;  3W99 C;  2ZY3 A;  3A1K A;  1P3O D;  2Y2G A;  3MVD C;  3AZF B;  1KX5 C;  2HUE C;  3X1T B;  2JSS A;  5JRG D;  5B31 B;  4J8W B;  4J8V A;  4ZUX B;  3UTB B;  4H9S C;  3B0D B;  4Z2M G;  3FDD A;  2CWE A;  1M1A D;  4CAY B;  5CPI B;  1P3I B;  3W98 C;  3AZG C;  3UT9 D;  3WKJ D;  1P3O A;  4Z5T D;  3AZI B;  5CPK D;  4H9R A;  3W96 B;  5B33 B;  2NQB A;  4J8U A;  3KWQ D;  2RVQ D;  2PYO D;  1P3A B;  4UUZ A;  2FJ7 A;  5AVC A;  1KX4 D;  4XZQ A;  3B0B A;  3EPJ A;  3C1B A;  3EPK A;  1A7W A;  2XD1 A;  3AZN D;  2BYK A;  4QLC B;  3MGP A;  1P3G B;  3NQJ A;  4H9P A;  4X23 B;  1M1A A;  3WA9 B;  3X1U A;  3TU4 D;  5GT3 B;  3NQU B;  4JJN A;  5CPK A;  5KDM A;  5DNM D;  1P3O C;  3KWQ A;  1EQZ A;  3MNN B;  5AV5 B;  5BNX A;  5JRG C;  4ZBJ B;  3KUY A;  2FJ7 C;  5AVC C;  3C1C B;  3REL B;  2Y2L A;  3AZN A;  3REI D;  4XUJ D;  5B2I B;  4KHA B;  1P34 D;  2YFV A;  3AZJ D;  3W99 B;  1M1A C;  1M19 D;  3UT9 C;  3WTP D;  3WKJ C;  2XD5 A;  4Z5T C;  3MVD B;  5CPK C;  1KX5 B;  4WV4 B;  3AZI D;  3KWQ C;  2HUE B;  2RVQ C;  2PYO C;  5B33 D;  3AZL D;  3X1V A;  1KX4 C;  3REI A;  4XUJ A;  2Y2J A;  3AZN C;  3AZJ A;  1M19 A;  3KXB D;  3W98 B;  3TU4 C;  3WTP A;  2CV5 D;  2F2A C;  2ZY2 A;  5DNM C;  2Y2I A;  3UTA D;  4YS3 A;  4J8V B;  5AV5 D;  3C1C D;  3REI C;  4XUJ C;  3REH A;  1P34 C;  1BH8 A;  3AZJ C;  1TZY D;  1M19 C;  4R8P D;  3B0C W;  4NE5 A;  3WTP C;  1P3O B;  3X1S D;  1HTA A;  3UTA A;  2ZY5 A;  4H9R B;  3V9R A;  3WAA A;  3AZI C;  3R45 A;  5B31 G;  5JRG B;  5B33 C;  2F8N A;  4YM6 A;  5B0Y D;  4UUZ B;  2BYM B;  5AVC B;  2FJ7 B;  3AZL C;  5B24 D;  1S32 D;  5AV9 D;  3C1B B;  2BYK B;  2IO5 C;  3MGP B;  5CP6 A;  3NQJ B;  4H9P B;  1M1A B;  3KXB C;  4R8P A;  1Q9C A;  3WKJ B;  2CV5 C;  3X1S A;  5CPK B;  5KDM B;  3KWQ B;  5AV6 D;  3MGR D;  3UTA C;  2PYO B;  2G5I C;  3VH5 W;  3AV1 D;  5CPJ A;  5B0Y A;  3MGQ D;  1KX4 B;  5AV5 C;  4J8V D;  5AV9 A;  4H9N B;  3C1C C;  4DQY B;  3AZN B;  4G92 C;  1U35 D;  2YFV B;  3AZM A;  3VH6 W;  4Z66 D;  1TZY C;  4R8P C;  5E5A D;  5B0Z D;  4EO5 C;  3AZH A;  3H0M C;  5DNM B;  2BG1 A;  5AV6 A;  3X1S C;  3MGR A;  3AV1 A;  5BO0 B;  3LJA D;  3MGQ A;  1P3F A;  2NQB D;  4J8U D;  5B0Y C;  4KUD D;  2Y2M A;  2L5A A;  5BS7 A;  5B24 C;  2FJ7 D;  5AVC D;  1U35 A;  3REI B;  4XUJ B;  4H9Q A;  1S32 C;  1P34 B;  5AV9 C;  4XZQ D;  3AZJ B;  4Z66 A;  1M19 B;  5AVB A;  3C1B D;  3EG5 B;  5E5A A;  5B0Z A;  3MGP D;  3WTP B;  4WU9 D;  3X1U D;  3H0R C;  4WZS B;  3LZ1 D;  3LJA A;  5AV6 C;  4JJN D;  3MGR C;  3AV1 C;  1EQZ D;  5B32 A;  3MGQ C;  4KUD A;  4NE3 A;  3REJ D;  3AZL B;  3AV2 A;  1HQ3 D;  4J8V C;  3KUY D;  1U35 C;  2IO5 B;  1T3U A;  3KXB B;  1P3K D;  1BH8 B;  4Z66 C;  4WU9 A;  2CV5 B;  2YFW A;  5E5A C;  5B0Z C;  3LZ1 A;  2F8N H;  5JA4 A;  3UTA B;  2NZD A;  2J8P A;  1P3L A;  3WAA B;  3LJA C;  3R45 B;  3AZE D;  2F8N B;  3REJ A;  2NQB C;  5B2J A;  4YM6 B;  4J8U C;  1HQ3 A;  1F66 A;  5B1L A;  4AWL C;  4KUD C;  1M18 A;  3B0C T;  3W97 D;  3X1V D;  4G92 B;  1BFM A;  4XZQ C;  1P3K A;  3P5J B;  1JFI A;  1TZY B;  3C1B C;  4R8P B;  3MGP C;  4EO5 B;  4WU9 C;  2W8S A;  1ID3 A;  3X1U C;  3X1S B;  5AV8 A;  3LZ1 C;  3VH5 A;  4JJN C;  3AZE A;  5CPJ B;  5BNV A;  5B0Y B;  1EQZ C;  3KSY A;  3REJ C;  4YS3 D;  1ZLA D;  3B6F A;  1HQ3 C;  5B24 B;  3W97 A;  1F1E A;  1S32 B;  5AV9 B;  3KUY C;  3A6N D;  1N1J A;  5GT0 D;  2HIO A;  3VH6 A;  5C3I C;  1P3K C;  3VH5 T;  3REH D;  5AV6 B;  3MGR B;  3AV1 B;  3MGQ B;  3AZE C;  5B1M D;  3WAA D;  4WU8 D;  1ZLA A;  2F8N D;  3VH6 T;  5FUG A;  4YM6 D;  1WWS A;  1WWI A;  1P3M D;  3W97 C;  4WNN A;  3X1V C;  3A6N A;  3F6T A;  5GT0 A;  3X1T A;  1U35 B;  2VQR A;  4Z66 B;  5E5A B;  5B0Z B;  5CP6 D;  4CAY A;  3LJA B;  5CPI A;  1AOI A;  2NQB B;  5AY8 D;  5B1M A;  4J8U B;  4WU8 A;  1P3B D;  4AWL B;  4NFT A;  4KUD B;  5CPJ D;  4YS3 C;  1ZLA C;  1P3M A;  2G5H C;  5B40 A;  3B6G D;  4LD9 D;  1Z2C B;  4XZQ B;  4E45 A;  3A6N C;  5GT0 C;  1TAF A;  2Y2Q A;  4CSR A;  3REH C;  5GSU D;  2YFW B;  4WU9 B;  3X1U B;  3AZM D;  2Y2O A;  3LZ1 B;  4QLC A;  4X23 A;  4JJN B;  5JA4 B;  3AZH D;  5AY8 A;  1EQZ B;  1P3B A;  3MGS A;  3REJ B;  5B1M C;  3WAA C;  1P3P A;  4WU8 C;  1HQ3 B;  5B1L B;  1P3F D;  5BNX B;  4YM6 C;  4G91 C;  3H0L C;  3B6G A;  4LD9 A;  3KUY B;  1P3M C;  1H3O A;  5C3I B;  1P3K B;  1JFI B;  5GSU A;  2Y2H A;  2ARO D;  3O62 A;  5CP6 C;  5AVB D;  5AV8 B;  3LZ0 D;  3AN2 D;  1KU5 A;  3LEL D;  3AZE B;  2F8N G;  5AY8 C;  4H9O A;  5BNV B;  1P3B C;  5CPJ C;  1KX5 A;  5B32 D;  3W97 B;  3X1V B;  3AV2 D;  3B6G C;  4LD9 C;  1N1J B;  4J8X D;  2HIO B;  2Y2K A;  3AZK D;  1R4V A;  2ARO A;  4H9S A;  1BH9 A;  5GSU C;  3AZM C;  3REK D;  3LZ0 A;  3AN2 A;  5BT1 D;  5G49 A;  3LEL A;  3AZG A;  4NE6 A;  3AZH C;  2NZD D;  1P3L D;  2DF4 C;  4YS3 B;  1ZLA B;  2F8N K;  1P3F C;  5B2J D;  5FUG B;  1F66 D;  5B1L D;  4UPK A;  4WNN B;  3A6N B;  5BS7 C;  5GT0 B;  4J8X A;  3AYW D;  1M18 D;  3AZK A;  4WJ3 C;  3REH B;  4KGC D;  3REK A;  2ARO C;  5AVB C;  3LZ0 C;  3AN2 C;  1ID3 D;  3LEL C;  5AV8 D;  1AOI B;  3V9R B;  5B1M B;  4WU8 B;  1KX3 D;  4G91 B;  5B32 C;  1P3M B;  3KFU G;  3AYW A;  5B40 B;  3AV2 C;  5JRG A;  3B6F D;  5F99 D;  2BYM A;  4J8X C;  1TAF B;  3AZK C;  4KGC A;  5GXQ D;  4CSR B;  2HIO D;  5CHL B;  5CP6 B;  2Y2N A;  3EPL A;  3REK C;  5BT1 C;  5DNN D;  5AY8 B;  3UT9 A;  1PZR A;  3WKJ A;  5B32 G;  3AFA D;  1P3B B;  1KX3 A;  2NZD C;  4Z5T A;  3MGS B;  1P3L C;  1P3P B;  4HGA C;  2UWX A;  5B2J C;  2PYO A;  3B6G B;  1F66 C;  4LD9 B;  5B1L C;  5F99 A;  3AYW C;  3AZF D;  1M18 C;  1KX4 A;  1H3O B;  3X1T D;  5GXQ A;  5B31 D;  5GSU B;  4J8W D;  3AZM B;  4KGC C;  4ZUX D;  4H9N A;  3O62 B;  4Z2M H;  3UTB D;  5DNN A;  3AZH B;  3TU4 A;  1ID3 C;  3AFA A;  5AV8 C;  4M6B A;  4H9O B;  5CPI D;  5DNM A;  1P3I D;  1AOI D;  1P3F B;  1KX3 C;  5BO0 A;  3AZF A;  3B6F C;  3W96 D;  5B40 D;  5F99 C;  5B31 A;  4H9Q B;  4J8W A;  1P3A D;  4ZUX A;  2ARO B;  5GXQ C;  2HIO C;  5AVB B;  1BH9 B;  1ULY A;  1P34 A;  3UTB A;  3LZ0 B;  3AN2 B;  5G49 B;  2ZM5 A;  3LEL B;  5DNN C;  3AZG B;  3WA9 D;  4QLC D;  1P3G D;  3EPH A;  4X23 D;  1P3I A;  3AFA C;  5GT3 D;  5B32 B;  3MGS D;  3AZI A;  3AV2 B;  3W96 A;  5B33 A;  1P3P D;  4J8X B;  3AZF C;  3AZL A;  1P3A A;  3AZK B;  2JE5 A;  3MNN D;  3X1T C;  5B31 C;  4J8W C;  2JCH A;  4ZUX C;  3REK B;  3REL D;  3IP4 C;  2FFF B;  3KXB A;  3O62 D;  3UTB C;  3WA9 A;  1P3G A;  3B0D C;  5B2I D;  2CV5 A;  1W2E A;  2NZD B;  1P3L B;  3W99 D;  5GT3 A;  3AL0 C;  4HGA B;  3NQU A;  5CPI C;  1P3I C;  1AOI C;  5B2J B;  1F66 B;  3MVD D;  1M18 B;  3AYW B;  3W96 C;  1KX5 D;  3MNN A;  5AV5 A;  5B40 C;  1P3A C;  4KGC B;  2DQN C;  3C1C A;  3REL A;  3WTP E;  5B2I A;  4KHA A;  1ID3 B;  1TZY A;  2Y2P A;  2ZY4 A;  4QLC C;  3UT9 B;  1P3G C;  4X23 C;  3W99 A;  3WA9 C;  3W98 D;  3AZG D;  1KX3 B;  4Z5T B;  5GT3 C;  3MGS C;  3MVD A;  1P3P C;  3B6F B;  2RIQ A; 
#chains in the Genus database with same CATH homology
 5F99 B;  5B24 A;  3MNN C;  5GXQ B;  4ZBJ C;  4DRA A;  1B6W A;  2LY8 A;  1S32 A;  1B67 A;  3REL C;  5DNN B;  3O62 C;  3TU4 B;  5B2I C;  3AFA B;  3W98 A;  4E44 A;  3A1I A;  4DRB A;  3W99 C;  2ZY3 A;  3A1K A;  1P3O D;  2Y2G A;  3MVD C;  3AZF B;  1KX5 C;  2HUE C;  3X1T B;  2JSS A;  5JRG D;  5B31 B;  4J8W B;  4J8V A;  4ZUX B;  3UTB B;  4H9S C;  3B0D B;  4Z2M G;  3FDD A;  2CWE A;  1M1A D;  4CAY B;  5CPI B;  1P3I B;  3W98 C;  3AZG C;  3UT9 D;  3WKJ D;  1P3O A;  4Z5T D;  3AZI B;  5CPK D;  4H9R A;  3W96 B;  5B33 B;  2NQB A;  4J8U A;  3KWQ D;  2RVQ D;  2PYO D;  1P3A B;  4UUZ A;  2FJ7 A;  5AVC A;  1KX4 D;  4XZQ A;  3B0B A;  3EPJ A;  3C1B A;  3EPK A;  1A7W A;  2XD1 A;  3AZN D;  2BYK A;  4QLC B;  3MGP A;  1P3G B;  3NQJ A;  4H9P A;  4X23 B;  1M1A A;  3WA9 B;  3X1U A;  3TU4 D;  5GT3 B;  3NQU B;  4JJN A;  5CPK A;  5KDM A;  5DNM D;  1P3O C;  3KWQ A;  1EQZ A;  3MNN B;  5AV5 B;  5BNX A;  5JRG C;  4ZBJ B;  3KUY A;  2FJ7 C;  5AVC C;  3C1C B;  3REL B;  2Y2L A;  3AZN A;  3REI D;  4XUJ D;  5B2I B;  4KHA B;  1P34 D;  2YFV A;  3AZJ D;  3W99 B;  1M1A C;  1M19 D;  3UT9 C;  3WTP D;  3WKJ C;  2XD5 A;  4Z5T C;  3MVD B;  5CPK C;  1KX5 B;  4WV4 B;  3AZI D;  3KWQ C;  2HUE B;  2RVQ C;  2PYO C;  5B33 D;  3AZL D;  3X1V A;  1KX4 C;  3REI A;  4XUJ A;  2Y2J A;  3AZN C;  3AZJ A;  1M19 A;  3KXB D;  3W98 B;  3TU4 C;  3WTP A;  2CV5 D;  2F2A C;  2ZY2 A;  5DNM C;  2Y2I A;  3UTA D;  4YS3 A;  4J8V B;  5AV5 D;  3C1C D;  3REI C;  4XUJ C;  3REH A;  1P34 C;  1BH8 A;  3AZJ C;  1TZY D;  1M19 C;  4R8P D;  3B0C W;  4NE5 A;  3WTP C;  1P3O B;  3X1S D;  1HTA A;  3UTA A;  2ZY5 A;  4H9R B;  3V9R A;  3WAA A;  3AZI C;  3R45 A;  5B31 G;  5JRG B;  5B33 C;  2F8N A;  4YM6 A;  5B0Y D;  4UUZ B;  2BYM B;  5AVC B;  2FJ7 B;  3AZL C;  5B24 D;  1S32 D;  5AV9 D;  3C1B B;  2BYK B;  2IO5 C;  3MGP B;  5CP6 A;  3NQJ B;  4H9P B;  1M1A B;  3KXB C;  4R8P A;  1Q9C A;  3WKJ B;  2CV5 C;  3X1S A;  5CPK B;  5KDM B;  3KWQ B;  5AV6 D;  3MGR D;  3UTA C;  2PYO B;  2G5I C;  3VH5 W;  3AV1 D;  5CPJ A;  5B0Y A;  3MGQ D;  1KX4 B;  5AV5 C;  4J8V D;  5AV9 A;  4H9N B;  3C1C C;  4DQY B;  3AZN B;  4G92 C;  1U35 D;  2YFV B;  3AZM A;  3VH6 W;  4Z66 D;  1TZY C;  4R8P C;  5E5A D;  5B0Z D;  4EO5 C;  3AZH A;  3H0M C;  5DNM B;  2BG1 A;  5AV6 A;  3X1S C;  3MGR A;  3AV1 A;  5BO0 B;  3LJA D;  3MGQ A;  1P3F A;  2NQB D;  4J8U D;  5B0Y C;  4KUD D;  2Y2M A;  2L5A A;  5BS7 A;  5B24 C;  2FJ7 D;  5AVC D;  1U35 A;  3REI B;  4XUJ B;  4H9Q A;  1S32 C;  1P34 B;  5AV9 C;  4XZQ D;  3AZJ B;  4Z66 A;  1M19 B;  5AVB A;  3C1B D;  3EG5 B;  5E5A A;  5B0Z A;  3MGP D;  3WTP B;  4WU9 D;  3X1U D;  3H0R C;  4WZS B;  3LZ1 D;  3LJA A;  5AV6 C;  4JJN D;  3MGR C;  3AV1 C;  1EQZ D;  5B32 A;  3MGQ C;  4KUD A;  4NE3 A;  3REJ D;  3AZL B;  3AV2 A;  1HQ3 D;  4J8V C;  3KUY D;  1U35 C;  2IO5 B;  1T3U A;  3KXB B;  1P3K D;  1BH8 B;  4Z66 C;  4WU9 A;  2CV5 B;  2YFW A;  5E5A C;  5B0Z C;  3LZ1 A;  2F8N H;  5JA4 A;  3UTA B;  2NZD A;  2J8P A;  1P3L A;  3WAA B;  3LJA C;  3R45 B;  3AZE D;  2F8N B;  3REJ A;  2NQB C;  5B2J A;  4YM6 B;  4J8U C;  1HQ3 A;  1F66 A;  5B1L A;  4AWL C;  4KUD C;  1M18 A;  3B0C T;  3W97 D;  3X1V D;  4G92 B;  1BFM A;  4XZQ C;  1P3K A;  3P5J B;  1JFI A;  1TZY B;  3C1B C;  4R8P B;  3MGP C;  4EO5 B;  4WU9 C;  2W8S A;  1ID3 A;  3X1U C;  3X1S B;  5AV8 A;  3LZ1 C;  3VH5 A;  4JJN C;  3AZE A;  5CPJ B;  5BNV A;  5B0Y B;  1EQZ C;  3KSY A;  3REJ C;  4YS3 D;  1ZLA D;  3B6F A;  1HQ3 C;  5B24 B;  3W97 A;  1F1E A;  1S32 B;  5AV9 B;  3KUY C;  3A6N D;  1N1J A;  5GT0 D;  2HIO A;  3VH6 A;  5C3I C;  1P3K C;  3VH5 T;  3REH D;  5AV6 B;  3MGR B;  3AV1 B;  3MGQ B;  3AZE C;  5B1M D;  3WAA D;  4WU8 D;  1ZLA A;  2F8N D;  3VH6 T;  5FUG A;  4YM6 D;  1WWS A;  1WWI A;  1P3M D;  3W97 C;  4WNN A;  3X1V C;  3A6N A;  3F6T A;  5GT0 A;  3X1T A;  1U35 B;  2VQR A;  4Z66 B;  5E5A B;  5B0Z B;  5CP6 D;  4CAY A;  3LJA B;  5CPI A;  1AOI A;  2NQB B;  5AY8 D;  5B1M A;  4J8U B;  4WU8 A;  1P3B D;  4AWL B;  4NFT A;  4KUD B;  5CPJ D;  4YS3 C;  1ZLA C;  1P3M A;  2G5H C;  5B40 A;  3B6G D;  4LD9 D;  1Z2C B;  4XZQ B;  4E45 A;  3A6N C;  5GT0 C;  1TAF A;  2Y2Q A;  4CSR A;  3REH C;  5GSU D;  2YFW B;  4WU9 B;  3X1U B;  3AZM D;  2Y2O A;  3LZ1 B;  4QLC A;  4X23 A;  4JJN B;  5JA4 B;  3AZH D;  5AY8 A;  1EQZ B;  1P3B A;  3MGS A;  3REJ B;  5B1M C;  3WAA C;  1P3P A;  4WU8 C;  1HQ3 B;  5B1L B;  1P3F D;  5BNX B;  4YM6 C;  4G91 C;  3H0L C;  3B6G A;  4LD9 A;  3KUY B;  1P3M C;  1H3O A;  5C3I B;  1P3K B;  1JFI B;  5GSU A;  2Y2H A;  2ARO D;  3O62 A;  5CP6 C;  5AVB D;  5AV8 B;  3LZ0 D;  3AN2 D;  1KU5 A;  3LEL D;  3AZE B;  2F8N G;  5AY8 C;  4H9O A;  5BNV B;  1P3B C;  5CPJ C;  1KX5 A;  5B32 D;  3W97 B;  3X1V B;  3AV2 D;  3B6G C;  4LD9 C;  1N1J B;  4J8X D;  2HIO B;  2Y2K A;  3AZK D;  1R4V A;  2ARO A;  4H9S A;  1BH9 A;  5GSU C;  3AZM C;  3REK D;  3LZ0 A;  3AN2 A;  5BT1 D;  5G49 A;  3LEL A;  3AZG A;  4NE6 A;  3AZH C;  2NZD D;  1P3L D;  2DF4 C;  4YS3 B;  1ZLA B;  2F8N K;  1P3F C;  5B2J D;  5FUG B;  1F66 D;  5B1L D;  4UPK A;  4WNN B;  3A6N B;  5BS7 C;  5GT0 B;  4J8X A;  3AYW D;  1M18 D;  3AZK A;  4WJ3 C;  3REH B;  4KGC D;  3REK A;  2ARO C;  5AVB C;  3LZ0 C;  3AN2 C;  1ID3 D;  3LEL C;  5AV8 D;  1AOI B;  3V9R B;  5B1M B;  4WU8 B;  1KX3 D;  4G91 B;  5B32 C;  1P3M B;  3KFU G;  3AYW A;  5B40 B;  3AV2 C;  5JRG A;  3B6F D;  5F99 D;  2BYM A;  4J8X C;  1TAF B;  3AZK C;  4KGC A;  5GXQ D;  4CSR B;  2HIO D;  5CHL B;  5CP6 B;  2Y2N A;  3EPL A;  3REK C;  5BT1 C;  5DNN D;  5AY8 B;  3UT9 A;  1PZR A;  3WKJ A;  5B32 G;  3AFA D;  1P3B B;  1KX3 A;  2NZD C;  4Z5T A;  3MGS B;  1P3L C;  1P3P B;  4HGA C;  2UWX A;  5B2J C;  2PYO A;  3B6G B;  1F66 C;  4LD9 B;  5B1L C;  5F99 A;  3AYW C;  3AZF D;  1M18 C;  1KX4 A;  1H3O B;  3X1T D;  5GXQ A;  5B31 D;  5GSU B;  4J8W D;  3AZM B;  4KGC C;  4ZUX D;  4H9N A;  3O62 B;  4Z2M H;  3UTB D;  5DNN A;  3AZH B;  3TU4 A;  1ID3 C;  3AFA A;  5AV8 C;  4M6B A;  4H9O B;  5CPI D;  5DNM A;  1P3I D;  1AOI D;  1P3F B;  1KX3 C;  5BO0 A;  3AZF A;  3B6F C;  3W96 D;  5B40 D;  5F99 C;  5B31 A;  4H9Q B;  4J8W A;  1P3A D;  4ZUX A;  2ARO B;  5GXQ C;  2HIO C;  5AVB B;  1BH9 B;  1ULY A;  1P34 A;  3UTB A;  3LZ0 B;  3AN2 B;  5G49 B;  2ZM5 A;  3LEL B;  5DNN C;  3AZG B;  3WA9 D;  4QLC D;  1P3G D;  3EPH A;  4X23 D;  1P3I A;  3AFA C;  5GT3 D;  5B32 B;  3MGS D;  3AZI A;  3AV2 B;  3W96 A;  5B33 A;  1P3P D;  4J8X B;  3AZF C;  3AZL A;  1P3A A;  3AZK B;  2JE5 A;  3MNN D;  3X1T C;  5B31 C;  4J8W C;  2JCH A;  4ZUX C;  3REK B;  3REL D;  3IP4 C;  2FFF B;  3KXB A;  3O62 D;  3UTB C;  3WA9 A;  1P3G A;  3B0D C;  5B2I D;  2CV5 A;  1W2E A;  2NZD B;  1P3L B;  3W99 D;  5GT3 A;  3AL0 C;  4HGA B;  3NQU A;  5CPI C;  1P3I C;  1AOI C;  5B2J B;  1F66 B;  3MVD D;  1M18 B;  3AYW B;  3W96 C;  1KX5 D;  3MNN A;  5AV5 A;  5B40 C;  1P3A C;  4KGC B;  2DQN C;  3C1C A;  3REL A;  3WTP E;  5B2I A;  4KHA A;  1ID3 B;  1TZY A;  2Y2P A;  2ZY4 A;  4QLC C;  3UT9 B;  1P3G C;  4X23 C;  3W99 A;  3WA9 C;  3W98 D;  3AZG D;  1KX3 B;  4Z5T B;  5GT3 C;  3MGS C;  3MVD A;  1P3P C;  3B6F B;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...