3H0RC

Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPERKDGFFVVPRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Insights into tRNA-Dependent Amidotransferase Evolution and Catalysis from the Structure of the Aquifex aeolicus Enzyme
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 18
structure length 91
sequence length 91
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3h0rC01
3A1KA 2F2AC 3H0LC 4WJ3C 2G5HC 3H0RC 3IP4C 3AL0C 2DF4C 2G5IC 3KFUG 3H0MC 2DQNC 3A1IA
chains in the Genus database with same CATH superfamily
3F6TA 3LELA 5AVBA 3MGQC 5B40D 1T3UA 3AV2B 3REHC 3AZIA 5B2IA 5B33C 3AZLA 3REIC 5AV8B 3REHB 3WA9D 3EG5B 3A6ND 3AZFD 2PYOC 5CPIA 5AV6D 1TAFB 3KUYD 5B1LA 5B33B 1P3KD 3AZHD 2BYMA 3AZJA 3B6GD 3H0RC 2PYOB 5B1MC 4WU8A 2NQBA 4NFTA 2J8PA 2JSSA 1H3OA 1KU5A 3MNNC 4YM6A 5B32D 3MGQA 5GXQD 4AWLC 4H9SC 3MVDB 5GT3D 3MNNB 1P3OB 4H9OB 2AROD 2HIOD 5AV9A 3REIA 5CPKD 3X1VC 4JJNB 5AV5D 3W99B 3AYWC 4J8VD 4H9NA 5DNMD 2YFWB 3WKJD 2CV5B 5E5AC 3AZGC 2NZDD 1P3PB 3TU4D 2Y2MA 4J8WB 5B1MA 5DNNC 3AYWB 2Y2NA 3VH5T 2L5AA 3A1IA 5E5AB 3AZGB 3LJAA 3W96C 1HQ3D 5B31D 1ID3D 5DNNB 1F1EA 2DQNC 2Y2OA 1F66D 3W96B 5AVBD 1M18D 5BT1C 3AZED 4WNNB 3VH6W 3B0CT 3WA9C 3NQJA 4XUJA 3A6NC 1S32A 2RIQA 5AV6C 3KUYC 3UTBB 3AZID 4KUDD 3X1VA 1P3LB 3X1SD 4H9PA 5AVCB 2JE5A 3LZ1C 4Z2MH 4J8UC 5CPID 5JRGA 5B0YD 1B67A 4Z5TC 5JA4A 3W96A 5GXQC 4J8UB 4WU8D 2F8NG 2Y2PA 4DRBA 3V9RA 4UPKA 3AV2D 5GSUB 5CHLB 1P3MC 4Z5TB 3W97C 4XZQC 2AROC 5B2JB 3MGQD 4WZSB 1N1JA 3WA9A 2RVQC 5AV8D 3A6NA 3AFAB 3REHD 5AV6A 3KUYA 1ULYA 5B32G 3WKJC 4XZQB 2VQRA 1P3KA 5B33D 3AZHA 1P3FC 3REID 1P3GB 4ZBJB 3X1UC 2YFVA 3TU4C 3LZ1A 2PYOD 3LZ0C 3AN2C 3REKB 4UUZB 3X1UB 1ID3C 4Z5TA 5GXQA 3B6FC 5GT0B 3LZ0B 3AN2B 2Y2KA 5GT3A 3MVDD 3MNND 1P3AB 1P3MA 3B0DB 3W97A 3C1CC 5CP6C 3B6FB 2AROA 5B0ZC 4H9RB 4KGCB 4KUDC 5CPKA 3H0MC 5AV5A 4JJND 3X1SC 5B31G 5F99B 1JFIA 3WAAB 4J8VA 3C1CB 5CP6B 3WKJA 1P3FA 3EPJA 3TU4A 1P3PD 5B0YC 5BS7A 4J8WD 3AZNC 4DQYB 3AYWD 3AN2A 5E5AD 3AZGD 1M1AC 1ID3A 5KDMA 3AZNB 3B6FA 5DNND 1F66A 2ZM5A 4R8PB 3MGPB 1M19B 1M18A 1M1AB 1AOIC 3AZEA 3W96D 3C1CA 4QLCB 5AV8C 5B0ZA 1WWIA 3IP4C 3O62C 4KUDA 3MGSB 1AOIB 3X1SA 1P3LD 3KWQB 4DRAA 5BT1D 5FUGB 3MGRC 3WTPB 3UTAC 2Y2IA 1BH9A 3O62B 5AVCD 2FFFB 3EPKA 5B0YA 3VH5A 3MGRB 3REJC 4H9QB 3UTAB 5C3IB 3LZ1D 4J8UD 5BNVB 3WTPE 2Y2HA 4YS3B 3MVDC 3AV2A 4EO5B 3REJB 1P3OC 2XD5A 4Z5TD 5CPJB 5B2JD 4CAYB 3UT9B 4NE5A 5AV8A 3REHA 4JJNC 4X23B 3AFAD 3W99C 3W98B 1TAFA 1P3MD 3W97D 2CWEA 4XZQD 5B33A 3EPLA 2CV5C 1P3PC 2RVQD 4J8WC 2PYOA 5BNVA 3REKD 2FJ7B 1P3FD 3X1UD 2BYKB 5GT0D 3LZ0D 3AN2D 4E45A 3MVDA 1P34C 3MNNA 1P3OA 4H9OA 4WJ3C 1P3AD 1KX5C 3B6FD 4KGCD 3UTBC 4H9SA 1P34B 4JJNA 1P3LC 3W99A 5F99D 1KX5B 3C1CD 5CP6D 2YFWA 3A1KA 5B0ZD 2CV5A 5AVCC 5AY8C 1P3IC 2G5HC 1P3PA 2ZY5A 4J8WA 3C1BB 3AYWA 5E5AA 3AZGA 4J8XC 5AY8B 1P3IB 1TZYC 1U35C 4ZUXB 5DNNA 3NQUB 3AZND 5GSUC 4NE3A 3KXBC 1P34A 3KSYA 4J8XB 3MGPD 1M19D 5B2JC 1M1AD 1PZRA 1TZYB 4WNNA 1U35B 5B40B 3KFUG 4QLCD 4WU9C 4Z66B 3AFAC 3KXBB 3UTBA 1P3LA 1AOID 3KWQD 3R45B 3WTPD 1P3GC 4ZBJC 4WU9B 5AVCA 3O62D 3REKC 1EQZB 2F8NB 3MGRD 3UTAD 4M6BA 4J8UA 1P3BC 5GT0C 4YS3D 5GSUA 3REJD 1P3AC 1ZLAC 3B0DC 5G49B 1P3BB 5B2JA 4KGCC 5CPJD 5B32B 1KX4B 3AZKC 3AFAA 2JCHA 3WAAC 5BNXB 2Y2GA 5F99C 4X23D 3X1TB 1P3OD 1ZLAB 4XZQA 2IO5B 1KX3C 2ZY4A 1P3GA 2HIOB 3AZKB 4G92C 3W99D 3REKA 4UUZA 1KX3B 2CV5D 2FJ7D 2UWXA 5DNMB 3X1UA 5G49A 2F8NH 5BO0B 4G92B 2NZDB 3VH6T 4CSRB 5GT0A 3LZ0A 2HUEC 3AV1C 4R8PC 3MGPC 1M19C 3B0BA 1P3AA 4LD9B 4QLCC 1HQ3B 5B24B 4KGCA 4H9RA 2HUEB 3AV1B 1P34D 3MGSC 3WAAA 5F99A 3KWQC 3LELB 5CP6A 5AVBB 3WTPC 1KX5D 3UTBD 3AZMC 3AZIB 1Z2CB 4CSRA 3C1BD 5B1LC 2Y2LA 5B2IB 3AZLB 5C3IC 4G91C 1W2EA 4HGAB 5AY8D 3AZMB 1P3ID 4YS3C 1BFMA 2NQBC 4ZUXD 3AZNA 4EO5C 2ZY3A 5B1LB 3B0CW 4R8PA 4G91B 3MGPA 4J8XD 1M19A 1M1AA 4YM6C 5CPJC 2BYMB 3AZJB 1TZYD 4QLCA 4WU8B 1U35D 2NQBB 3UT9C 4X23C 4Z66D 5GSUD 3RELC 3W98C 3KXBD 1H3OB 3MGSA 1AOIA 4YM6B 3KWQA 5FUGA 1B6WA 3WTPA 3MGQB 4NE6A 4WU9D 5AV9C 3O62A 3RELB 3AZMA 3MGRA 1EQZD 2FJ7C 2F8ND 4H9QA 3UTAA 2BG1A 1P3GD 5AV9B 3REIB 4YS3A 2XD1A 4H9NB 3REJA 3LJAC 1P3BD 5CPJA 4CAYA 4Z2MG 5B1MB 1KX4D 3UT9A 2F8NK 3AL0C 4X23A 3X1TD 3RELA 3W98A 1ZLAD 3LJAB 4E44A 4XUJC 4AWLB 3AZKD 1S32C 3WAAD 3C1BC 1BH8B 1Q9CA 1HTAA 1KX3D 2FJ7A 3NQJB 4XUJB 1S32B 4ZUXC 2BYKA 3X1VB 5JRGC 3H0LC 4H9PB 4LD9D 5B40C 5B24D 4Z66C 5JRGB 3AV1D 4R8PD 1KX5A 3LELD 5JA4B 1BH8A 3V9RB 3AZFC 2DF4C 3MGSD 1EQZC 3C1BA 1P3KC 5B2ID 3AZHC 3AZLD 1N1JB 5AY8A 1P3IA 3WA9B 3B6GC 3A6NB 3FDDA 3AZMD 3VH6A 3AZFB 5AV6B 4ZUXA 3KUYB 3NQUA 5B1LD 1P3KB 4KHAB 3AZHB 4J8XA 1R4VA 3B6GB 2YFVB 1TZYA 5B32C 3AZJD 1U35A 5B40A 2W8SA 3LZ1B 1KX4C 2NQBD 4Z66A 3X1TC 2Y2JA 3KXBA 5GT3C 2IO5C 4YM6D 3R45A 5GXQB 2HIOC 3UT9D 4WU9A 5CPKC 3RELD 5GT3B 3W98D 3AZFA 5AV5C 1P3MB 4J8VC 1EQZA 2F8NA 3W97B 5DNMC 2AROB 4KHAA 4WV4B 2NZDC 5AV9D 3P5JB 5CPKB 3B6GA 5AV5B 5BS7C 1JFIB 4J8VB 3WKJB 2Y2QA 4LD9C 1P3FB 1HQ3C 1P3BA 5B31C 5B24C 2G5IC 3TU4B 5B32A 1KX4A 5B1MD 3X1TA 5BNXA 1F66C 3LELC 1ZLAA 5AVBC 3LJAD 1M18C 5B31B 3AZEC 1ID3B 3EPHA 2F2AC 5KDMB 2HIOA 3AZKA 2ZY2A 3AZIC 1F66B 1WWSA 1A7WA 1M18B 5B2IC 3AZEB 3AZLC 1KX3A 4HGAC 5DNMA 5B0ZB 3VH5W 4XUJD 2NZDA 5BO0A 4KUDB 2LY8A 5CPIC 1S32D 3X1VD 3X1SB 1BH9B 4LD9A 3AZJC 1HQ3A 4WU8C 5CPIB 5B31A 5B24A 5B0YB 3AV1A 5JRGD 3AV2C
chains in the Genus database with same CATH topology
3F6TA 3LELA 5AVBA 3MGQC 5B40D 1T3UA 3AV2B 3REHC 3AZIA 5B2IA 5B33C 3AZLA 3REIC 5AV8B 3REHB 3WA9D 3EG5B 3A6ND 3AZFD 2PYOC 5CPIA 5AV6D 1TAFB 3KUYD 5B1LA 5B33B 1P3KD 3AZHD 2BYMA 3AZJA 3B6GD 3H0RC 2PYOB 5B1MC 4WU8A 2NQBA 4NFTA 2J8PA 2JSSA 1H3OA 1KU5A 3MNNC 4YM6A 5B32D 3MGQA 5GXQD 4AWLC 4H9SC 3MVDB 5GT3D 3MNNB 1P3OB 4H9OB 2AROD 2HIOD 5AV9A 3REIA 5CPKD 3X1VC 4JJNB 5AV5D 3W99B 3AYWC 4J8VD 4H9NA 5DNMD 2YFWB 3WKJD 2CV5B 5E5AC 3AZGC 2NZDD 1P3PB 3TU4D 2Y2MA 4J8WB 5B1MA 5DNNC 3AYWB 2Y2NA 3VH5T 2L5AA 3A1IA 5E5AB 3AZGB 3LJAA 3W96C 1HQ3D 5B31D 1ID3D 5DNNB 1F1EA 2DQNC 2Y2OA 1F66D 3W96B 5AVBD 1M18D 5BT1C 3AZED 4WNNB 3VH6W 3B0CT 3WA9C 3NQJA 4XUJA 3A6NC 1S32A 2RIQA 5AV6C 3KUYC 3UTBB 3AZID 4KUDD 3X1VA 1P3LB 3X1SD 4H9PA 5AVCB 2JE5A 3LZ1C 4Z2MH 4J8UC 5CPID 5JRGA 5B0YD 1B67A 4Z5TC 5JA4A 3W96A 5GXQC 4J8UB 4WU8D 2F8NG 2Y2PA 4DRBA 3V9RA 4UPKA 3AV2D 5GSUB 5CHLB 1P3MC 4Z5TB 3W97C 4XZQC 2AROC 5B2JB 3MGQD 4WZSB 1N1JA 3WA9A 2RVQC 5AV8D 3A6NA 3AFAB 3REHD 5AV6A 3KUYA 1ULYA 5B32G 3WKJC 4XZQB 2VQRA 1P3KA 5B33D 3AZHA 1P3FC 3REID 1P3GB 4ZBJB 3X1UC 2YFVA 3TU4C 3LZ1A 2PYOD 3LZ0C 3AN2C 3REKB 4UUZB 3X1UB 1ID3C 4Z5TA 5GXQA 3B6FC 5GT0B 3LZ0B 3AN2B 2Y2KA 5GT3A 3MVDD 3MNND 1P3AB 1P3MA 3B0DB 3W97A 3C1CC 5CP6C 3B6FB 2AROA 5B0ZC 4H9RB 4KGCB 4KUDC 5CPKA 3H0MC 5AV5A 4JJND 3X1SC 5B31G 5F99B 1JFIA 3WAAB 4J8VA 3C1CB 5CP6B 3WKJA 1P3FA 3EPJA 3TU4A 1P3PD 5B0YC 5BS7A 4J8WD 3AZNC 4DQYB 3AYWD 3AN2A 5E5AD 3AZGD 1M1AC 1ID3A 5KDMA 3AZNB 3B6FA 5DNND 1F66A 2ZM5A 4R8PB 3MGPB 1M19B 1M18A 1M1AB 1AOIC 3AZEA 3W96D 3C1CA 4QLCB 5AV8C 5B0ZA 1WWIA 3IP4C 3O62C 4KUDA 3MGSB 1AOIB 3X1SA 1P3LD 3KWQB 4DRAA 5BT1D 5FUGB 3MGRC 3WTPB 3UTAC 2Y2IA 1BH9A 3O62B 5AVCD 2FFFB 3EPKA 5B0YA 3VH5A 3MGRB 3REJC 4H9QB 3UTAB 5C3IB 3LZ1D 4J8UD 5BNVB 3WTPE 2Y2HA 4YS3B 3MVDC 3AV2A 4EO5B 3REJB 1P3OC 2XD5A 4Z5TD 5CPJB 5B2JD 4CAYB 3UT9B 4NE5A 5AV8A 3REHA 4JJNC 4X23B 3AFAD 3W99C 3W98B 1TAFA 1P3MD 3W97D 2CWEA 4XZQD 5B33A 3EPLA 2CV5C 1P3PC 2RVQD 4J8WC 2PYOA 5BNVA 3REKD 2FJ7B 1P3FD 3X1UD 2BYKB 5GT0D 3LZ0D 3AN2D 4E45A 3MVDA 1P34C 3MNNA 1P3OA 4H9OA 4WJ3C 1P3AD 1KX5C 3B6FD 4KGCD 3UTBC 4H9SA 1P34B 4JJNA 1P3LC 3W99A 5F99D 1KX5B 3C1CD 5CP6D 2YFWA 3A1KA 5B0ZD 2CV5A 5AVCC 5AY8C 1P3IC 2G5HC 1P3PA 2ZY5A 4J8WA 3C1BB 3AYWA 5E5AA 3AZGA 4J8XC 5AY8B 1P3IB 1TZYC 1U35C 4ZUXB 5DNNA 3NQUB 3AZND 5GSUC 4NE3A 3KXBC 1P34A 3KSYA 4J8XB 3MGPD 1M19D 5B2JC 1M1AD 1PZRA 1TZYB 4WNNA 1U35B 5B40B 3KFUG 4QLCD 4WU9C 4Z66B 3AFAC 3KXBB 3UTBA 1P3LA 1AOID 3KWQD 3R45B 3WTPD 1P3GC 4ZBJC 4WU9B 5AVCA 3O62D 3REKC 1EQZB 2F8NB 3MGRD 3UTAD 4M6BA 4J8UA 1P3BC 5GT0C 4YS3D 5GSUA 3REJD 1P3AC 1ZLAC 3B0DC 5G49B 1P3BB 5B2JA 4KGCC 5CPJD 5B32B 1KX4B 3AZKC 3AFAA 2JCHA 3WAAC 5BNXB 2Y2GA 5F99C 4X23D 3X1TB 1P3OD 1ZLAB 4XZQA 2IO5B 1KX3C 2ZY4A 1P3GA 2HIOB 3AZKB 4G92C 3W99D 3REKA 4UUZA 1KX3B 2CV5D 2FJ7D 2UWXA 5DNMB 3X1UA 5G49A 2F8NH 5BO0B 4G92B 2NZDB 3VH6T 4CSRB 5GT0A 3LZ0A 2HUEC 3AV1C 4R8PC 3MGPC 1M19C 3B0BA 1P3AA 4LD9B 4QLCC 1HQ3B 5B24B 4KGCA 4H9RA 2HUEB 3AV1B 1P34D 3MGSC 3WAAA 5F99A 3KWQC 3LELB 5CP6A 5AVBB 3WTPC 1KX5D 3UTBD 3AZMC 3AZIB 1Z2CB 4CSRA 3C1BD 5B1LC 2Y2LA 5B2IB 3AZLB 5C3IC 4G91C 1W2EA 4HGAB 5AY8D 3AZMB 1P3ID 4YS3C 1BFMA 2NQBC 4ZUXD 3AZNA 4EO5C 2ZY3A 5B1LB 3B0CW 4R8PA 4G91B 3MGPA 4J8XD 1M19A 1M1AA 4YM6C 5CPJC 2BYMB 3AZJB 1TZYD 4QLCA 4WU8B 1U35D 2NQBB 3UT9C 4X23C 4Z66D 5GSUD 3RELC 3W98C 3KXBD 1H3OB 3MGSA 1AOIA 4YM6B 3KWQA 5FUGA 1B6WA 3WTPA 3MGQB 4NE6A 4WU9D 5AV9C 3O62A 3RELB 3AZMA 3MGRA 1EQZD 2FJ7C 2F8ND 4H9QA 3UTAA 2BG1A 1P3GD 5AV9B 3REIB 4YS3A 2XD1A 4H9NB 3REJA 3LJAC 1P3BD 5CPJA 4CAYA 4Z2MG 5B1MB 1KX4D 3UT9A 2F8NK 3AL0C 4X23A 3X1TD 3RELA 3W98A 1ZLAD 3LJAB 4E44A 4XUJC 4AWLB 3AZKD 1S32C 3WAAD 3C1BC 1BH8B 1Q9CA 1HTAA 1KX3D 2FJ7A 3NQJB 4XUJB 1S32B 4ZUXC 2BYKA 3X1VB 5JRGC 3H0LC 4H9PB 4LD9D 5B40C 5B24D 4Z66C 5JRGB 3AV1D 4R8PD 1KX5A 3LELD 5JA4B 1BH8A 3V9RB 3AZFC 2DF4C 3MGSD 1EQZC 3C1BA 1P3KC 5B2ID 3AZHC 3AZLD 1N1JB 5AY8A 1P3IA 3WA9B 3B6GC 3A6NB 3FDDA 3AZMD 3VH6A 3AZFB 5AV6B 4ZUXA 3KUYB 3NQUA 5B1LD 1P3KB 4KHAB 3AZHB 4J8XA 1R4VA 3B6GB 2YFVB 1TZYA 5B32C 3AZJD 1U35A 5B40A 2W8SA 3LZ1B 1KX4C 2NQBD 4Z66A 3X1TC 2Y2JA 3KXBA 5GT3C 2IO5C 4YM6D 3R45A 5GXQB 2HIOC 3UT9D 4WU9A 5CPKC 3RELD 5GT3B 3W98D 3AZFA 5AV5C 1P3MB 4J8VC 1EQZA 2F8NA 3W97B 5DNMC 2AROB 4KHAA 4WV4B 2NZDC 5AV9D 3P5JB 5CPKB 3B6GA 5AV5B 5BS7C 1JFIB 4J8VB 3WKJB 2Y2QA 4LD9C 1P3FB 1HQ3C 1P3BA 5B31C 5B24C 2G5IC 3TU4B 5B32A 1KX4A 5B1MD 3X1TA 5BNXA 1F66C 3LELC 1ZLAA 5AVBC 3LJAD 1M18C 5B31B 3AZEC 1ID3B 3EPHA 2F2AC 5KDMB 2HIOA 3AZKA 2ZY2A 3AZIC 1F66B 1WWSA 1A7WA 1M18B 5B2IC 3AZEB 3AZLC 1KX3A 4HGAC 5DNMA 5B0ZB 3VH5W 4XUJD 2NZDA 5BO0A 4KUDB 2LY8A 5CPIC 1S32D 3X1VD 3X1SB 1BH9B 4LD9A 3AZJC 1HQ3A 4WU8C 5CPIB 5B31A 5B24A 5B0YB 3AV1A 5JRGD 3AV2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1K A;  2F2A C;  3H0L C;  4WJ3 C;  2G5H C;  3H0R C;  3IP4 C;  3AL0 C;  2DF4 C;  2G5I C;  3KFU G;  3H0M C;  2DQN C;  3A1I A; 
#chains in the Genus database with same CATH topology
 3F6T A;  3LEL A;  5AVB A;  3MGQ C;  5B40 D;  1T3U A;  3AV2 B;  3REH C;  3AZI A;  5B2I A;  5B33 C;  3AZL A;  3REI C;  5AV8 B;  3REH B;  3WA9 D;  3EG5 B;  3A6N D;  3AZF D;  2PYO C;  5CPI A;  5AV6 D;  1TAF B;  3KUY D;  5B1L A;  5B33 B;  1P3K D;  3AZH D;  2BYM A;  3AZJ A;  3B6G D;  3H0R C;  2PYO B;  5B1M C;  4WU8 A;  2NQB A;  4NFT A;  2J8P A;  2JSS A;  1H3O A;  1KU5 A;  3MNN C;  4YM6 A;  5B32 D;  3MGQ A;  5GXQ D;  4AWL C;  4H9S C;  3MVD B;  5GT3 D;  3MNN B;  1P3O B;  4H9O B;  2ARO D;  2HIO D;  5AV9 A;  3REI A;  5CPK D;  3X1V C;  4JJN B;  5AV5 D;  3W99 B;  3AYW C;  4J8V D;  4H9N A;  5DNM D;  2YFW B;  3WKJ D;  2CV5 B;  5E5A C;  3AZG C;  2NZD D;  1P3P B;  3TU4 D;  2Y2M A;  4J8W B;  5B1M A;  5DNN C;  3AYW B;  2Y2N A;  3VH5 T;  2L5A A;  3A1I A;  5E5A B;  3AZG B;  3LJA A;  3W96 C;  1HQ3 D;  5B31 D;  1ID3 D;  5DNN B;  1F1E A;  2DQN C;  2Y2O A;  1F66 D;  3W96 B;  5AVB D;  1M18 D;  5BT1 C;  3AZE D;  4WNN B;  3VH6 W;  3B0C T;  3WA9 C;  3NQJ A;  4XUJ A;  3A6N C;  1S32 A;  2RIQ A;  5AV6 C;  3KUY C;  3UTB B;  3AZI D;  4KUD D;  3X1V A;  1P3L B;  3X1S D;  4H9P A;  5AVC B;  2JE5 A;  3LZ1 C;  4Z2M H;  4J8U C;  5CPI D;  5JRG A;  5B0Y D;  1B67 A;  4Z5T C;  5JA4 A;  3W96 A;  5GXQ C;  4J8U B;  4WU8 D;  2F8N G;  2Y2P A;  4DRB A;  3V9R A;  4UPK A;  3AV2 D;  5GSU B;  5CHL B;  1P3M C;  4Z5T B;  3W97 C;  4XZQ C;  2ARO C;  5B2J B;  3MGQ D;  4WZS B;  1N1J A;  3WA9 A;  2RVQ C;  5AV8 D;  3A6N A;  3AFA B;  3REH D;  5AV6 A;  3KUY A;  1ULY A;  5B32 G;  3WKJ C;  4XZQ B;  2VQR A;  1P3K A;  5B33 D;  3AZH A;  1P3F C;  3REI D;  1P3G B;  4ZBJ B;  3X1U C;  2YFV A;  3TU4 C;  3LZ1 A;  2PYO D;  3LZ0 C;  3AN2 C;  3REK B;  4UUZ B;  3X1U B;  1ID3 C;  4Z5T A;  5GXQ A;  3B6F C;  5GT0 B;  3LZ0 B;  3AN2 B;  2Y2K A;  5GT3 A;  3MVD D;  3MNN D;  1P3A B;  1P3M A;  3B0D B;  3W97 A;  3C1C C;  5CP6 C;  3B6F B;  2ARO A;  5B0Z C;  4H9R B;  4KGC B;  4KUD C;  5CPK A;  3H0M C;  5AV5 A;  4JJN D;  3X1S C;  5B31 G;  5F99 B;  1JFI A;  3WAA B;  4J8V A;  3C1C B;  5CP6 B;  3WKJ A;  1P3F A;  3EPJ A;  3TU4 A;  1P3P D;  5B0Y C;  5BS7 A;  4J8W D;  3AZN C;  4DQY B;  3AYW D;  3AN2 A;  5E5A D;  3AZG D;  1M1A C;  1ID3 A;  5KDM A;  3AZN B;  3B6F A;  5DNN D;  1F66 A;  2ZM5 A;  4R8P B;  3MGP B;  1M19 B;  1M18 A;  1M1A B;  1AOI C;  3AZE A;  3W96 D;  3C1C A;  4QLC B;  5AV8 C;  5B0Z A;  1WWI A;  3IP4 C;  3O62 C;  4KUD A;  3MGS B;  1AOI B;  3X1S A;  1P3L D;  3KWQ B;  4DRA A;  5BT1 D;  5FUG B;  3MGR C;  3WTP B;  3UTA C;  2Y2I A;  1BH9 A;  3O62 B;  5AVC D;  2FFF B;  3EPK A;  5B0Y A;  3VH5 A;  3MGR B;  3REJ C;  4H9Q B;  3UTA B;  5C3I B;  3LZ1 D;  4J8U D;  5BNV B;  3WTP E;  2Y2H A;  4YS3 B;  3MVD C;  3AV2 A;  4EO5 B;  3REJ B;  1P3O C;  2XD5 A;  4Z5T D;  5CPJ B;  5B2J D;  4CAY B;  3UT9 B;  4NE5 A;  5AV8 A;  3REH A;  4JJN C;  4X23 B;  3AFA D;  3W99 C;  3W98 B;  1TAF A;  1P3M D;  3W97 D;  2CWE A;  4XZQ D;  5B33 A;  3EPL A;  2CV5 C;  1P3P C;  2RVQ D;  4J8W C;  2PYO A;  5BNV A;  3REK D;  2FJ7 B;  1P3F D;  3X1U D;  2BYK B;  5GT0 D;  3LZ0 D;  3AN2 D;  4E45 A;  3MVD A;  1P34 C;  3MNN A;  1P3O A;  4H9O A;  4WJ3 C;  1P3A D;  1KX5 C;  3B6F D;  4KGC D;  3UTB C;  4H9S A;  1P34 B;  4JJN A;  1P3L C;  3W99 A;  5F99 D;  1KX5 B;  3C1C D;  5CP6 D;  2YFW A;  3A1K A;  5B0Z D;  2CV5 A;  5AVC C;  5AY8 C;  1P3I C;  2G5H C;  1P3P A;  2ZY5 A;  4J8W A;  3C1B B;  3AYW A;  5E5A A;  3AZG A;  4J8X C;  5AY8 B;  1P3I B;  1TZY C;  1U35 C;  4ZUX B;  5DNN A;  3NQU B;  3AZN D;  5GSU C;  4NE3 A;  3KXB C;  1P34 A;  3KSY A;  4J8X B;  3MGP D;  1M19 D;  5B2J C;  1M1A D;  1PZR A;  1TZY B;  4WNN A;  1U35 B;  5B40 B;  3KFU G;  4QLC D;  4WU9 C;  4Z66 B;  3AFA C;  3KXB B;  3UTB A;  1P3L A;  1AOI D;  3KWQ D;  3R45 B;  3WTP D;  1P3G C;  4ZBJ C;  4WU9 B;  5AVC A;  3O62 D;  3REK C;  1EQZ B;  2F8N B;  3MGR D;  3UTA D;  4M6B A;  4J8U A;  1P3B C;  5GT0 C;  4YS3 D;  5GSU A;  3REJ D;  1P3A C;  1ZLA C;  3B0D C;  5G49 B;  1P3B B;  5B2J A;  4KGC C;  5CPJ D;  5B32 B;  1KX4 B;  3AZK C;  3AFA A;  2JCH A;  3WAA C;  5BNX B;  2Y2G A;  5F99 C;  4X23 D;  3X1T B;  1P3O D;  1ZLA B;  4XZQ A;  2IO5 B;  1KX3 C;  2ZY4 A;  1P3G A;  2HIO B;  3AZK B;  4G92 C;  3W99 D;  3REK A;  4UUZ A;  1KX3 B;  2CV5 D;  2FJ7 D;  2UWX A;  5DNM B;  3X1U A;  5G49 A;  2F8N H;  5BO0 B;  4G92 B;  2NZD B;  3VH6 T;  4CSR B;  5GT0 A;  3LZ0 A;  2HUE C;  3AV1 C;  4R8P C;  3MGP C;  1M19 C;  3B0B A;  1P3A A;  4LD9 B;  4QLC C;  1HQ3 B;  5B24 B;  4KGC A;  4H9R A;  2HUE B;  3AV1 B;  1P34 D;  3MGS C;  3WAA A;  5F99 A;  3KWQ C;  3LEL B;  5CP6 A;  5AVB B;  3WTP C;  1KX5 D;  3UTB D;  3AZM C;  3AZI B;  1Z2C B;  4CSR A;  3C1B D;  5B1L C;  2Y2L A;  5B2I B;  3AZL B;  5C3I C;  4G91 C;  1W2E A;  4HGA B;  5AY8 D;  3AZM B;  1P3I D;  4YS3 C;  1BFM A;  2NQB C;  4ZUX D;  3AZN A;  4EO5 C;  2ZY3 A;  5B1L B;  3B0C W;  4R8P A;  4G91 B;  3MGP A;  4J8X D;  1M19 A;  1M1A A;  4YM6 C;  5CPJ C;  2BYM B;  3AZJ B;  1TZY D;  4QLC A;  4WU8 B;  1U35 D;  2NQB B;  3UT9 C;  4X23 C;  4Z66 D;  5GSU D;  3REL C;  3W98 C;  3KXB D;  1H3O B;  3MGS A;  1AOI A;  4YM6 B;  3KWQ A;  5FUG A;  1B6W A;  3WTP A;  3MGQ B;  4NE6 A;  4WU9 D;  5AV9 C;  3O62 A;  3REL B;  3AZM A;  3MGR A;  1EQZ D;  2FJ7 C;  2F8N D;  4H9Q A;  3UTA A;  2BG1 A;  1P3G D;  5AV9 B;  3REI B;  4YS3 A;  2XD1 A;  4H9N B;  3REJ A;  3LJA C;  1P3B D;  5CPJ A;  4CAY A;  4Z2M G;  5B1M B;  1KX4 D;  3UT9 A;  2F8N K;  3AL0 C;  4X23 A;  3X1T D;  3REL A;  3W98 A;  1ZLA D;  3LJA B;  4E44 A;  4XUJ C;  4AWL B;  3AZK D;  1S32 C;  3WAA D;  3C1B C;  1BH8 B;  1Q9C A;  1HTA A;  1KX3 D;  2FJ7 A;  3NQJ B;  4XUJ B;  1S32 B;  4ZUX C;  2BYK A;  3X1V B;  5JRG C;  3H0L C;  4H9P B;  4LD9 D;  5B40 C;  5B24 D;  4Z66 C;  5JRG B;  3AV1 D;  4R8P D;  1KX5 A;  3LEL D;  5JA4 B;  1BH8 A;  3V9R B;  3AZF C;  2DF4 C;  3MGS D;  1EQZ C;  3C1B A;  1P3K C;  5B2I D;  3AZH C;  3AZL D;  1N1J B;  5AY8 A;  1P3I A;  3WA9 B;  3B6G C;  3A6N B;  3FDD A;  3AZM D;  3VH6 A;  3AZF B;  5AV6 B;  4ZUX A;  3KUY B;  3NQU A;  5B1L D;  1P3K B;  4KHA B;  3AZH B;  4J8X A;  1R4V A;  3B6G B;  2YFV B;  1TZY A;  5B32 C;  3AZJ D;  1U35 A;  5B40 A;  2W8S A;  3LZ1 B;  1KX4 C;  2NQB D;  4Z66 A;  3X1T C;  2Y2J A;  3KXB A;  5GT3 C;  2IO5 C;  4YM6 D;  3R45 A;  5GXQ B;  2HIO C;  3UT9 D;  4WU9 A;  5CPK C;  3REL D;  5GT3 B;  3W98 D;  3AZF A;  5AV5 C;  1P3M B;  4J8V C;  1EQZ A;  2F8N A;  3W97 B;  5DNM C;  2ARO B;  4KHA A;  4WV4 B;  2NZD C;  5AV9 D;  3P5J B;  5CPK B;  3B6G A;  5AV5 B;  5BS7 C;  1JFI B;  4J8V B;  3WKJ B;  2Y2Q A;  4LD9 C;  1P3F B;  1HQ3 C;  1P3B A;  5B31 C;  5B24 C;  2G5I C;  3TU4 B;  5B32 A;  1KX4 A;  5B1M D;  3X1T A;  5BNX A;  1F66 C;  3LEL C;  1ZLA A;  5AVB C;  3LJA D;  1M18 C;  5B31 B;  3AZE C;  1ID3 B;  3EPH A;  2F2A C;  5KDM B;  2HIO A;  3AZK A;  2ZY2 A;  3AZI C;  1F66 B;  1WWS A;  1A7W A;  1M18 B;  5B2I C;  3AZE B;  3AZL C;  1KX3 A;  4HGA C;  5DNM A;  5B0Z B;  3VH5 W;  4XUJ D;  2NZD A;  5BO0 A;  4KUD B;  2LY8 A;  5CPI C;  1S32 D;  3X1V D;  3X1S B;  1BH9 B;  4LD9 A;  3AZJ C;  1HQ3 A;  4WU8 C;  5CPI B;  5B31 A;  5B24 A;  5B0Y B;  3AV1 A;  5JRG D;  3AV2 C; 
#chains in the Genus database with same CATH homology
 3F6T A;  3LEL A;  5AVB A;  3MGQ C;  5B40 D;  1T3U A;  3AV2 B;  3REH C;  3AZI A;  5B2I A;  5B33 C;  3AZL A;  3REI C;  5AV8 B;  3REH B;  3WA9 D;  3EG5 B;  3A6N D;  3AZF D;  2PYO C;  5CPI A;  5AV6 D;  1TAF B;  3KUY D;  5B1L A;  5B33 B;  1P3K D;  3AZH D;  2BYM A;  3AZJ A;  3B6G D;  3H0R C;  2PYO B;  5B1M C;  4WU8 A;  2NQB A;  4NFT A;  2J8P A;  2JSS A;  1H3O A;  1KU5 A;  3MNN C;  4YM6 A;  5B32 D;  3MGQ A;  5GXQ D;  4AWL C;  4H9S C;  3MVD B;  5GT3 D;  3MNN B;  1P3O B;  4H9O B;  2ARO D;  2HIO D;  5AV9 A;  3REI A;  5CPK D;  3X1V C;  4JJN B;  5AV5 D;  3W99 B;  3AYW C;  4J8V D;  4H9N A;  5DNM D;  2YFW B;  3WKJ D;  2CV5 B;  5E5A C;  3AZG C;  2NZD D;  1P3P B;  3TU4 D;  2Y2M A;  4J8W B;  5B1M A;  5DNN C;  3AYW B;  2Y2N A;  3VH5 T;  2L5A A;  3A1I A;  5E5A B;  3AZG B;  3LJA A;  3W96 C;  1HQ3 D;  5B31 D;  1ID3 D;  5DNN B;  1F1E A;  2DQN C;  2Y2O A;  1F66 D;  3W96 B;  5AVB D;  1M18 D;  5BT1 C;  3AZE D;  4WNN B;  3VH6 W;  3B0C T;  3WA9 C;  3NQJ A;  4XUJ A;  3A6N C;  1S32 A;  2RIQ A;  5AV6 C;  3KUY C;  3UTB B;  3AZI D;  4KUD D;  3X1V A;  1P3L B;  3X1S D;  4H9P A;  5AVC B;  2JE5 A;  3LZ1 C;  4Z2M H;  4J8U C;  5CPI D;  5JRG A;  5B0Y D;  1B67 A;  4Z5T C;  5JA4 A;  3W96 A;  5GXQ C;  4J8U B;  4WU8 D;  2F8N G;  2Y2P A;  4DRB A;  3V9R A;  4UPK A;  3AV2 D;  5GSU B;  5CHL B;  1P3M C;  4Z5T B;  3W97 C;  4XZQ C;  2ARO C;  5B2J B;  3MGQ D;  4WZS B;  1N1J A;  3WA9 A;  2RVQ C;  5AV8 D;  3A6N A;  3AFA B;  3REH D;  5AV6 A;  3KUY A;  1ULY A;  5B32 G;  3WKJ C;  4XZQ B;  2VQR A;  1P3K A;  5B33 D;  3AZH A;  1P3F C;  3REI D;  1P3G B;  4ZBJ B;  3X1U C;  2YFV A;  3TU4 C;  3LZ1 A;  2PYO D;  3LZ0 C;  3AN2 C;  3REK B;  4UUZ B;  3X1U B;  1ID3 C;  4Z5T A;  5GXQ A;  3B6F C;  5GT0 B;  3LZ0 B;  3AN2 B;  2Y2K A;  5GT3 A;  3MVD D;  3MNN D;  1P3A B;  1P3M A;  3B0D B;  3W97 A;  3C1C C;  5CP6 C;  3B6F B;  2ARO A;  5B0Z C;  4H9R B;  4KGC B;  4KUD C;  5CPK A;  3H0M C;  5AV5 A;  4JJN D;  3X1S C;  5B31 G;  5F99 B;  1JFI A;  3WAA B;  4J8V A;  3C1C B;  5CP6 B;  3WKJ A;  1P3F A;  3EPJ A;  3TU4 A;  1P3P D;  5B0Y C;  5BS7 A;  4J8W D;  3AZN C;  4DQY B;  3AYW D;  3AN2 A;  5E5A D;  3AZG D;  1M1A C;  1ID3 A;  5KDM A;  3AZN B;  3B6F A;  5DNN D;  1F66 A;  2ZM5 A;  4R8P B;  3MGP B;  1M19 B;  1M18 A;  1M1A B;  1AOI C;  3AZE A;  3W96 D;  3C1C A;  4QLC B;  5AV8 C;  5B0Z A;  1WWI A;  3IP4 C;  3O62 C;  4KUD A;  3MGS B;  1AOI B;  3X1S A;  1P3L D;  3KWQ B;  4DRA A;  5BT1 D;  5FUG B;  3MGR C;  3WTP B;  3UTA C;  2Y2I A;  1BH9 A;  3O62 B;  5AVC D;  2FFF B;  3EPK A;  5B0Y A;  3VH5 A;  3MGR B;  3REJ C;  4H9Q B;  3UTA B;  5C3I B;  3LZ1 D;  4J8U D;  5BNV B;  3WTP E;  2Y2H A;  4YS3 B;  3MVD C;  3AV2 A;  4EO5 B;  3REJ B;  1P3O C;  2XD5 A;  4Z5T D;  5CPJ B;  5B2J D;  4CAY B;  3UT9 B;  4NE5 A;  5AV8 A;  3REH A;  4JJN C;  4X23 B;  3AFA D;  3W99 C;  3W98 B;  1TAF A;  1P3M D;  3W97 D;  2CWE A;  4XZQ D;  5B33 A;  3EPL A;  2CV5 C;  1P3P C;  2RVQ D;  4J8W C;  2PYO A;  5BNV A;  3REK D;  2FJ7 B;  1P3F D;  3X1U D;  2BYK B;  5GT0 D;  3LZ0 D;  3AN2 D;  4E45 A;  3MVD A;  1P34 C;  3MNN A;  1P3O A;  4H9O A;  4WJ3 C;  1P3A D;  1KX5 C;  3B6F D;  4KGC D;  3UTB C;  4H9S A;  1P34 B;  4JJN A;  1P3L C;  3W99 A;  5F99 D;  1KX5 B;  3C1C D;  5CP6 D;  2YFW A;  3A1K A;  5B0Z D;  2CV5 A;  5AVC C;  5AY8 C;  1P3I C;  2G5H C;  1P3P A;  2ZY5 A;  4J8W A;  3C1B B;  3AYW A;  5E5A A;  3AZG A;  4J8X C;  5AY8 B;  1P3I B;  1TZY C;  1U35 C;  4ZUX B;  5DNN A;  3NQU B;  3AZN D;  5GSU C;  4NE3 A;  3KXB C;  1P34 A;  3KSY A;  4J8X B;  3MGP D;  1M19 D;  5B2J C;  1M1A D;  1PZR A;  1TZY B;  4WNN A;  1U35 B;  5B40 B;  3KFU G;  4QLC D;  4WU9 C;  4Z66 B;  3AFA C;  3KXB B;  3UTB A;  1P3L A;  1AOI D;  3KWQ D;  3R45 B;  3WTP D;  1P3G C;  4ZBJ C;  4WU9 B;  5AVC A;  3O62 D;  3REK C;  1EQZ B;  2F8N B;  3MGR D;  3UTA D;  4M6B A;  4J8U A;  1P3B C;  5GT0 C;  4YS3 D;  5GSU A;  3REJ D;  1P3A C;  1ZLA C;  3B0D C;  5G49 B;  1P3B B;  5B2J A;  4KGC C;  5CPJ D;  5B32 B;  1KX4 B;  3AZK C;  3AFA A;  2JCH A;  3WAA C;  5BNX B;  2Y2G A;  5F99 C;  4X23 D;  3X1T B;  1P3O D;  1ZLA B;  4XZQ A;  2IO5 B;  1KX3 C;  2ZY4 A;  1P3G A;  2HIO B;  3AZK B;  4G92 C;  3W99 D;  3REK A;  4UUZ A;  1KX3 B;  2CV5 D;  2FJ7 D;  2UWX A;  5DNM B;  3X1U A;  5G49 A;  2F8N H;  5BO0 B;  4G92 B;  2NZD B;  3VH6 T;  4CSR B;  5GT0 A;  3LZ0 A;  2HUE C;  3AV1 C;  4R8P C;  3MGP C;  1M19 C;  3B0B A;  1P3A A;  4LD9 B;  4QLC C;  1HQ3 B;  5B24 B;  4KGC A;  4H9R A;  2HUE B;  3AV1 B;  1P34 D;  3MGS C;  3WAA A;  5F99 A;  3KWQ C;  3LEL B;  5CP6 A;  5AVB B;  3WTP C;  1KX5 D;  3UTB D;  3AZM C;  3AZI B;  1Z2C B;  4CSR A;  3C1B D;  5B1L C;  2Y2L A;  5B2I B;  3AZL B;  5C3I C;  4G91 C;  1W2E A;  4HGA B;  5AY8 D;  3AZM B;  1P3I D;  4YS3 C;  1BFM A;  2NQB C;  4ZUX D;  3AZN A;  4EO5 C;  2ZY3 A;  5B1L B;  3B0C W;  4R8P A;  4G91 B;  3MGP A;  4J8X D;  1M19 A;  1M1A A;  4YM6 C;  5CPJ C;  2BYM B;  3AZJ B;  1TZY D;  4QLC A;  4WU8 B;  1U35 D;  2NQB B;  3UT9 C;  4X23 C;  4Z66 D;  5GSU D;  3REL C;  3W98 C;  3KXB D;  1H3O B;  3MGS A;  1AOI A;  4YM6 B;  3KWQ A;  5FUG A;  1B6W A;  3WTP A;  3MGQ B;  4NE6 A;  4WU9 D;  5AV9 C;  3O62 A;  3REL B;  3AZM A;  3MGR A;  1EQZ D;  2FJ7 C;  2F8N D;  4H9Q A;  3UTA A;  2BG1 A;  1P3G D;  5AV9 B;  3REI B;  4YS3 A;  2XD1 A;  4H9N B;  3REJ A;  3LJA C;  1P3B D;  5CPJ A;  4CAY A;  4Z2M G;  5B1M B;  1KX4 D;  3UT9 A;  2F8N K;  3AL0 C;  4X23 A;  3X1T D;  3REL A;  3W98 A;  1ZLA D;  3LJA B;  4E44 A;  4XUJ C;  4AWL B;  3AZK D;  1S32 C;  3WAA D;  3C1B C;  1BH8 B;  1Q9C A;  1HTA A;  1KX3 D;  2FJ7 A;  3NQJ B;  4XUJ B;  1S32 B;  4ZUX C;  2BYK A;  3X1V B;  5JRG C;  3H0L C;  4H9P B;  4LD9 D;  5B40 C;  5B24 D;  4Z66 C;  5JRG B;  3AV1 D;  4R8P D;  1KX5 A;  3LEL D;  5JA4 B;  1BH8 A;  3V9R B;  3AZF C;  2DF4 C;  3MGS D;  1EQZ C;  3C1B A;  1P3K C;  5B2I D;  3AZH C;  3AZL D;  1N1J B;  5AY8 A;  1P3I A;  3WA9 B;  3B6G C;  3A6N B;  3FDD A;  3AZM D;  3VH6 A;  3AZF B;  5AV6 B;  4ZUX A;  3KUY B;  3NQU A;  5B1L D;  1P3K B;  4KHA B;  3AZH B;  4J8X A;  1R4V A;  3B6G B;  2YFV B;  1TZY A;  5B32 C;  3AZJ D;  1U35 A;  5B40 A;  2W8S A;  3LZ1 B;  1KX4 C;  2NQB D;  4Z66 A;  3X1T C;  2Y2J A;  3KXB A;  5GT3 C;  2IO5 C;  4YM6 D;  3R45 A;  5GXQ B;  2HIO C;  3UT9 D;  4WU9 A;  5CPK C;  3REL D;  5GT3 B;  3W98 D;  3AZF A;  5AV5 C;  1P3M B;  4J8V C;  1EQZ A;  2F8N A;  3W97 B;  5DNM C;  2ARO B;  4KHA A;  4WV4 B;  2NZD C;  5AV9 D;  3P5J B;  5CPK B;  3B6G A;  5AV5 B;  5BS7 C;  1JFI B;  4J8V B;  3WKJ B;  2Y2Q A;  4LD9 C;  1P3F B;  1HQ3 C;  1P3B A;  5B31 C;  5B24 C;  2G5I C;  3TU4 B;  5B32 A;  1KX4 A;  5B1M D;  3X1T A;  5BNX A;  1F66 C;  3LEL C;  1ZLA A;  5AVB C;  3LJA D;  1M18 C;  5B31 B;  3AZE C;  1ID3 B;  3EPH A;  2F2A C;  5KDM B;  2HIO A;  3AZK A;  2ZY2 A;  3AZI C;  1F66 B;  1WWS A;  1A7W A;  1M18 B;  5B2I C;  3AZE B;  3AZL C;  1KX3 A;  4HGA C;  5DNM A;  5B0Z B;  3VH5 W;  4XUJ D;  2NZD A;  5BO0 A;  4KUD B;  2LY8 A;  5CPI C;  1S32 D;  3X1V D;  3X1S B;  1BH9 B;  4LD9 A;  3AZJ C;  1HQ3 A;  4WU8 C;  5CPI B;  5B31 A;  5B24 A;  5B0Y B;  3AV1 A;  5JRG D;  3AV2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...