3H0RC

Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPERKDGFFVVPRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Insights into tRNA-Dependent Amidotransferase Evolution and Catalysis from the Structure of the Aquifex aeolicus Enzyme
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 18
structure length 91
sequence length 91
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3h0rC01
3H0RC 3AL0C 2G5IC 3H0MC 4WJ3C 2G5HC 2DQNC 3A1KA 3KFUG 3A1IA 3IP4C 3H0LC 2DF4C 2F2AC
chains in the Genus database with same CATH superfamily
4NE3A 5B0YC 5B2JD 3O62A 1ID3A 3WTPC 5B0ZB 3KFUG 3KSYA 4X23A 3H0LC 3AZKB 3W99C 3LZ1B 2RVQD 1P3MB 1P3KA 3AV1C 5GT3B 1P34A 4XZQA 3W97D 3REKC 5E5AC 3AFAA 1P3FC 5B2IB 4XUJB 1N1JA 5G49A 4WU9A 3AZIC 5CPKC 1M1AD 4H9SC 3O62D 4R8PA 4H9OA 5B33B 3X1SA 4KHAB 3MGSC 3UTBC 3MGRC 3MNNA 4QLCB 3AZNA 4KUDA 2Y2MA 5B31B 3AZIB 1P3KD 1ZLAC 4YS3A 5AV6B 5GT0A 4WNNB 4J8WD 4XZQD 3EPLA 3REHD 2YFVB 5AY8C 3MGSB 3UT9C 2NQBA 4Z5TC 3AFAD 4HGAB 3B0CT 4ZUXA 3EPKA 3X1UB 1P3LB 4J8UD 4AWLC 2G5IC 4WU8A 1R4VA 5B24B 5B1LA 4LD9D 3AV2A 1S32A 5GXQD 4Z5TB 5AV8B 5B32A 3WAAA 2CV5D 3MNND 1H3OB 4AWLB 3REJC 4JJNB 1BH8A 1U35C 4YS3D 3WTPA 4Z66B 1AOIA 5GT0D 2FJ7B 3AN2D 4Z2MH 2BYKA 5AVCA 3C1CD 2F8NB 3LELD 3AV1A 3X1TC 5BO0B 3REKA 5E5AA 1KX4B 2PYOC 3AV2D 3B6GB 3WAAD 1P3IC 2Y2JA 3KXBB 5CPKA 1TZYC 5B0YD 3AYWC 1A7WA 3KWQA 4J8VC 2ZY3A 3X1TB 3WTPD 1P3GC 5B1MA 4YM6B 4ZBJB 1P3IB 3R45A 3W99D 5B2JB 1P3OA 1ZLAA 1P3PC 3A6NC 2Y2OA 5DNMC 3AV1D 2IO5B 3REKD 1P3AC 5E5AD 3UT9A 2LY8A 1KX3C 1P3FD 3AZID 5CPKD 3EPJA 1ID3C 3W97B 5DNMB 1F66C 4X23C 3V9RA 3MGSD 3UTBD 1M1AB 2DQNC 3MGRD 3O62B 3REJA 1ZLAD 1P34C 1U35A 4XZQC 2W8SA 5GSUA 5AY8D 4CSRA 3UT9D 4Z5TD 4WU9C 1P3KB 2JSSA 4EO5B 4H9RA 5DNNA 4R8PC 4J8WB 2Y2HA 4E45A 4XZQB 3W96A 3X1SC 5BNXB 3AFAB 2PYOA 3AZLA 1N1JB 3AZNC 4KUDC 4J8UB 5AV5C 3AZGA 1TZYA 3REJD 4H9OB 3AZMA 3IP4C 3TU4A 4LD9B 1U35D 5JRGA 1P3GA 2NQBC 2BYMA 3MNNB 2CV5B 1EQZC 3NQJB 4KUDB 4ZUXC 4E44A 3NQUA 3VH6W 4WU8C 3KUYA 4YS3B 4G92B 5GT0B 1JFIA 3A6NA 3AN2B 3X1TD 5B1LC 1S32C 1PZRA 3WAAC 5B32C 2PYOD 3VH6A 3AL0C 1KX3A 1P3ID 3C1CB 3LELB 5C3IC 1TZYD 3C1BC 3AYWD 1AOIC 4J8VD 3AV2B 1F66A 1P3GD 5B32B 3WAAB 4KGCA 4CAYB 2F8NH 2ZY5A 5FUGA 5B0YB 5AVCC 5C3IB 3W98C 1BH8B 3MVDC 3WTPB 1P3PD 3A6ND 5DNMD 5JA4A 3A1KA 1P3AD 3W99B 3RELA 1KX3D 3AZEA 3AV1B 3KWQC 3VH5W 1ID3D 3LZ0C 3REKB 1Q9CA 5E5AB 5B1MC 3LJAA 2DF4C 1F66D 1BFMA 4X23D 1P3FB 5CPJA 3AZHC 1B6WA 3VH5A 5CPKB 5AV5A 1P3OC 5AVBA 1P34D 2XD5A 3UTBB 3MGRB 5F99A 1EQZA 4WU9D 2Y2NA 2HIOA 5BNVA 1ZLAB 1M18C 4R8PD 2Y2KA 3X1SD 5AY8B 3UT9B 4WJ3C 3EPHA 5CPJD 5CP6A 3AZND 4KUDD 5KDMB 3B6FA 3REIC 5AV5D 5CPIA 1WWSA 3C1BA 2AROA 3WA9A 5GSUC 2NQBD 3WKJC 2F8NK 1EQZD 4ZUXD 5DNNC 3REJB 1HQ3A 3H0MC 1ULYA 3W98A 3MVDA 1U35B 4WU8D 3W96C 1M19A 5B1LD 5B32G 3F6TA 3AZLC 1S32D 2Y2GA 5B32D 2FFFB 3AZKA 3AZGC 2NZDC 3AZMC 3TU4C 5CPID 3MGPC 1P3MA 3LZ0A 5JRGC 3C1BD 1AOID 2PYOB 3VH6T 1KX5C 3AZHA 3MGQC 1TZYB 5B2IA 4XUJA 5AVCD 3KUYC 3AYWB 3AZMB 4J8VB 3MVDD 3W98D 5B40A 1P3GB 4UUZB 1M19D 5B33A 3H0RC 2RIQA 1KU5A 5BS7C 4J8XA 3A6NB 1P3PB 1M18A 1JFIB 4H9QA 5B31A 3KWQD 3B0DC 3LZ0D 1P3AB 5BT1C 5B1MD 5AV6A 4KGCC 1KX3B 3AZHD 2XD1A 3REIA 1ID3B 1P3OD 3X1UA 1F66B 4X23B 2UWXA 3B0BA 4KGCB 3WKJA 5B24A 5FUGB 3RELC 3VH5T 3AZEC 1P34B 1M18D 1H3OA 3LJAC 5JA4B 3FDDA 4JJNA 5CPJC 4WU9B 5G49B 2FJ7A 2Y2PA 4R8PB 4G91C 3REID 2NZDA 5AVBC 3X1SB 3MGPA 4H9PA 4H9NA 3X1VC 5CPJB 5GSUD 5F99C 3WKJD 3AZNB 1KX5A 2HIOC 1KX4A 3MGQA 5AV5B 5DNND 3KXBA 4M6BA 3W96D 2NQBB 3UTAC 1EQZB 3AZLD 5CP6C 4ZUXB 2ZY4A 5BNVB 3B6FC 4WU8B 5CPIC 4DRAA 3AZGD 5BS7A 2NZDD 1F1EA 5B1LB 5B2JA 2J8PA 3MGPD 3TU4D 3AZFC 2AROC 5JRGD 3AZMD 1S32B 3WA9C 4NFTA 3AZJC 1B67A 2YFWA 1KX5D 1P3BC 1HQ3C 5AV9C 3MGQD 5CPIB 3KUYD 3C1BB 1AOIB 1M19C 3W97A 5B0ZC 2BYKB 2CWEA 4WV4B 5AVCB 3AZKC 3W98B 3MVDB 3LZ1C 1M1AA 1P3MC 1M19B 5GT3C 5BT1D 2HUEC 4KGCD 5CHLB 5B2IC 4XUJC 2Y2IA 3KWQB 3LZ0B 5B40C 5B1MB 1BH9A 5B33C 4J8WA 3REHA 3X1VA 2HUEB 3R45B 5BNXA 3AZHB 3P5JB 3RELD 1P3OB 4QLCC 4J8XC 3AZED 4J8UA 5B31C 5B40B 3LJAD 5AV6C 3UTAA 4LD9A 2L5AA 5GXQA 1W2EA 2CV5A 4HGAC 1TAFA 4J8XB 1M18B 1HTAA 3NQJA 4H9QB 4Z2MG 4WZSB 3X1UC 1P3LC 5AVBD 3AZFA 3V9RB 5B24C 3AZJA 3AN2A 3X1VD 2F2AC 5F99D 2ZY2A 5AV8C 1P3BA 2HIOD 5AV9A 3REIB 1T3UA 3C1CA 3A1IA 3LELA 3EG5B 4JJNC 1Z2CB 5GSUB 4CSRB 4UPKA 5B0ZA 4Z66C 2FJ7C 3WKJB 3UTAD 5CP6D 4H9RB 5DNNB 3B6FD 4CAYA 4DRBA 3LZ1A 3W96B 5B0YA 1WWIA 3AZFD 3AZLB 2AROD 3WA9D 5GT3A 3AZJD 1KX4C 3B6GC 3AZGB 1P3BD 2NZDB 3W99A 1HQ3D 2JE5A 5AV9D 3KXBC 3TU4B 3MGPB 5JRGB 4H9PB 4H9NB 2BYMB 2BG1A 5B0ZD 1KX5B 4YM6C 3MGQB 3NQUB 4KHAA 4ZBJC 1P3FA 3KUYB 4NE5A 4QLCA 3AZKD 2Y2QA 5B2JC 3LZ1D 3AZIA 1P3MD 4H9SA 2IO5C 4WNNA 5GT3D 2YFVA 3MGSA 3UTBA 3MGRA 2RVQC 5B2ID 4XUJD 1P3LA 3B0DB 5B40D 3W97C 4NE6A 2JCHA 5B33D 2YFWB 5AY8A 4Z5TA 5AV8A 1M1AC 4QLCD 5B31G 4J8XD 4DQYB 5KDMA 2VQRA 5B31D 3B0CW 3O62C 5AV6D 4Z66A 3RELB 3WTPE 3AZEB 1P3KC 4EO5C 3LJAB 3X1UD 1P3LD 2F8NA 4J8WC 5BO0A 3REHC 5B24D 3AFAC 3B6GA 5AV8D 4G91B 4J8UC 5AVBB 1BH9B 3X1TA 3REHB 4JJND 3X1VB 5F99B 4LD9C 5GXQC 4Z66D 2FJ7D 2HIOB 4YM6A 2CV5C 3MNNC 1P3IA 2ZM5A 2G5HC 2F8NG 4YS3C 4G92C 5GT0C 3AYWA 2F8ND 4J8VA 3UTAB 3AN2C 5GXQB 5CP6B 4UUZA 3B6FB 1KX4D 1TAFB 3B6GD 3C1CC 3KXBD 2Y2LA 3LELC 3AZFB 2AROB 3WA9B 1P3PA 5DNMA 3AZJB 3AV2C 1P3AA 1P3BB 1HQ3B 5AV9B 4YM6D
chains in the Genus database with same CATH topology
4NE3A 5B0YC 5B2JD 3O62A 1ID3A 3WTPC 5B0ZB 3KFUG 3KSYA 4X23A 3H0LC 3AZKB 3W99C 3LZ1B 2RVQD 1P3MB 1P3KA 3AV1C 5GT3B 1P34A 4XZQA 3W97D 3REKC 5E5AC 3AFAA 1P3FC 5B2IB 4XUJB 1N1JA 5G49A 4WU9A 3AZIC 5CPKC 1M1AD 4H9SC 3O62D 4R8PA 4H9OA 5B33B 3X1SA 4KHAB 3MGSC 3UTBC 3MGRC 3MNNA 4QLCB 3AZNA 4KUDA 2Y2MA 5B31B 3AZIB 1P3KD 1ZLAC 4YS3A 5AV6B 5GT0A 4WNNB 4J8WD 4XZQD 3EPLA 3REHD 2YFVB 5AY8C 3MGSB 3UT9C 2NQBA 4Z5TC 3AFAD 4HGAB 3B0CT 4ZUXA 3EPKA 3X1UB 1P3LB 4J8UD 4AWLC 2G5IC 4WU8A 1R4VA 5B24B 5B1LA 4LD9D 3AV2A 1S32A 5GXQD 4Z5TB 5AV8B 5B32A 3WAAA 2CV5D 3MNND 1H3OB 4AWLB 3REJC 4JJNB 1BH8A 1U35C 4YS3D 3WTPA 4Z66B 1AOIA 5GT0D 2FJ7B 3AN2D 4Z2MH 2BYKA 5AVCA 3C1CD 2F8NB 3LELD 3AV1A 3X1TC 5BO0B 3REKA 5E5AA 1KX4B 2PYOC 3AV2D 3B6GB 3WAAD 1P3IC 2Y2JA 3KXBB 5CPKA 1TZYC 5B0YD 3AYWC 1A7WA 3KWQA 4J8VC 2ZY3A 3X1TB 3WTPD 1P3GC 5B1MA 4YM6B 4ZBJB 1P3IB 3R45A 3W99D 5B2JB 1P3OA 1ZLAA 1P3PC 3A6NC 2Y2OA 5DNMC 3AV1D 2IO5B 3REKD 1P3AC 5E5AD 3UT9A 2LY8A 1KX3C 1P3FD 3AZID 5CPKD 3EPJA 1ID3C 3W97B 5DNMB 1F66C 4X23C 3V9RA 3MGSD 3UTBD 1M1AB 2DQNC 3MGRD 3O62B 3REJA 1ZLAD 1P34C 1U35A 4XZQC 2W8SA 5GSUA 5AY8D 4CSRA 3UT9D 4Z5TD 4WU9C 1P3KB 2JSSA 4EO5B 4H9RA 5DNNA 4R8PC 4J8WB 2Y2HA 4E45A 4XZQB 3W96A 3X1SC 5BNXB 3AFAB 2PYOA 3AZLA 1N1JB 3AZNC 4KUDC 4J8UB 5AV5C 3AZGA 1TZYA 3REJD 4H9OB 3AZMA 3IP4C 3TU4A 4LD9B 1U35D 5JRGA 1P3GA 2NQBC 2BYMA 3MNNB 2CV5B 1EQZC 3NQJB 4KUDB 4ZUXC 4E44A 3NQUA 3VH6W 4WU8C 3KUYA 4YS3B 4G92B 5GT0B 1JFIA 3A6NA 3AN2B 3X1TD 5B1LC 1S32C 1PZRA 3WAAC 5B32C 2PYOD 3VH6A 3AL0C 1KX3A 1P3ID 3C1CB 3LELB 5C3IC 1TZYD 3C1BC 3AYWD 1AOIC 4J8VD 3AV2B 1F66A 1P3GD 5B32B 3WAAB 4KGCA 4CAYB 2F8NH 2ZY5A 5FUGA 5B0YB 5AVCC 5C3IB 3W98C 1BH8B 3MVDC 3WTPB 1P3PD 3A6ND 5DNMD 5JA4A 3A1KA 1P3AD 3W99B 3RELA 1KX3D 3AZEA 3AV1B 3KWQC 3VH5W 1ID3D 3LZ0C 3REKB 1Q9CA 5E5AB 5B1MC 3LJAA 2DF4C 1F66D 1BFMA 4X23D 1P3FB 5CPJA 3AZHC 1B6WA 3VH5A 5CPKB 5AV5A 1P3OC 5AVBA 1P34D 2XD5A 3UTBB 3MGRB 5F99A 1EQZA 4WU9D 2Y2NA 2HIOA 5BNVA 1ZLAB 1M18C 4R8PD 2Y2KA 3X1SD 5AY8B 3UT9B 4WJ3C 3EPHA 5CPJD 5CP6A 3AZND 4KUDD 5KDMB 3B6FA 3REIC 5AV5D 5CPIA 1WWSA 3C1BA 2AROA 3WA9A 5GSUC 2NQBD 3WKJC 2F8NK 1EQZD 4ZUXD 5DNNC 3REJB 1HQ3A 3H0MC 1ULYA 3W98A 3MVDA 1U35B 4WU8D 3W96C 1M19A 5B1LD 5B32G 3F6TA 3AZLC 1S32D 2Y2GA 5B32D 2FFFB 3AZKA 3AZGC 2NZDC 3AZMC 3TU4C 5CPID 3MGPC 1P3MA 3LZ0A 5JRGC 3C1BD 1AOID 2PYOB 3VH6T 1KX5C 3AZHA 3MGQC 1TZYB 5B2IA 4XUJA 5AVCD 3KUYC 3AYWB 3AZMB 4J8VB 3MVDD 3W98D 5B40A 1P3GB 4UUZB 1M19D 5B33A 3H0RC 2RIQA 1KU5A 5BS7C 4J8XA 3A6NB 1P3PB 1M18A 1JFIB 4H9QA 5B31A 3KWQD 3B0DC 3LZ0D 1P3AB 5BT1C 5B1MD 5AV6A 4KGCC 1KX3B 3AZHD 2XD1A 3REIA 1ID3B 1P3OD 3X1UA 1F66B 4X23B 2UWXA 3B0BA 4KGCB 3WKJA 5B24A 5FUGB 3RELC 3VH5T 3AZEC 1P34B 1M18D 1H3OA 3LJAC 5JA4B 3FDDA 4JJNA 5CPJC 4WU9B 5G49B 2FJ7A 2Y2PA 4R8PB 4G91C 3REID 2NZDA 5AVBC 3X1SB 3MGPA 4H9PA 4H9NA 3X1VC 5CPJB 5GSUD 5F99C 3WKJD 3AZNB 1KX5A 2HIOC 1KX4A 3MGQA 5AV5B 5DNND 3KXBA 4M6BA 3W96D 2NQBB 3UTAC 1EQZB 3AZLD 5CP6C 4ZUXB 2ZY4A 5BNVB 3B6FC 4WU8B 5CPIC 4DRAA 3AZGD 5BS7A 2NZDD 1F1EA 5B1LB 5B2JA 2J8PA 3MGPD 3TU4D 3AZFC 2AROC 5JRGD 3AZMD 1S32B 3WA9C 4NFTA 3AZJC 1B67A 2YFWA 1KX5D 1P3BC 1HQ3C 5AV9C 3MGQD 5CPIB 3KUYD 3C1BB 1AOIB 1M19C 3W97A 5B0ZC 2BYKB 2CWEA 4WV4B 5AVCB 3AZKC 3W98B 3MVDB 3LZ1C 1M1AA 1P3MC 1M19B 5GT3C 5BT1D 2HUEC 4KGCD 5CHLB 5B2IC 4XUJC 2Y2IA 3KWQB 3LZ0B 5B40C 5B1MB 1BH9A 5B33C 4J8WA 3REHA 3X1VA 2HUEB 3R45B 5BNXA 3AZHB 3P5JB 3RELD 1P3OB 4QLCC 4J8XC 3AZED 4J8UA 5B31C 5B40B 3LJAD 5AV6C 3UTAA 4LD9A 2L5AA 5GXQA 1W2EA 2CV5A 4HGAC 1TAFA 4J8XB 1M18B 1HTAA 3NQJA 4H9QB 4Z2MG 4WZSB 3X1UC 1P3LC 5AVBD 3AZFA 3V9RB 5B24C 3AZJA 3AN2A 3X1VD 2F2AC 5F99D 2ZY2A 5AV8C 1P3BA 2HIOD 5AV9A 3REIB 1T3UA 3C1CA 3A1IA 3LELA 3EG5B 4JJNC 1Z2CB 5GSUB 4CSRB 4UPKA 5B0ZA 4Z66C 2FJ7C 3WKJB 3UTAD 5CP6D 4H9RB 5DNNB 3B6FD 4CAYA 4DRBA 3LZ1A 3W96B 5B0YA 1WWIA 3AZFD 3AZLB 2AROD 3WA9D 5GT3A 3AZJD 1KX4C 3B6GC 3AZGB 1P3BD 2NZDB 3W99A 1HQ3D 2JE5A 5AV9D 3KXBC 3TU4B 3MGPB 5JRGB 4H9PB 4H9NB 2BYMB 2BG1A 5B0ZD 1KX5B 4YM6C 3MGQB 3NQUB 4KHAA 4ZBJC 1P3FA 3KUYB 4NE5A 4QLCA 3AZKD 2Y2QA 5B2JC 3LZ1D 3AZIA 1P3MD 4H9SA 2IO5C 4WNNA 5GT3D 2YFVA 3MGSA 3UTBA 3MGRA 2RVQC 5B2ID 4XUJD 1P3LA 3B0DB 5B40D 3W97C 4NE6A 2JCHA 5B33D 2YFWB 5AY8A 4Z5TA 5AV8A 1M1AC 4QLCD 5B31G 4J8XD 4DQYB 5KDMA 2VQRA 5B31D 3B0CW 3O62C 5AV6D 4Z66A 3RELB 3WTPE 3AZEB 1P3KC 4EO5C 3LJAB 3X1UD 1P3LD 2F8NA 4J8WC 5BO0A 3REHC 5B24D 3AFAC 3B6GA 5AV8D 4G91B 4J8UC 5AVBB 1BH9B 3X1TA 3REHB 4JJND 3X1VB 5F99B 4LD9C 5GXQC 4Z66D 2FJ7D 2HIOB 4YM6A 2CV5C 3MNNC 1P3IA 2ZM5A 2G5HC 2F8NG 4YS3C 4G92C 5GT0C 3AYWA 2F8ND 4J8VA 3UTAB 3AN2C 5GXQB 5CP6B 4UUZA 3B6FB 1KX4D 1TAFB 3B6GD 3C1CC 3KXBD 2Y2LA 3LELC 3AZFB 2AROB 3WA9B 1P3PA 5DNMA 3AZJB 3AV2C 1P3AA 1P3BB 1HQ3B 5AV9B 4YM6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0R C;  3AL0 C;  2G5I C;  3H0M C;  4WJ3 C;  2G5H C;  2DQN C;  3A1K A;  3KFU G;  3A1I A;  3IP4 C;  3H0L C;  2DF4 C;  2F2A C; 
#chains in the Genus database with same CATH topology
 4NE3 A;  5B0Y C;  5B2J D;  3O62 A;  1ID3 A;  3WTP C;  5B0Z B;  3KFU G;  3KSY A;  4X23 A;  3H0L C;  3AZK B;  3W99 C;  3LZ1 B;  2RVQ D;  1P3M B;  1P3K A;  3AV1 C;  5GT3 B;  1P34 A;  4XZQ A;  3W97 D;  3REK C;  5E5A C;  3AFA A;  1P3F C;  5B2I B;  4XUJ B;  1N1J A;  5G49 A;  4WU9 A;  3AZI C;  5CPK C;  1M1A D;  4H9S C;  3O62 D;  4R8P A;  4H9O A;  5B33 B;  3X1S A;  4KHA B;  3MGS C;  3UTB C;  3MGR C;  3MNN A;  4QLC B;  3AZN A;  4KUD A;  2Y2M A;  5B31 B;  3AZI B;  1P3K D;  1ZLA C;  4YS3 A;  5AV6 B;  5GT0 A;  4WNN B;  4J8W D;  4XZQ D;  3EPL A;  3REH D;  2YFV B;  5AY8 C;  3MGS B;  3UT9 C;  2NQB A;  4Z5T C;  3AFA D;  4HGA B;  3B0C T;  4ZUX A;  3EPK A;  3X1U B;  1P3L B;  4J8U D;  4AWL C;  2G5I C;  4WU8 A;  1R4V A;  5B24 B;  5B1L A;  4LD9 D;  3AV2 A;  1S32 A;  5GXQ D;  4Z5T B;  5AV8 B;  5B32 A;  3WAA A;  2CV5 D;  3MNN D;  1H3O B;  4AWL B;  3REJ C;  4JJN B;  1BH8 A;  1U35 C;  4YS3 D;  3WTP A;  4Z66 B;  1AOI A;  5GT0 D;  2FJ7 B;  3AN2 D;  4Z2M H;  2BYK A;  5AVC A;  3C1C D;  2F8N B;  3LEL D;  3AV1 A;  3X1T C;  5BO0 B;  3REK A;  5E5A A;  1KX4 B;  2PYO C;  3AV2 D;  3B6G B;  3WAA D;  1P3I C;  2Y2J A;  3KXB B;  5CPK A;  1TZY C;  5B0Y D;  3AYW C;  1A7W A;  3KWQ A;  4J8V C;  2ZY3 A;  3X1T B;  3WTP D;  1P3G C;  5B1M A;  4YM6 B;  4ZBJ B;  1P3I B;  3R45 A;  3W99 D;  5B2J B;  1P3O A;  1ZLA A;  1P3P C;  3A6N C;  2Y2O A;  5DNM C;  3AV1 D;  2IO5 B;  3REK D;  1P3A C;  5E5A D;  3UT9 A;  2LY8 A;  1KX3 C;  1P3F D;  3AZI D;  5CPK D;  3EPJ A;  1ID3 C;  3W97 B;  5DNM B;  1F66 C;  4X23 C;  3V9R A;  3MGS D;  3UTB D;  1M1A B;  2DQN C;  3MGR D;  3O62 B;  3REJ A;  1ZLA D;  1P34 C;  1U35 A;  4XZQ C;  2W8S A;  5GSU A;  5AY8 D;  4CSR A;  3UT9 D;  4Z5T D;  4WU9 C;  1P3K B;  2JSS A;  4EO5 B;  4H9R A;  5DNN A;  4R8P C;  4J8W B;  2Y2H A;  4E45 A;  4XZQ B;  3W96 A;  3X1S C;  5BNX B;  3AFA B;  2PYO A;  3AZL A;  1N1J B;  3AZN C;  4KUD C;  4J8U B;  5AV5 C;  3AZG A;  1TZY A;  3REJ D;  4H9O B;  3AZM A;  3IP4 C;  3TU4 A;  4LD9 B;  1U35 D;  5JRG A;  1P3G A;  2NQB C;  2BYM A;  3MNN B;  2CV5 B;  1EQZ C;  3NQJ B;  4KUD B;  4ZUX C;  4E44 A;  3NQU A;  3VH6 W;  4WU8 C;  3KUY A;  4YS3 B;  4G92 B;  5GT0 B;  1JFI A;  3A6N A;  3AN2 B;  3X1T D;  5B1L C;  1S32 C;  1PZR A;  3WAA C;  5B32 C;  2PYO D;  3VH6 A;  3AL0 C;  1KX3 A;  1P3I D;  3C1C B;  3LEL B;  5C3I C;  1TZY D;  3C1B C;  3AYW D;  1AOI C;  4J8V D;  3AV2 B;  1F66 A;  1P3G D;  5B32 B;  3WAA B;  4KGC A;  4CAY B;  2F8N H;  2ZY5 A;  5FUG A;  5B0Y B;  5AVC C;  5C3I B;  3W98 C;  1BH8 B;  3MVD C;  3WTP B;  1P3P D;  3A6N D;  5DNM D;  5JA4 A;  3A1K A;  1P3A D;  3W99 B;  3REL A;  1KX3 D;  3AZE A;  3AV1 B;  3KWQ C;  3VH5 W;  1ID3 D;  3LZ0 C;  3REK B;  1Q9C A;  5E5A B;  5B1M C;  3LJA A;  2DF4 C;  1F66 D;  1BFM A;  4X23 D;  1P3F B;  5CPJ A;  3AZH C;  1B6W A;  3VH5 A;  5CPK B;  5AV5 A;  1P3O C;  5AVB A;  1P34 D;  2XD5 A;  3UTB B;  3MGR B;  5F99 A;  1EQZ A;  4WU9 D;  2Y2N A;  2HIO A;  5BNV A;  1ZLA B;  1M18 C;  4R8P D;  2Y2K A;  3X1S D;  5AY8 B;  3UT9 B;  4WJ3 C;  3EPH A;  5CPJ D;  5CP6 A;  3AZN D;  4KUD D;  5KDM B;  3B6F A;  3REI C;  5AV5 D;  5CPI A;  1WWS A;  3C1B A;  2ARO A;  3WA9 A;  5GSU C;  2NQB D;  3WKJ C;  2F8N K;  1EQZ D;  4ZUX D;  5DNN C;  3REJ B;  1HQ3 A;  3H0M C;  1ULY A;  3W98 A;  3MVD A;  1U35 B;  4WU8 D;  3W96 C;  1M19 A;  5B1L D;  5B32 G;  3F6T A;  3AZL C;  1S32 D;  2Y2G A;  5B32 D;  2FFF B;  3AZK A;  3AZG C;  2NZD C;  3AZM C;  3TU4 C;  5CPI D;  3MGP C;  1P3M A;  3LZ0 A;  5JRG C;  3C1B D;  1AOI D;  2PYO B;  3VH6 T;  1KX5 C;  3AZH A;  3MGQ C;  1TZY B;  5B2I A;  4XUJ A;  5AVC D;  3KUY C;  3AYW B;  3AZM B;  4J8V B;  3MVD D;  3W98 D;  5B40 A;  1P3G B;  4UUZ B;  1M19 D;  5B33 A;  3H0R C;  2RIQ A;  1KU5 A;  5BS7 C;  4J8X A;  3A6N B;  1P3P B;  1M18 A;  1JFI B;  4H9Q A;  5B31 A;  3KWQ D;  3B0D C;  3LZ0 D;  1P3A B;  5BT1 C;  5B1M D;  5AV6 A;  4KGC C;  1KX3 B;  3AZH D;  2XD1 A;  3REI A;  1ID3 B;  1P3O D;  3X1U A;  1F66 B;  4X23 B;  2UWX A;  3B0B A;  4KGC B;  3WKJ A;  5B24 A;  5FUG B;  3REL C;  3VH5 T;  3AZE C;  1P34 B;  1M18 D;  1H3O A;  3LJA C;  5JA4 B;  3FDD A;  4JJN A;  5CPJ C;  4WU9 B;  5G49 B;  2FJ7 A;  2Y2P A;  4R8P B;  4G91 C;  3REI D;  2NZD A;  5AVB C;  3X1S B;  3MGP A;  4H9P A;  4H9N A;  3X1V C;  5CPJ B;  5GSU D;  5F99 C;  3WKJ D;  3AZN B;  1KX5 A;  2HIO C;  1KX4 A;  3MGQ A;  5AV5 B;  5DNN D;  3KXB A;  4M6B A;  3W96 D;  2NQB B;  3UTA C;  1EQZ B;  3AZL D;  5CP6 C;  4ZUX B;  2ZY4 A;  5BNV B;  3B6F C;  4WU8 B;  5CPI C;  4DRA A;  3AZG D;  5BS7 A;  2NZD D;  1F1E A;  5B1L B;  5B2J A;  2J8P A;  3MGP D;  3TU4 D;  3AZF C;  2ARO C;  5JRG D;  3AZM D;  1S32 B;  3WA9 C;  4NFT A;  3AZJ C;  1B67 A;  2YFW A;  1KX5 D;  1P3B C;  1HQ3 C;  5AV9 C;  3MGQ D;  5CPI B;  3KUY D;  3C1B B;  1AOI B;  1M19 C;  3W97 A;  5B0Z C;  2BYK B;  2CWE A;  4WV4 B;  5AVC B;  3AZK C;  3W98 B;  3MVD B;  3LZ1 C;  1M1A A;  1P3M C;  1M19 B;  5GT3 C;  5BT1 D;  2HUE C;  4KGC D;  5CHL B;  5B2I C;  4XUJ C;  2Y2I A;  3KWQ B;  3LZ0 B;  5B40 C;  5B1M B;  1BH9 A;  5B33 C;  4J8W A;  3REH A;  3X1V A;  2HUE B;  3R45 B;  5BNX A;  3AZH B;  3P5J B;  3REL D;  1P3O B;  4QLC C;  4J8X C;  3AZE D;  4J8U A;  5B31 C;  5B40 B;  3LJA D;  5AV6 C;  3UTA A;  4LD9 A;  2L5A A;  5GXQ A;  1W2E A;  2CV5 A;  4HGA C;  1TAF A;  4J8X B;  1M18 B;  1HTA A;  3NQJ A;  4H9Q B;  4Z2M G;  4WZS B;  3X1U C;  1P3L C;  5AVB D;  3AZF A;  3V9R B;  5B24 C;  3AZJ A;  3AN2 A;  3X1V D;  2F2A C;  5F99 D;  2ZY2 A;  5AV8 C;  1P3B A;  2HIO D;  5AV9 A;  3REI B;  1T3U A;  3C1C A;  3A1I A;  3LEL A;  3EG5 B;  4JJN C;  1Z2C B;  5GSU B;  4CSR B;  4UPK A;  5B0Z A;  4Z66 C;  2FJ7 C;  3WKJ B;  3UTA D;  5CP6 D;  4H9R B;  5DNN B;  3B6F D;  4CAY A;  4DRB A;  3LZ1 A;  3W96 B;  5B0Y A;  1WWI A;  3AZF D;  3AZL B;  2ARO D;  3WA9 D;  5GT3 A;  3AZJ D;  1KX4 C;  3B6G C;  3AZG B;  1P3B D;  2NZD B;  3W99 A;  1HQ3 D;  2JE5 A;  5AV9 D;  3KXB C;  3TU4 B;  3MGP B;  5JRG B;  4H9P B;  4H9N B;  2BYM B;  2BG1 A;  5B0Z D;  1KX5 B;  4YM6 C;  3MGQ B;  3NQU B;  4KHA A;  4ZBJ C;  1P3F A;  3KUY B;  4NE5 A;  4QLC A;  3AZK D;  2Y2Q A;  5B2J C;  3LZ1 D;  3AZI A;  1P3M D;  4H9S A;  2IO5 C;  4WNN A;  5GT3 D;  2YFV A;  3MGS A;  3UTB A;  3MGR A;  2RVQ C;  5B2I D;  4XUJ D;  1P3L A;  3B0D B;  5B40 D;  3W97 C;  4NE6 A;  2JCH A;  5B33 D;  2YFW B;  5AY8 A;  4Z5T A;  5AV8 A;  1M1A C;  4QLC D;  5B31 G;  4J8X D;  4DQY B;  5KDM A;  2VQR A;  5B31 D;  3B0C W;  3O62 C;  5AV6 D;  4Z66 A;  3REL B;  3WTP E;  3AZE B;  1P3K C;  4EO5 C;  3LJA B;  3X1U D;  1P3L D;  2F8N A;  4J8W C;  5BO0 A;  3REH C;  5B24 D;  3AFA C;  3B6G A;  5AV8 D;  4G91 B;  4J8U C;  5AVB B;  1BH9 B;  3X1T A;  3REH B;  4JJN D;  3X1V B;  5F99 B;  4LD9 C;  5GXQ C;  4Z66 D;  2FJ7 D;  2HIO B;  4YM6 A;  2CV5 C;  3MNN C;  1P3I A;  2ZM5 A;  2G5H C;  2F8N G;  4YS3 C;  4G92 C;  5GT0 C;  3AYW A;  2F8N D;  4J8V A;  3UTA B;  3AN2 C;  5GXQ B;  5CP6 B;  4UUZ A;  3B6F B;  1KX4 D;  1TAF B;  3B6G D;  3C1C C;  3KXB D;  2Y2L A;  3LEL C;  3AZF B;  2ARO B;  3WA9 B;  1P3P A;  5DNM A;  3AZJ B;  3AV2 C;  1P3A A;  1P3B B;  1HQ3 B;  5AV9 B;  4YM6 D; 
#chains in the Genus database with same CATH homology
 4NE3 A;  5B0Y C;  5B2J D;  3O62 A;  1ID3 A;  3WTP C;  5B0Z B;  3KFU G;  3KSY A;  4X23 A;  3H0L C;  3AZK B;  3W99 C;  3LZ1 B;  2RVQ D;  1P3M B;  1P3K A;  3AV1 C;  5GT3 B;  1P34 A;  4XZQ A;  3W97 D;  3REK C;  5E5A C;  3AFA A;  1P3F C;  5B2I B;  4XUJ B;  1N1J A;  5G49 A;  4WU9 A;  3AZI C;  5CPK C;  1M1A D;  4H9S C;  3O62 D;  4R8P A;  4H9O A;  5B33 B;  3X1S A;  4KHA B;  3MGS C;  3UTB C;  3MGR C;  3MNN A;  4QLC B;  3AZN A;  4KUD A;  2Y2M A;  5B31 B;  3AZI B;  1P3K D;  1ZLA C;  4YS3 A;  5AV6 B;  5GT0 A;  4WNN B;  4J8W D;  4XZQ D;  3EPL A;  3REH D;  2YFV B;  5AY8 C;  3MGS B;  3UT9 C;  2NQB A;  4Z5T C;  3AFA D;  4HGA B;  3B0C T;  4ZUX A;  3EPK A;  3X1U B;  1P3L B;  4J8U D;  4AWL C;  2G5I C;  4WU8 A;  1R4V A;  5B24 B;  5B1L A;  4LD9 D;  3AV2 A;  1S32 A;  5GXQ D;  4Z5T B;  5AV8 B;  5B32 A;  3WAA A;  2CV5 D;  3MNN D;  1H3O B;  4AWL B;  3REJ C;  4JJN B;  1BH8 A;  1U35 C;  4YS3 D;  3WTP A;  4Z66 B;  1AOI A;  5GT0 D;  2FJ7 B;  3AN2 D;  4Z2M H;  2BYK A;  5AVC A;  3C1C D;  2F8N B;  3LEL D;  3AV1 A;  3X1T C;  5BO0 B;  3REK A;  5E5A A;  1KX4 B;  2PYO C;  3AV2 D;  3B6G B;  3WAA D;  1P3I C;  2Y2J A;  3KXB B;  5CPK A;  1TZY C;  5B0Y D;  3AYW C;  1A7W A;  3KWQ A;  4J8V C;  2ZY3 A;  3X1T B;  3WTP D;  1P3G C;  5B1M A;  4YM6 B;  4ZBJ B;  1P3I B;  3R45 A;  3W99 D;  5B2J B;  1P3O A;  1ZLA A;  1P3P C;  3A6N C;  2Y2O A;  5DNM C;  3AV1 D;  2IO5 B;  3REK D;  1P3A C;  5E5A D;  3UT9 A;  2LY8 A;  1KX3 C;  1P3F D;  3AZI D;  5CPK D;  3EPJ A;  1ID3 C;  3W97 B;  5DNM B;  1F66 C;  4X23 C;  3V9R A;  3MGS D;  3UTB D;  1M1A B;  2DQN C;  3MGR D;  3O62 B;  3REJ A;  1ZLA D;  1P34 C;  1U35 A;  4XZQ C;  2W8S A;  5GSU A;  5AY8 D;  4CSR A;  3UT9 D;  4Z5T D;  4WU9 C;  1P3K B;  2JSS A;  4EO5 B;  4H9R A;  5DNN A;  4R8P C;  4J8W B;  2Y2H A;  4E45 A;  4XZQ B;  3W96 A;  3X1S C;  5BNX B;  3AFA B;  2PYO A;  3AZL A;  1N1J B;  3AZN C;  4KUD C;  4J8U B;  5AV5 C;  3AZG A;  1TZY A;  3REJ D;  4H9O B;  3AZM A;  3IP4 C;  3TU4 A;  4LD9 B;  1U35 D;  5JRG A;  1P3G A;  2NQB C;  2BYM A;  3MNN B;  2CV5 B;  1EQZ C;  3NQJ B;  4KUD B;  4ZUX C;  4E44 A;  3NQU A;  3VH6 W;  4WU8 C;  3KUY A;  4YS3 B;  4G92 B;  5GT0 B;  1JFI A;  3A6N A;  3AN2 B;  3X1T D;  5B1L C;  1S32 C;  1PZR A;  3WAA C;  5B32 C;  2PYO D;  3VH6 A;  3AL0 C;  1KX3 A;  1P3I D;  3C1C B;  3LEL B;  5C3I C;  1TZY D;  3C1B C;  3AYW D;  1AOI C;  4J8V D;  3AV2 B;  1F66 A;  1P3G D;  5B32 B;  3WAA B;  4KGC A;  4CAY B;  2F8N H;  2ZY5 A;  5FUG A;  5B0Y B;  5AVC C;  5C3I B;  3W98 C;  1BH8 B;  3MVD C;  3WTP B;  1P3P D;  3A6N D;  5DNM D;  5JA4 A;  3A1K A;  1P3A D;  3W99 B;  3REL A;  1KX3 D;  3AZE A;  3AV1 B;  3KWQ C;  3VH5 W;  1ID3 D;  3LZ0 C;  3REK B;  1Q9C A;  5E5A B;  5B1M C;  3LJA A;  2DF4 C;  1F66 D;  1BFM A;  4X23 D;  1P3F B;  5CPJ A;  3AZH C;  1B6W A;  3VH5 A;  5CPK B;  5AV5 A;  1P3O C;  5AVB A;  1P34 D;  2XD5 A;  3UTB B;  3MGR B;  5F99 A;  1EQZ A;  4WU9 D;  2Y2N A;  2HIO A;  5BNV A;  1ZLA B;  1M18 C;  4R8P D;  2Y2K A;  3X1S D;  5AY8 B;  3UT9 B;  4WJ3 C;  3EPH A;  5CPJ D;  5CP6 A;  3AZN D;  4KUD D;  5KDM B;  3B6F A;  3REI C;  5AV5 D;  5CPI A;  1WWS A;  3C1B A;  2ARO A;  3WA9 A;  5GSU C;  2NQB D;  3WKJ C;  2F8N K;  1EQZ D;  4ZUX D;  5DNN C;  3REJ B;  1HQ3 A;  3H0M C;  1ULY A;  3W98 A;  3MVD A;  1U35 B;  4WU8 D;  3W96 C;  1M19 A;  5B1L D;  5B32 G;  3F6T A;  3AZL C;  1S32 D;  2Y2G A;  5B32 D;  2FFF B;  3AZK A;  3AZG C;  2NZD C;  3AZM C;  3TU4 C;  5CPI D;  3MGP C;  1P3M A;  3LZ0 A;  5JRG C;  3C1B D;  1AOI D;  2PYO B;  3VH6 T;  1KX5 C;  3AZH A;  3MGQ C;  1TZY B;  5B2I A;  4XUJ A;  5AVC D;  3KUY C;  3AYW B;  3AZM B;  4J8V B;  3MVD D;  3W98 D;  5B40 A;  1P3G B;  4UUZ B;  1M19 D;  5B33 A;  3H0R C;  2RIQ A;  1KU5 A;  5BS7 C;  4J8X A;  3A6N B;  1P3P B;  1M18 A;  1JFI B;  4H9Q A;  5B31 A;  3KWQ D;  3B0D C;  3LZ0 D;  1P3A B;  5BT1 C;  5B1M D;  5AV6 A;  4KGC C;  1KX3 B;  3AZH D;  2XD1 A;  3REI A;  1ID3 B;  1P3O D;  3X1U A;  1F66 B;  4X23 B;  2UWX A;  3B0B A;  4KGC B;  3WKJ A;  5B24 A;  5FUG B;  3REL C;  3VH5 T;  3AZE C;  1P34 B;  1M18 D;  1H3O A;  3LJA C;  5JA4 B;  3FDD A;  4JJN A;  5CPJ C;  4WU9 B;  5G49 B;  2FJ7 A;  2Y2P A;  4R8P B;  4G91 C;  3REI D;  2NZD A;  5AVB C;  3X1S B;  3MGP A;  4H9P A;  4H9N A;  3X1V C;  5CPJ B;  5GSU D;  5F99 C;  3WKJ D;  3AZN B;  1KX5 A;  2HIO C;  1KX4 A;  3MGQ A;  5AV5 B;  5DNN D;  3KXB A;  4M6B A;  3W96 D;  2NQB B;  3UTA C;  1EQZ B;  3AZL D;  5CP6 C;  4ZUX B;  2ZY4 A;  5BNV B;  3B6F C;  4WU8 B;  5CPI C;  4DRA A;  3AZG D;  5BS7 A;  2NZD D;  1F1E A;  5B1L B;  5B2J A;  2J8P A;  3MGP D;  3TU4 D;  3AZF C;  2ARO C;  5JRG D;  3AZM D;  1S32 B;  3WA9 C;  4NFT A;  3AZJ C;  1B67 A;  2YFW A;  1KX5 D;  1P3B C;  1HQ3 C;  5AV9 C;  3MGQ D;  5CPI B;  3KUY D;  3C1B B;  1AOI B;  1M19 C;  3W97 A;  5B0Z C;  2BYK B;  2CWE A;  4WV4 B;  5AVC B;  3AZK C;  3W98 B;  3MVD B;  3LZ1 C;  1M1A A;  1P3M C;  1M19 B;  5GT3 C;  5BT1 D;  2HUE C;  4KGC D;  5CHL B;  5B2I C;  4XUJ C;  2Y2I A;  3KWQ B;  3LZ0 B;  5B40 C;  5B1M B;  1BH9 A;  5B33 C;  4J8W A;  3REH A;  3X1V A;  2HUE B;  3R45 B;  5BNX A;  3AZH B;  3P5J B;  3REL D;  1P3O B;  4QLC C;  4J8X C;  3AZE D;  4J8U A;  5B31 C;  5B40 B;  3LJA D;  5AV6 C;  3UTA A;  4LD9 A;  2L5A A;  5GXQ A;  1W2E A;  2CV5 A;  4HGA C;  1TAF A;  4J8X B;  1M18 B;  1HTA A;  3NQJ A;  4H9Q B;  4Z2M G;  4WZS B;  3X1U C;  1P3L C;  5AVB D;  3AZF A;  3V9R B;  5B24 C;  3AZJ A;  3AN2 A;  3X1V D;  2F2A C;  5F99 D;  2ZY2 A;  5AV8 C;  1P3B A;  2HIO D;  5AV9 A;  3REI B;  1T3U A;  3C1C A;  3A1I A;  3LEL A;  3EG5 B;  4JJN C;  1Z2C B;  5GSU B;  4CSR B;  4UPK A;  5B0Z A;  4Z66 C;  2FJ7 C;  3WKJ B;  3UTA D;  5CP6 D;  4H9R B;  5DNN B;  3B6F D;  4CAY A;  4DRB A;  3LZ1 A;  3W96 B;  5B0Y A;  1WWI A;  3AZF D;  3AZL B;  2ARO D;  3WA9 D;  5GT3 A;  3AZJ D;  1KX4 C;  3B6G C;  3AZG B;  1P3B D;  2NZD B;  3W99 A;  1HQ3 D;  2JE5 A;  5AV9 D;  3KXB C;  3TU4 B;  3MGP B;  5JRG B;  4H9P B;  4H9N B;  2BYM B;  2BG1 A;  5B0Z D;  1KX5 B;  4YM6 C;  3MGQ B;  3NQU B;  4KHA A;  4ZBJ C;  1P3F A;  3KUY B;  4NE5 A;  4QLC A;  3AZK D;  2Y2Q A;  5B2J C;  3LZ1 D;  3AZI A;  1P3M D;  4H9S A;  2IO5 C;  4WNN A;  5GT3 D;  2YFV A;  3MGS A;  3UTB A;  3MGR A;  2RVQ C;  5B2I D;  4XUJ D;  1P3L A;  3B0D B;  5B40 D;  3W97 C;  4NE6 A;  2JCH A;  5B33 D;  2YFW B;  5AY8 A;  4Z5T A;  5AV8 A;  1M1A C;  4QLC D;  5B31 G;  4J8X D;  4DQY B;  5KDM A;  2VQR A;  5B31 D;  3B0C W;  3O62 C;  5AV6 D;  4Z66 A;  3REL B;  3WTP E;  3AZE B;  1P3K C;  4EO5 C;  3LJA B;  3X1U D;  1P3L D;  2F8N A;  4J8W C;  5BO0 A;  3REH C;  5B24 D;  3AFA C;  3B6G A;  5AV8 D;  4G91 B;  4J8U C;  5AVB B;  1BH9 B;  3X1T A;  3REH B;  4JJN D;  3X1V B;  5F99 B;  4LD9 C;  5GXQ C;  4Z66 D;  2FJ7 D;  2HIO B;  4YM6 A;  2CV5 C;  3MNN C;  1P3I A;  2ZM5 A;  2G5H C;  2F8N G;  4YS3 C;  4G92 C;  5GT0 C;  3AYW A;  2F8N D;  4J8V A;  3UTA B;  3AN2 C;  5GXQ B;  5CP6 B;  4UUZ A;  3B6F B;  1KX4 D;  1TAF B;  3B6G D;  3C1C C;  3KXB D;  2Y2L A;  3LEL C;  3AZF B;  2ARO B;  3WA9 B;  1P3P A;  5DNM A;  3AZJ B;  3AV2 C;  1P3A A;  1P3B B;  1HQ3 B;  5AV9 B;  4YM6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...