3H0RC

Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPERKDGFFVVPRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Insights into tRNA-Dependent Amidotransferase Evolution and Catalysis from the Structure of the Aquifex aeolicus Enzyme
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 18
structure length 91
sequence length 91
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3h0rC01
2G5IC 2DF4C 3A1IA 3IP4C 3H0LC 2F2AC 3H0RC 2DQNC 3H0MC 2G5HC 3A1KA 4WJ3C 3AL0C 3KFUG
chains in the Genus database with same CATH superfamily
2Y2LA 4WNNA 2XD1A 5AV9B 1P3PD 4H9SC 5KDMB 5B1LB 1S32A 3C1CC 3AZJB 2HIOD 4DQYB 4J8WC 1F66C 2Y2QA 4M6BA 5E5AB 3P5JB 1P3LA 5B1MB 1PZRA 2RVQC 3LJAD 3AZKB 4H9NA 1P3PA 3MGPB 5AV5B 4WV4B 5CP6C 1R4VA 1M1AD 4KUDC 2HIOA 3W98B 4AWLC 5AVCD 3AV2B 2HUEB 4G91C 4J8VD 2PYOD 3AV1D 5B31B 2F8NG 5B24D 3LELC 3LJAA 2Y2PA 4XZQD 2F8ND 3EPHA 3A6ND 1M1AA 1P34B 5B40A 5AVCA 1AOIB 1S32C 4J8VA 3UT9D 1P3KA 3AV1A 2BYKB 3REHD 3AN2C 5CPID 1P3LC 5B24A 4JJNB 1TAFA 5FUGA 4XZQA 4KHAA 5B33B 2BYMB 3KWQB 3MGQD 3R45A 2F8NA 4YS3D 3A6NA 3B0BA 4NE6A 2HIOC 4CSRB 5AV9D 3UT9A 2VQRA 3WTPB 1P3AC 5BT1C 3REHA 3AZJD 2XD5A 3W99B 5B32B 3LZ1D 4ZUXC 5DNNB 5E5AD 3MGQA 2DF4C 4Z5TD 3LJAC 3IP4C 1TZYB 5B1MD 5GT0A 5BNXB 4WU9A 3AZEB 2Y2IA 5B0YB 3MNNB 1M1AC 3VH5A 5AV9A 3AZKD 2YFVB 1P3BD 5AVCC 4E45A 3MGPD 4J8VC 5KDMA 2PYOC 1KX4C 3W98D 3LZ1A 3AV2D 5E5AA 5B31G 5B24C 4Z5TA 3H0MC 5B1MA 3A1KA 5B0ZA 5B31D 5CPJA 3VH6T 3A6NC 3AZKA 1P3BA 2JE5A 3MGPA 3UT9C 3MVDB 3AZFB 1P34D 2FFFB 3W98A 2BG1A 4G92C 1AOID 5CPIC 3AV2A 3AZIC 5C3IB 5B31A 4JJND 4YS3C 5GT3C 3NQUB 5B33D 3F6TA 3KWQD 5B40B 5AV9C 3RELB 1P34A 1P3KB 1ZLAB 4E44A 1AOIA 5B1LC 3AZJC 3UTAB 5E5AC 3WTPD 2BYKA 5B32G 1BH8B 4KHAB 4JJNA 3W99D 3MGRB 5B32D 3AL0C 3B0CW 5DNND 5B33A 1W2EA 2BYMA 3MGSB 3KUYB 4X23B 3AZKC 1TZYD 3MGPC 5AV5C 3REKB 3UTBC 3AZED 5B0YD 4UUZA 3MNND 3W98C 4CSRA 4J8UA 3AV2C 2HUEC 4H9QB 3WTPA 3AZLA 5F99D 3W99A 5GT0B 5B31C 5B32A 5B2JD 4WU9B 5DNNA 2F2AC 3W97B 3LZ0B 1TZYA 5BNXA 5CHLB 2Y2HA 3AZGA 3AZEA 5B0YA 3AFAA 3MNNA 1P34C 2YFVA 3X1UB 3B6GC 1AOIC 2ZY3A 3EG5B 3LZ1B 3MVDD 5F99A 3AZFD 4Z5TB 3EPKA 5B2JA 5B0ZB 5CPJB 2JSSA 2Y2KA 2Y2GA 2JCHA 3KWQC 2J8PA 4H9OB 3AZMB 1P3BB 3B6FB 2L5AA 2NZDB 5G49B 5B40D 3RELD 3MVDA 3AZFA 1EQZB 1P3MC 1P3KD 1U35D 1ZLAD 3WTPC 1P3FB 3W99C 1P3LD 4KGCB 5B32C 3UTAD 3WKJB 1A7WA 1KX3B 1HQ3D 1TZYC 1M18B 3AYWB 3MGRD 3AZNB 1KU5A 3NQUA 3AZEC 5B0YC 3MGSD 3KUYD 1P3IB 3MNNC 2DQNC 4X23D 3RELA 1U35A 1ZLAA 4H9RA 3REKD 4WU8B 4LD9B 2IO5B 4ZBJB 2RIQA 3UTAA 1BH8A 3NQJB 1HQ3A 1KX5D 1T3UA 3MGRA 1P3PC 5GT0D 4WU9D 3MGSA 3LZ0D 2Y2JA 3KUYA 3W97D 4UUZB 4X23A 5DNMA 3REKA 1P3OB 4J8UB 3MVDC 3AZLB 3WA9B 3X1UD 5AV6A 4H9QA 1KX5A 2UWXA 3O62A 5C3IC 5B0ZD 4Z2MH 5CPJD 3W97A 3LZ0A 3AZGB 5CPKB 3AFAB 1B67A 3TU4B 4R8PB 3AZMD 5B40C 3RELC 1M19D 4J8XA 3B6FD 1P3KC 5F99B 2CV5D 3X1UA 3AV1C 2NZDD 5B2JB 3X1VB 1EQZD 3V9RB 3UTAC 3X1SA 3REIC 4XZQC 1P3FD 3MGRC 4KGCD 3WKJD 5GSUB 3MGSC 3KUYC 4H9OA 5AVBB 3AZMA 1KX3D 1M19A 4HGAC 3AYWD 1M18D 3B6FA 3AZND 3REKC 2CV5A 2NZDA 5G49A 1P3ID 3C1BB 3REHC 1EQZA 4WU8D 1P3FA 3MGQC 4LD9D 3AN2B 1JFIB 4KGCA 5GT0C 2ZY5A 4NE3A 4WJ3C 4WU9C 3WKJA 3EPLA 1KX3A 3W97C 3KXBA 1M18A 3AYWA 3AZNA 2Y2NA 5AY8B 1U35B 4H9RB 1P3IA 3X1UC 3AZHB 3LZ1C 4WU8A 4J8UD 1P3AB 1P3OD 4LD9A 4Z5TC 1HQ3B 3AZLD 5B1MC 3WA9D 5B0ZC 5CPJC 4ZUXB 4J8WD 1F66D 4EO5B 3NQJA 2CWEA 4NFTA 3REIA 3AZMC 5DNMB 1P3BC 1H3OB 4Z66B 3FDDA 3B6FC 3AZGD 5CPKD 5GXQB 5BO0B 3AFAD 3TU4D 4R8PD 1P3GB 1P3OA 2AROB 5AV6B 2NQBB 3VH6A 1KX5B 3WA9A 3O62B 1P3FC 4J8WA 1F66A 4KGCC 2G5HC 3X1VD 1ULYA 3WKJC 5BS7A 1KX3C 3AYWC 5CPKA 4J8XB 3TU4A 1N1JA 4R8PA 5GSUD 3EPJA 5AVBD 1P3IC 1Q9CA 5AV8B 3VH6W 3X1TB 4WU8C 3X1SB 4LD9C 3C1BD 2IO5C 3AZIB 3X1VA 4JJNC 3V9RA 2Y2MA 4DRAA 5BNVA 2Y2OA 5B33C 3WAAB 4UPKA 3AN2D 1M19B 5GT3B 5GSUA 2CV5B 5AVBA 3H0RC 1ID3B 5AY8D 4J8UC 1P3OC 2FJ7B 3KFUG 3C1BA 3AZLC 3REJB 3WA9C 4XUJB 3B0DB 3AZHD 4H9PB 5DNNC 1P3AD 5BT1D 3KXBB 3AN2A 1JFIA 5BS7C 5B2IB 4ZUXD 3AZGC 5CPKC 4Z2MG 3AFAC 3TU4C 4R8PC 5DNMD 5AY8A 4Z66D 3UTBB 5GXQD 5F99C 3W96B 3AZHA 5B2JC 1P3GD 2AROD 1P3AA 5AV6D 3X1VC 2NQBD 3VH5T 4YM6B 1F1EA 5JRGB 3O62D 4QLCB 3REIB 1KX4D 4ZUXA 2ZM5A 5GSUC 1H3OA 5AVBC 4Z66A 5GXQA 5BO0A 4J8XD 3AZFC 2YFWB 5JA4A 3C1CB 3B6GB 3C1BC 1P3GA 2AROA 1BH9B 5AV8D 4J8WB 1F66B 2NQBA 3X1TD 2PYOA 1KX4A 3X1SD 3AZID 1N1JB 4NE5A 3WAAD 5CP6B 5AY8C 5GT3D 1U35C 1ZLAC 4KUDB 4AWLB 5AV8A 4G91B 3AZHC 1ID3D 3X1TA 3B0CT 1P3MB 2FJ7D 2F8NH 5BNVB 1B6WA 1HQ3C 5B1LD 4CAYA 3REJD 4XUJD 2ZY2A 1WWIA 3AZIA 5CPIA 3LELB 4WNNB 4EO5C 3WAAA 3KXBD 4X23C 5DNMC 4YS3A 5GT3A 4Z66C 5B2ID 5GXQC 1S32B 1BFMA 1ID3A 1P3GC 2AROC 5AV5D 5AV6C 3UTBD 2FJ7A 2NQBC 1KX5C 5B1LA 3REJA 3AZJA 1Z2CB 2W8SA 4XUJA 3O62C 1P3LB 3W96D 4H9PA 3LZ0C 3WTPE 3KSYA 4YM6D 5JRGD 4H9NB 4QLCD 3REID 1P3PB 5B2IA 4J8XC 2G5IC 3VH5W 2HIOB 5AV5A 3UTBA 5AV8C 3X1TC 3W96A 3X1SC 2F8NK 3C1CD 3B6GD 4WZSB 4DRBA 4YM6A 3LJAB 5JRGA 4QLCA 3WAAC 1HTAA 1M19C 2RVQD 3H0LC 1M1AB 2CV5C 5JA4B 2NZDC 2LY8A 5AVCB 4H9SA 4J8VB 1ID3C 1EQZC 5CP6D 2YFWA 2FJ7C 3C1CA 4KUDD 2PYOB 1KX4B 3AV1B 3B6GA 3REJC 1BH9A 3B0DC 4XUJC 5B24B 1TAFB 1P3MD 5FUGB 4XZQB 2F8NB 3KXBC 3R45B 1M18C 3AZNC 3LELD 5B2IC 3A6NB 1WWSA 3KWQA 4HGAB 5CP6A 3UT9B 4KUDA 4G92B 3REHB 3W96C 5CPIB 4CAYB 1S32D 4ZBJC 2ZY4A 1P3MA 3A1IA 3MGQB 4YM6C 5JRGC 4QLCC 3LELA 4YS3B
chains in the Genus database with same CATH topology
2Y2LA 4WNNA 2XD1A 5AV9B 1P3PD 4H9SC 5KDMB 5B1LB 1S32A 3C1CC 3AZJB 2HIOD 4DQYB 4J8WC 1F66C 2Y2QA 4M6BA 5E5AB 3P5JB 1P3LA 5B1MB 1PZRA 2RVQC 3LJAD 3AZKB 4H9NA 1P3PA 3MGPB 5AV5B 4WV4B 5CP6C 1R4VA 1M1AD 4KUDC 2HIOA 3W98B 4AWLC 5AVCD 3AV2B 2HUEB 4G91C 4J8VD 2PYOD 3AV1D 5B31B 2F8NG 5B24D 3LELC 3LJAA 2Y2PA 4XZQD 2F8ND 3EPHA 3A6ND 1M1AA 1P34B 5B40A 5AVCA 1AOIB 1S32C 4J8VA 3UT9D 1P3KA 3AV1A 2BYKB 3REHD 3AN2C 5CPID 1P3LC 5B24A 4JJNB 1TAFA 5FUGA 4XZQA 4KHAA 5B33B 2BYMB 3KWQB 3MGQD 3R45A 2F8NA 4YS3D 3A6NA 3B0BA 4NE6A 2HIOC 4CSRB 5AV9D 3UT9A 2VQRA 3WTPB 1P3AC 5BT1C 3REHA 3AZJD 2XD5A 3W99B 5B32B 3LZ1D 4ZUXC 5DNNB 5E5AD 3MGQA 2DF4C 4Z5TD 3LJAC 3IP4C 1TZYB 5B1MD 5GT0A 5BNXB 4WU9A 3AZEB 2Y2IA 5B0YB 3MNNB 1M1AC 3VH5A 5AV9A 3AZKD 2YFVB 1P3BD 5AVCC 4E45A 3MGPD 4J8VC 5KDMA 2PYOC 1KX4C 3W98D 3LZ1A 3AV2D 5E5AA 5B31G 5B24C 4Z5TA 3H0MC 5B1MA 3A1KA 5B0ZA 5B31D 5CPJA 3VH6T 3A6NC 3AZKA 1P3BA 2JE5A 3MGPA 3UT9C 3MVDB 3AZFB 1P34D 2FFFB 3W98A 2BG1A 4G92C 1AOID 5CPIC 3AV2A 3AZIC 5C3IB 5B31A 4JJND 4YS3C 5GT3C 3NQUB 5B33D 3F6TA 3KWQD 5B40B 5AV9C 3RELB 1P34A 1P3KB 1ZLAB 4E44A 1AOIA 5B1LC 3AZJC 3UTAB 5E5AC 3WTPD 2BYKA 5B32G 1BH8B 4KHAB 4JJNA 3W99D 3MGRB 5B32D 3AL0C 3B0CW 5DNND 5B33A 1W2EA 2BYMA 3MGSB 3KUYB 4X23B 3AZKC 1TZYD 3MGPC 5AV5C 3REKB 3UTBC 3AZED 5B0YD 4UUZA 3MNND 3W98C 4CSRA 4J8UA 3AV2C 2HUEC 4H9QB 3WTPA 3AZLA 5F99D 3W99A 5GT0B 5B31C 5B32A 5B2JD 4WU9B 5DNNA 2F2AC 3W97B 3LZ0B 1TZYA 5BNXA 5CHLB 2Y2HA 3AZGA 3AZEA 5B0YA 3AFAA 3MNNA 1P34C 2YFVA 3X1UB 3B6GC 1AOIC 2ZY3A 3EG5B 3LZ1B 3MVDD 5F99A 3AZFD 4Z5TB 3EPKA 5B2JA 5B0ZB 5CPJB 2JSSA 2Y2KA 2Y2GA 2JCHA 3KWQC 2J8PA 4H9OB 3AZMB 1P3BB 3B6FB 2L5AA 2NZDB 5G49B 5B40D 3RELD 3MVDA 3AZFA 1EQZB 1P3MC 1P3KD 1U35D 1ZLAD 3WTPC 1P3FB 3W99C 1P3LD 4KGCB 5B32C 3UTAD 3WKJB 1A7WA 1KX3B 1HQ3D 1TZYC 1M18B 3AYWB 3MGRD 3AZNB 1KU5A 3NQUA 3AZEC 5B0YC 3MGSD 3KUYD 1P3IB 3MNNC 2DQNC 4X23D 3RELA 1U35A 1ZLAA 4H9RA 3REKD 4WU8B 4LD9B 2IO5B 4ZBJB 2RIQA 3UTAA 1BH8A 3NQJB 1HQ3A 1KX5D 1T3UA 3MGRA 1P3PC 5GT0D 4WU9D 3MGSA 3LZ0D 2Y2JA 3KUYA 3W97D 4UUZB 4X23A 5DNMA 3REKA 1P3OB 4J8UB 3MVDC 3AZLB 3WA9B 3X1UD 5AV6A 4H9QA 1KX5A 2UWXA 3O62A 5C3IC 5B0ZD 4Z2MH 5CPJD 3W97A 3LZ0A 3AZGB 5CPKB 3AFAB 1B67A 3TU4B 4R8PB 3AZMD 5B40C 3RELC 1M19D 4J8XA 3B6FD 1P3KC 5F99B 2CV5D 3X1UA 3AV1C 2NZDD 5B2JB 3X1VB 1EQZD 3V9RB 3UTAC 3X1SA 3REIC 4XZQC 1P3FD 3MGRC 4KGCD 3WKJD 5GSUB 3MGSC 3KUYC 4H9OA 5AVBB 3AZMA 1KX3D 1M19A 4HGAC 3AYWD 1M18D 3B6FA 3AZND 3REKC 2CV5A 2NZDA 5G49A 1P3ID 3C1BB 3REHC 1EQZA 4WU8D 1P3FA 3MGQC 4LD9D 3AN2B 1JFIB 4KGCA 5GT0C 2ZY5A 4NE3A 4WJ3C 4WU9C 3WKJA 3EPLA 1KX3A 3W97C 3KXBA 1M18A 3AYWA 3AZNA 2Y2NA 5AY8B 1U35B 4H9RB 1P3IA 3X1UC 3AZHB 3LZ1C 4WU8A 4J8UD 1P3AB 1P3OD 4LD9A 4Z5TC 1HQ3B 3AZLD 5B1MC 3WA9D 5B0ZC 5CPJC 4ZUXB 4J8WD 1F66D 4EO5B 3NQJA 2CWEA 4NFTA 3REIA 3AZMC 5DNMB 1P3BC 1H3OB 4Z66B 3FDDA 3B6FC 3AZGD 5CPKD 5GXQB 5BO0B 3AFAD 3TU4D 4R8PD 1P3GB 1P3OA 2AROB 5AV6B 2NQBB 3VH6A 1KX5B 3WA9A 3O62B 1P3FC 4J8WA 1F66A 4KGCC 2G5HC 3X1VD 1ULYA 3WKJC 5BS7A 1KX3C 3AYWC 5CPKA 4J8XB 3TU4A 1N1JA 4R8PA 5GSUD 3EPJA 5AVBD 1P3IC 1Q9CA 5AV8B 3VH6W 3X1TB 4WU8C 3X1SB 4LD9C 3C1BD 2IO5C 3AZIB 3X1VA 4JJNC 3V9RA 2Y2MA 4DRAA 5BNVA 2Y2OA 5B33C 3WAAB 4UPKA 3AN2D 1M19B 5GT3B 5GSUA 2CV5B 5AVBA 3H0RC 1ID3B 5AY8D 4J8UC 1P3OC 2FJ7B 3KFUG 3C1BA 3AZLC 3REJB 3WA9C 4XUJB 3B0DB 3AZHD 4H9PB 5DNNC 1P3AD 5BT1D 3KXBB 3AN2A 1JFIA 5BS7C 5B2IB 4ZUXD 3AZGC 5CPKC 4Z2MG 3AFAC 3TU4C 4R8PC 5DNMD 5AY8A 4Z66D 3UTBB 5GXQD 5F99C 3W96B 3AZHA 5B2JC 1P3GD 2AROD 1P3AA 5AV6D 3X1VC 2NQBD 3VH5T 4YM6B 1F1EA 5JRGB 3O62D 4QLCB 3REIB 1KX4D 4ZUXA 2ZM5A 5GSUC 1H3OA 5AVBC 4Z66A 5GXQA 5BO0A 4J8XD 3AZFC 2YFWB 5JA4A 3C1CB 3B6GB 3C1BC 1P3GA 2AROA 1BH9B 5AV8D 4J8WB 1F66B 2NQBA 3X1TD 2PYOA 1KX4A 3X1SD 3AZID 1N1JB 4NE5A 3WAAD 5CP6B 5AY8C 5GT3D 1U35C 1ZLAC 4KUDB 4AWLB 5AV8A 4G91B 3AZHC 1ID3D 3X1TA 3B0CT 1P3MB 2FJ7D 2F8NH 5BNVB 1B6WA 1HQ3C 5B1LD 4CAYA 3REJD 4XUJD 2ZY2A 1WWIA 3AZIA 5CPIA 3LELB 4WNNB 4EO5C 3WAAA 3KXBD 4X23C 5DNMC 4YS3A 5GT3A 4Z66C 5B2ID 5GXQC 1S32B 1BFMA 1ID3A 1P3GC 2AROC 5AV5D 5AV6C 3UTBD 2FJ7A 2NQBC 1KX5C 5B1LA 3REJA 3AZJA 1Z2CB 2W8SA 4XUJA 3O62C 1P3LB 3W96D 4H9PA 3LZ0C 3WTPE 3KSYA 4YM6D 5JRGD 4H9NB 4QLCD 3REID 1P3PB 5B2IA 4J8XC 2G5IC 3VH5W 2HIOB 5AV5A 3UTBA 5AV8C 3X1TC 3W96A 3X1SC 2F8NK 3C1CD 3B6GD 4WZSB 4DRBA 4YM6A 3LJAB 5JRGA 4QLCA 3WAAC 1HTAA 1M19C 2RVQD 3H0LC 1M1AB 2CV5C 5JA4B 2NZDC 2LY8A 5AVCB 4H9SA 4J8VB 1ID3C 1EQZC 5CP6D 2YFWA 2FJ7C 3C1CA 4KUDD 2PYOB 1KX4B 3AV1B 3B6GA 3REJC 1BH9A 3B0DC 4XUJC 5B24B 1TAFB 1P3MD 5FUGB 4XZQB 2F8NB 3KXBC 3R45B 1M18C 3AZNC 3LELD 5B2IC 3A6NB 1WWSA 3KWQA 4HGAB 5CP6A 3UT9B 4KUDA 4G92B 3REHB 3W96C 5CPIB 4CAYB 1S32D 4ZBJC 2ZY4A 1P3MA 3A1IA 3MGQB 4YM6C 5JRGC 4QLCC 3LELA 4YS3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5I C;  2DF4 C;  3A1I A;  3IP4 C;  3H0L C;  2F2A C;  3H0R C;  2DQN C;  3H0M C;  2G5H C;  3A1K A;  4WJ3 C;  3AL0 C;  3KFU G; 
#chains in the Genus database with same CATH topology
 2Y2L A;  4WNN A;  2XD1 A;  5AV9 B;  1P3P D;  4H9S C;  5KDM B;  5B1L B;  1S32 A;  3C1C C;  3AZJ B;  2HIO D;  4DQY B;  4J8W C;  1F66 C;  2Y2Q A;  4M6B A;  5E5A B;  3P5J B;  1P3L A;  5B1M B;  1PZR A;  2RVQ C;  3LJA D;  3AZK B;  4H9N A;  1P3P A;  3MGP B;  5AV5 B;  4WV4 B;  5CP6 C;  1R4V A;  1M1A D;  4KUD C;  2HIO A;  3W98 B;  4AWL C;  5AVC D;  3AV2 B;  2HUE B;  4G91 C;  4J8V D;  2PYO D;  3AV1 D;  5B31 B;  2F8N G;  5B24 D;  3LEL C;  3LJA A;  2Y2P A;  4XZQ D;  2F8N D;  3EPH A;  3A6N D;  1M1A A;  1P34 B;  5B40 A;  5AVC A;  1AOI B;  1S32 C;  4J8V A;  3UT9 D;  1P3K A;  3AV1 A;  2BYK B;  3REH D;  3AN2 C;  5CPI D;  1P3L C;  5B24 A;  4JJN B;  1TAF A;  5FUG A;  4XZQ A;  4KHA A;  5B33 B;  2BYM B;  3KWQ B;  3MGQ D;  3R45 A;  2F8N A;  4YS3 D;  3A6N A;  3B0B A;  4NE6 A;  2HIO C;  4CSR B;  5AV9 D;  3UT9 A;  2VQR A;  3WTP B;  1P3A C;  5BT1 C;  3REH A;  3AZJ D;  2XD5 A;  3W99 B;  5B32 B;  3LZ1 D;  4ZUX C;  5DNN B;  5E5A D;  3MGQ A;  2DF4 C;  4Z5T D;  3LJA C;  3IP4 C;  1TZY B;  5B1M D;  5GT0 A;  5BNX B;  4WU9 A;  3AZE B;  2Y2I A;  5B0Y B;  3MNN B;  1M1A C;  3VH5 A;  5AV9 A;  3AZK D;  2YFV B;  1P3B D;  5AVC C;  4E45 A;  3MGP D;  4J8V C;  5KDM A;  2PYO C;  1KX4 C;  3W98 D;  3LZ1 A;  3AV2 D;  5E5A A;  5B31 G;  5B24 C;  4Z5T A;  3H0M C;  5B1M A;  3A1K A;  5B0Z A;  5B31 D;  5CPJ A;  3VH6 T;  3A6N C;  3AZK A;  1P3B A;  2JE5 A;  3MGP A;  3UT9 C;  3MVD B;  3AZF B;  1P34 D;  2FFF B;  3W98 A;  2BG1 A;  4G92 C;  1AOI D;  5CPI C;  3AV2 A;  3AZI C;  5C3I B;  5B31 A;  4JJN D;  4YS3 C;  5GT3 C;  3NQU B;  5B33 D;  3F6T A;  3KWQ D;  5B40 B;  5AV9 C;  3REL B;  1P34 A;  1P3K B;  1ZLA B;  4E44 A;  1AOI A;  5B1L C;  3AZJ C;  3UTA B;  5E5A C;  3WTP D;  2BYK A;  5B32 G;  1BH8 B;  4KHA B;  4JJN A;  3W99 D;  3MGR B;  5B32 D;  3AL0 C;  3B0C W;  5DNN D;  5B33 A;  1W2E A;  2BYM A;  3MGS B;  3KUY B;  4X23 B;  3AZK C;  1TZY D;  3MGP C;  5AV5 C;  3REK B;  3UTB C;  3AZE D;  5B0Y D;  4UUZ A;  3MNN D;  3W98 C;  4CSR A;  4J8U A;  3AV2 C;  2HUE C;  4H9Q B;  3WTP A;  3AZL A;  5F99 D;  3W99 A;  5GT0 B;  5B31 C;  5B32 A;  5B2J D;  4WU9 B;  5DNN A;  2F2A C;  3W97 B;  3LZ0 B;  1TZY A;  5BNX A;  5CHL B;  2Y2H A;  3AZG A;  3AZE A;  5B0Y A;  3AFA A;  3MNN A;  1P34 C;  2YFV A;  3X1U B;  3B6G C;  1AOI C;  2ZY3 A;  3EG5 B;  3LZ1 B;  3MVD D;  5F99 A;  3AZF D;  4Z5T B;  3EPK A;  5B2J A;  5B0Z B;  5CPJ B;  2JSS A;  2Y2K A;  2Y2G A;  2JCH A;  3KWQ C;  2J8P A;  4H9O B;  3AZM B;  1P3B B;  3B6F B;  2L5A A;  2NZD B;  5G49 B;  5B40 D;  3REL D;  3MVD A;  3AZF A;  1EQZ B;  1P3M C;  1P3K D;  1U35 D;  1ZLA D;  3WTP C;  1P3F B;  3W99 C;  1P3L D;  4KGC B;  5B32 C;  3UTA D;  3WKJ B;  1A7W A;  1KX3 B;  1HQ3 D;  1TZY C;  1M18 B;  3AYW B;  3MGR D;  3AZN B;  1KU5 A;  3NQU A;  3AZE C;  5B0Y C;  3MGS D;  3KUY D;  1P3I B;  3MNN C;  2DQN C;  4X23 D;  3REL A;  1U35 A;  1ZLA A;  4H9R A;  3REK D;  4WU8 B;  4LD9 B;  2IO5 B;  4ZBJ B;  2RIQ A;  3UTA A;  1BH8 A;  3NQJ B;  1HQ3 A;  1KX5 D;  1T3U A;  3MGR A;  1P3P C;  5GT0 D;  4WU9 D;  3MGS A;  3LZ0 D;  2Y2J A;  3KUY A;  3W97 D;  4UUZ B;  4X23 A;  5DNM A;  3REK A;  1P3O B;  4J8U B;  3MVD C;  3AZL B;  3WA9 B;  3X1U D;  5AV6 A;  4H9Q A;  1KX5 A;  2UWX A;  3O62 A;  5C3I C;  5B0Z D;  4Z2M H;  5CPJ D;  3W97 A;  3LZ0 A;  3AZG B;  5CPK B;  3AFA B;  1B67 A;  3TU4 B;  4R8P B;  3AZM D;  5B40 C;  3REL C;  1M19 D;  4J8X A;  3B6F D;  1P3K C;  5F99 B;  2CV5 D;  3X1U A;  3AV1 C;  2NZD D;  5B2J B;  3X1V B;  1EQZ D;  3V9R B;  3UTA C;  3X1S A;  3REI C;  4XZQ C;  1P3F D;  3MGR C;  4KGC D;  3WKJ D;  5GSU B;  3MGS C;  3KUY C;  4H9O A;  5AVB B;  3AZM A;  1KX3 D;  1M19 A;  4HGA C;  3AYW D;  1M18 D;  3B6F A;  3AZN D;  3REK C;  2CV5 A;  2NZD A;  5G49 A;  1P3I D;  3C1B B;  3REH C;  1EQZ A;  4WU8 D;  1P3F A;  3MGQ C;  4LD9 D;  3AN2 B;  1JFI B;  4KGC A;  5GT0 C;  2ZY5 A;  4NE3 A;  4WJ3 C;  4WU9 C;  3WKJ A;  3EPL A;  1KX3 A;  3W97 C;  3KXB A;  1M18 A;  3AYW A;  3AZN A;  2Y2N A;  5AY8 B;  1U35 B;  4H9R B;  1P3I A;  3X1U C;  3AZH B;  3LZ1 C;  4WU8 A;  4J8U D;  1P3A B;  1P3O D;  4LD9 A;  4Z5T C;  1HQ3 B;  3AZL D;  5B1M C;  3WA9 D;  5B0Z C;  5CPJ C;  4ZUX B;  4J8W D;  1F66 D;  4EO5 B;  3NQJ A;  2CWE A;  4NFT A;  3REI A;  3AZM C;  5DNM B;  1P3B C;  1H3O B;  4Z66 B;  3FDD A;  3B6F C;  3AZG D;  5CPK D;  5GXQ B;  5BO0 B;  3AFA D;  3TU4 D;  4R8P D;  1P3G B;  1P3O A;  2ARO B;  5AV6 B;  2NQB B;  3VH6 A;  1KX5 B;  3WA9 A;  3O62 B;  1P3F C;  4J8W A;  1F66 A;  4KGC C;  2G5H C;  3X1V D;  1ULY A;  3WKJ C;  5BS7 A;  1KX3 C;  3AYW C;  5CPK A;  4J8X B;  3TU4 A;  1N1J A;  4R8P A;  5GSU D;  3EPJ A;  5AVB D;  1P3I C;  1Q9C A;  5AV8 B;  3VH6 W;  3X1T B;  4WU8 C;  3X1S B;  4LD9 C;  3C1B D;  2IO5 C;  3AZI B;  3X1V A;  4JJN C;  3V9R A;  2Y2M A;  4DRA A;  5BNV A;  2Y2O A;  5B33 C;  3WAA B;  4UPK A;  3AN2 D;  1M19 B;  5GT3 B;  5GSU A;  2CV5 B;  5AVB A;  3H0R C;  1ID3 B;  5AY8 D;  4J8U C;  1P3O C;  2FJ7 B;  3KFU G;  3C1B A;  3AZL C;  3REJ B;  3WA9 C;  4XUJ B;  3B0D B;  3AZH D;  4H9P B;  5DNN C;  1P3A D;  5BT1 D;  3KXB B;  3AN2 A;  1JFI A;  5BS7 C;  5B2I B;  4ZUX D;  3AZG C;  5CPK C;  4Z2M G;  3AFA C;  3TU4 C;  4R8P C;  5DNM D;  5AY8 A;  4Z66 D;  3UTB B;  5GXQ D;  5F99 C;  3W96 B;  3AZH A;  5B2J C;  1P3G D;  2ARO D;  1P3A A;  5AV6 D;  3X1V C;  2NQB D;  3VH5 T;  4YM6 B;  1F1E A;  5JRG B;  3O62 D;  4QLC B;  3REI B;  1KX4 D;  4ZUX A;  2ZM5 A;  5GSU C;  1H3O A;  5AVB C;  4Z66 A;  5GXQ A;  5BO0 A;  4J8X D;  3AZF C;  2YFW B;  5JA4 A;  3C1C B;  3B6G B;  3C1B C;  1P3G A;  2ARO A;  1BH9 B;  5AV8 D;  4J8W B;  1F66 B;  2NQB A;  3X1T D;  2PYO A;  1KX4 A;  3X1S D;  3AZI D;  1N1J B;  4NE5 A;  3WAA D;  5CP6 B;  5AY8 C;  5GT3 D;  1U35 C;  1ZLA C;  4KUD B;  4AWL B;  5AV8 A;  4G91 B;  3AZH C;  1ID3 D;  3X1T A;  3B0C T;  1P3M B;  2FJ7 D;  2F8N H;  5BNV B;  1B6W A;  1HQ3 C;  5B1L D;  4CAY A;  3REJ D;  4XUJ D;  2ZY2 A;  1WWI A;  3AZI A;  5CPI A;  3LEL B;  4WNN B;  4EO5 C;  3WAA A;  3KXB D;  4X23 C;  5DNM C;  4YS3 A;  5GT3 A;  4Z66 C;  5B2I D;  5GXQ C;  1S32 B;  1BFM A;  1ID3 A;  1P3G C;  2ARO C;  5AV5 D;  5AV6 C;  3UTB D;  2FJ7 A;  2NQB C;  1KX5 C;  5B1L A;  3REJ A;  3AZJ A;  1Z2C B;  2W8S A;  4XUJ A;  3O62 C;  1P3L B;  3W96 D;  4H9P A;  3LZ0 C;  3WTP E;  3KSY A;  4YM6 D;  5JRG D;  4H9N B;  4QLC D;  3REI D;  1P3P B;  5B2I A;  4J8X C;  2G5I C;  3VH5 W;  2HIO B;  5AV5 A;  3UTB A;  5AV8 C;  3X1T C;  3W96 A;  3X1S C;  2F8N K;  3C1C D;  3B6G D;  4WZS B;  4DRB A;  4YM6 A;  3LJA B;  5JRG A;  4QLC A;  3WAA C;  1HTA A;  1M19 C;  2RVQ D;  3H0L C;  1M1A B;  2CV5 C;  5JA4 B;  2NZD C;  2LY8 A;  5AVC B;  4H9S A;  4J8V B;  1ID3 C;  1EQZ C;  5CP6 D;  2YFW A;  2FJ7 C;  3C1C A;  4KUD D;  2PYO B;  1KX4 B;  3AV1 B;  3B6G A;  3REJ C;  1BH9 A;  3B0D C;  4XUJ C;  5B24 B;  1TAF B;  1P3M D;  5FUG B;  4XZQ B;  2F8N B;  3KXB C;  3R45 B;  1M18 C;  3AZN C;  3LEL D;  5B2I C;  3A6N B;  1WWS A;  3KWQ A;  4HGA B;  5CP6 A;  3UT9 B;  4KUD A;  4G92 B;  3REH B;  3W96 C;  5CPI B;  4CAY B;  1S32 D;  4ZBJ C;  2ZY4 A;  1P3M A;  3A1I A;  3MGQ B;  4YM6 C;  5JRG C;  4QLC C;  3LEL A;  4YS3 B; 
#chains in the Genus database with same CATH homology
 2Y2L A;  4WNN A;  2XD1 A;  5AV9 B;  1P3P D;  4H9S C;  5KDM B;  5B1L B;  1S32 A;  3C1C C;  3AZJ B;  2HIO D;  4DQY B;  4J8W C;  1F66 C;  2Y2Q A;  4M6B A;  5E5A B;  3P5J B;  1P3L A;  5B1M B;  1PZR A;  2RVQ C;  3LJA D;  3AZK B;  4H9N A;  1P3P A;  3MGP B;  5AV5 B;  4WV4 B;  5CP6 C;  1R4V A;  1M1A D;  4KUD C;  2HIO A;  3W98 B;  4AWL C;  5AVC D;  3AV2 B;  2HUE B;  4G91 C;  4J8V D;  2PYO D;  3AV1 D;  5B31 B;  2F8N G;  5B24 D;  3LEL C;  3LJA A;  2Y2P A;  4XZQ D;  2F8N D;  3EPH A;  3A6N D;  1M1A A;  1P34 B;  5B40 A;  5AVC A;  1AOI B;  1S32 C;  4J8V A;  3UT9 D;  1P3K A;  3AV1 A;  2BYK B;  3REH D;  3AN2 C;  5CPI D;  1P3L C;  5B24 A;  4JJN B;  1TAF A;  5FUG A;  4XZQ A;  4KHA A;  5B33 B;  2BYM B;  3KWQ B;  3MGQ D;  3R45 A;  2F8N A;  4YS3 D;  3A6N A;  3B0B A;  4NE6 A;  2HIO C;  4CSR B;  5AV9 D;  3UT9 A;  2VQR A;  3WTP B;  1P3A C;  5BT1 C;  3REH A;  3AZJ D;  2XD5 A;  3W99 B;  5B32 B;  3LZ1 D;  4ZUX C;  5DNN B;  5E5A D;  3MGQ A;  2DF4 C;  4Z5T D;  3LJA C;  3IP4 C;  1TZY B;  5B1M D;  5GT0 A;  5BNX B;  4WU9 A;  3AZE B;  2Y2I A;  5B0Y B;  3MNN B;  1M1A C;  3VH5 A;  5AV9 A;  3AZK D;  2YFV B;  1P3B D;  5AVC C;  4E45 A;  3MGP D;  4J8V C;  5KDM A;  2PYO C;  1KX4 C;  3W98 D;  3LZ1 A;  3AV2 D;  5E5A A;  5B31 G;  5B24 C;  4Z5T A;  3H0M C;  5B1M A;  3A1K A;  5B0Z A;  5B31 D;  5CPJ A;  3VH6 T;  3A6N C;  3AZK A;  1P3B A;  2JE5 A;  3MGP A;  3UT9 C;  3MVD B;  3AZF B;  1P34 D;  2FFF B;  3W98 A;  2BG1 A;  4G92 C;  1AOI D;  5CPI C;  3AV2 A;  3AZI C;  5C3I B;  5B31 A;  4JJN D;  4YS3 C;  5GT3 C;  3NQU B;  5B33 D;  3F6T A;  3KWQ D;  5B40 B;  5AV9 C;  3REL B;  1P34 A;  1P3K B;  1ZLA B;  4E44 A;  1AOI A;  5B1L C;  3AZJ C;  3UTA B;  5E5A C;  3WTP D;  2BYK A;  5B32 G;  1BH8 B;  4KHA B;  4JJN A;  3W99 D;  3MGR B;  5B32 D;  3AL0 C;  3B0C W;  5DNN D;  5B33 A;  1W2E A;  2BYM A;  3MGS B;  3KUY B;  4X23 B;  3AZK C;  1TZY D;  3MGP C;  5AV5 C;  3REK B;  3UTB C;  3AZE D;  5B0Y D;  4UUZ A;  3MNN D;  3W98 C;  4CSR A;  4J8U A;  3AV2 C;  2HUE C;  4H9Q B;  3WTP A;  3AZL A;  5F99 D;  3W99 A;  5GT0 B;  5B31 C;  5B32 A;  5B2J D;  4WU9 B;  5DNN A;  2F2A C;  3W97 B;  3LZ0 B;  1TZY A;  5BNX A;  5CHL B;  2Y2H A;  3AZG A;  3AZE A;  5B0Y A;  3AFA A;  3MNN A;  1P34 C;  2YFV A;  3X1U B;  3B6G C;  1AOI C;  2ZY3 A;  3EG5 B;  3LZ1 B;  3MVD D;  5F99 A;  3AZF D;  4Z5T B;  3EPK A;  5B2J A;  5B0Z B;  5CPJ B;  2JSS A;  2Y2K A;  2Y2G A;  2JCH A;  3KWQ C;  2J8P A;  4H9O B;  3AZM B;  1P3B B;  3B6F B;  2L5A A;  2NZD B;  5G49 B;  5B40 D;  3REL D;  3MVD A;  3AZF A;  1EQZ B;  1P3M C;  1P3K D;  1U35 D;  1ZLA D;  3WTP C;  1P3F B;  3W99 C;  1P3L D;  4KGC B;  5B32 C;  3UTA D;  3WKJ B;  1A7W A;  1KX3 B;  1HQ3 D;  1TZY C;  1M18 B;  3AYW B;  3MGR D;  3AZN B;  1KU5 A;  3NQU A;  3AZE C;  5B0Y C;  3MGS D;  3KUY D;  1P3I B;  3MNN C;  2DQN C;  4X23 D;  3REL A;  1U35 A;  1ZLA A;  4H9R A;  3REK D;  4WU8 B;  4LD9 B;  2IO5 B;  4ZBJ B;  2RIQ A;  3UTA A;  1BH8 A;  3NQJ B;  1HQ3 A;  1KX5 D;  1T3U A;  3MGR A;  1P3P C;  5GT0 D;  4WU9 D;  3MGS A;  3LZ0 D;  2Y2J A;  3KUY A;  3W97 D;  4UUZ B;  4X23 A;  5DNM A;  3REK A;  1P3O B;  4J8U B;  3MVD C;  3AZL B;  3WA9 B;  3X1U D;  5AV6 A;  4H9Q A;  1KX5 A;  2UWX A;  3O62 A;  5C3I C;  5B0Z D;  4Z2M H;  5CPJ D;  3W97 A;  3LZ0 A;  3AZG B;  5CPK B;  3AFA B;  1B67 A;  3TU4 B;  4R8P B;  3AZM D;  5B40 C;  3REL C;  1M19 D;  4J8X A;  3B6F D;  1P3K C;  5F99 B;  2CV5 D;  3X1U A;  3AV1 C;  2NZD D;  5B2J B;  3X1V B;  1EQZ D;  3V9R B;  3UTA C;  3X1S A;  3REI C;  4XZQ C;  1P3F D;  3MGR C;  4KGC D;  3WKJ D;  5GSU B;  3MGS C;  3KUY C;  4H9O A;  5AVB B;  3AZM A;  1KX3 D;  1M19 A;  4HGA C;  3AYW D;  1M18 D;  3B6F A;  3AZN D;  3REK C;  2CV5 A;  2NZD A;  5G49 A;  1P3I D;  3C1B B;  3REH C;  1EQZ A;  4WU8 D;  1P3F A;  3MGQ C;  4LD9 D;  3AN2 B;  1JFI B;  4KGC A;  5GT0 C;  2ZY5 A;  4NE3 A;  4WJ3 C;  4WU9 C;  3WKJ A;  3EPL A;  1KX3 A;  3W97 C;  3KXB A;  1M18 A;  3AYW A;  3AZN A;  2Y2N A;  5AY8 B;  1U35 B;  4H9R B;  1P3I A;  3X1U C;  3AZH B;  3LZ1 C;  4WU8 A;  4J8U D;  1P3A B;  1P3O D;  4LD9 A;  4Z5T C;  1HQ3 B;  3AZL D;  5B1M C;  3WA9 D;  5B0Z C;  5CPJ C;  4ZUX B;  4J8W D;  1F66 D;  4EO5 B;  3NQJ A;  2CWE A;  4NFT A;  3REI A;  3AZM C;  5DNM B;  1P3B C;  1H3O B;  4Z66 B;  3FDD A;  3B6F C;  3AZG D;  5CPK D;  5GXQ B;  5BO0 B;  3AFA D;  3TU4 D;  4R8P D;  1P3G B;  1P3O A;  2ARO B;  5AV6 B;  2NQB B;  3VH6 A;  1KX5 B;  3WA9 A;  3O62 B;  1P3F C;  4J8W A;  1F66 A;  4KGC C;  2G5H C;  3X1V D;  1ULY A;  3WKJ C;  5BS7 A;  1KX3 C;  3AYW C;  5CPK A;  4J8X B;  3TU4 A;  1N1J A;  4R8P A;  5GSU D;  3EPJ A;  5AVB D;  1P3I C;  1Q9C A;  5AV8 B;  3VH6 W;  3X1T B;  4WU8 C;  3X1S B;  4LD9 C;  3C1B D;  2IO5 C;  3AZI B;  3X1V A;  4JJN C;  3V9R A;  2Y2M A;  4DRA A;  5BNV A;  2Y2O A;  5B33 C;  3WAA B;  4UPK A;  3AN2 D;  1M19 B;  5GT3 B;  5GSU A;  2CV5 B;  5AVB A;  3H0R C;  1ID3 B;  5AY8 D;  4J8U C;  1P3O C;  2FJ7 B;  3KFU G;  3C1B A;  3AZL C;  3REJ B;  3WA9 C;  4XUJ B;  3B0D B;  3AZH D;  4H9P B;  5DNN C;  1P3A D;  5BT1 D;  3KXB B;  3AN2 A;  1JFI A;  5BS7 C;  5B2I B;  4ZUX D;  3AZG C;  5CPK C;  4Z2M G;  3AFA C;  3TU4 C;  4R8P C;  5DNM D;  5AY8 A;  4Z66 D;  3UTB B;  5GXQ D;  5F99 C;  3W96 B;  3AZH A;  5B2J C;  1P3G D;  2ARO D;  1P3A A;  5AV6 D;  3X1V C;  2NQB D;  3VH5 T;  4YM6 B;  1F1E A;  5JRG B;  3O62 D;  4QLC B;  3REI B;  1KX4 D;  4ZUX A;  2ZM5 A;  5GSU C;  1H3O A;  5AVB C;  4Z66 A;  5GXQ A;  5BO0 A;  4J8X D;  3AZF C;  2YFW B;  5JA4 A;  3C1C B;  3B6G B;  3C1B C;  1P3G A;  2ARO A;  1BH9 B;  5AV8 D;  4J8W B;  1F66 B;  2NQB A;  3X1T D;  2PYO A;  1KX4 A;  3X1S D;  3AZI D;  1N1J B;  4NE5 A;  3WAA D;  5CP6 B;  5AY8 C;  5GT3 D;  1U35 C;  1ZLA C;  4KUD B;  4AWL B;  5AV8 A;  4G91 B;  3AZH C;  1ID3 D;  3X1T A;  3B0C T;  1P3M B;  2FJ7 D;  2F8N H;  5BNV B;  1B6W A;  1HQ3 C;  5B1L D;  4CAY A;  3REJ D;  4XUJ D;  2ZY2 A;  1WWI A;  3AZI A;  5CPI A;  3LEL B;  4WNN B;  4EO5 C;  3WAA A;  3KXB D;  4X23 C;  5DNM C;  4YS3 A;  5GT3 A;  4Z66 C;  5B2I D;  5GXQ C;  1S32 B;  1BFM A;  1ID3 A;  1P3G C;  2ARO C;  5AV5 D;  5AV6 C;  3UTB D;  2FJ7 A;  2NQB C;  1KX5 C;  5B1L A;  3REJ A;  3AZJ A;  1Z2C B;  2W8S A;  4XUJ A;  3O62 C;  1P3L B;  3W96 D;  4H9P A;  3LZ0 C;  3WTP E;  3KSY A;  4YM6 D;  5JRG D;  4H9N B;  4QLC D;  3REI D;  1P3P B;  5B2I A;  4J8X C;  2G5I C;  3VH5 W;  2HIO B;  5AV5 A;  3UTB A;  5AV8 C;  3X1T C;  3W96 A;  3X1S C;  2F8N K;  3C1C D;  3B6G D;  4WZS B;  4DRB A;  4YM6 A;  3LJA B;  5JRG A;  4QLC A;  3WAA C;  1HTA A;  1M19 C;  2RVQ D;  3H0L C;  1M1A B;  2CV5 C;  5JA4 B;  2NZD C;  2LY8 A;  5AVC B;  4H9S A;  4J8V B;  1ID3 C;  1EQZ C;  5CP6 D;  2YFW A;  2FJ7 C;  3C1C A;  4KUD D;  2PYO B;  1KX4 B;  3AV1 B;  3B6G A;  3REJ C;  1BH9 A;  3B0D C;  4XUJ C;  5B24 B;  1TAF B;  1P3M D;  5FUG B;  4XZQ B;  2F8N B;  3KXB C;  3R45 B;  1M18 C;  3AZN C;  3LEL D;  5B2I C;  3A6N B;  1WWS A;  3KWQ A;  4HGA B;  5CP6 A;  3UT9 B;  4KUD A;  4G92 B;  3REH B;  3W96 C;  5CPI B;  4CAY B;  1S32 D;  4ZBJ C;  2ZY4 A;  1P3M A;  3A1I A;  3MGQ B;  4YM6 C;  5JRG C;  4QLC C;  3LEL A;  4YS3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...