3B6GD

Nucleosome core particle treated with oxaliplatin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 101
sequence length 101
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gD00
3UTBA 3W99C 4J8VA 2YFVB 5CPKA 3RELB 3AFAD 3AFAC 5AV5A 3MGPD 3MGQA 3KUYA 1N1JA 3MGPC 1JFIA 4ZUXB 3LJAA 1P3BB 5B0YD 5B0YC 4EO5C 4G92B 4XUJA 5GT3B 5G49A 3REHD 4H9SC 3REHC 1P34A 1B67A 3MGSB 1M1AA 1M18A 5E5AA 2YFWB 1U35B 4R8PA 3W96D 3W96C 5BS7C 1TZYB 4WU8B 3X1SA 4H9RA 5B0ZA 4NE5A 1P3PA 5AY8B 3RELD 3REIB 3RELC 5B1LD 2PYOB 5B1LC 5B32B 4WNNA 4ZUXD 3AN2A 4ZUXC 1P3KB 5GT0A 1BH9A 1AOIA 1BFMA 1P3BD 1P3BC 4KGCB 5GT3D 1P3GB 1EQZB 5GT3C 4H9PA 5F99A 3AZIA 3X1VA 3KXBD 3MGSD 1P3IA 3KXBC 3MGSC 3TU4B 3X1TA 3WKJB 1U35D 1U35C 3X1UB 1ZLAA 5B24A 4G91C 4CSRA 3UT9B 2HIOB 4WU8D 2IO5B 4WU8C 4J8UA 3B6FD 4UUZA 3B6FC 2BYKA 4LD9D 4LD9C 3REID 3C1CB 3REIC 2PYOD 1Q9CA 2PYOC 4WU9D 4WU9C 1P3KD 1P3KC 3AZNB 1EQZD 1EQZC 5FUGB 2NZDB 3AZFB 3X1UD 5B0YA 3X1UC 5DNMA 5B31B 3REHA 2IO5C 3W97D 3W97C 3C1CD 2NQBB 3C1CC 3B0CT 5CP6B 3W96A 3AZGB 5B40B 5KDMA 1M19D 1BH8B 2YFVA 3NQUB 1M19C 3RELA 5B33D 5B33C 4ZUXA 1ID3B 5GSUB 3AZFD 1P3BA 3AZFC 3AZHD 3UTAB 5B31D 3AZHC 2HUEB 5GT3A 5B31C 3AZLB 3B0DC 1P3MB 2NQBD 1WWSA 3AZED 3MGSA 3AZEC 2NQBC 4NE6A 5AV8B 4DRBA 3W99B 2YFWA 3V9RB 1U35A 5B40D 5B40C 3VH6W 3AFAB 1TZYA 4WU8A 3MGPB 1F66B 5AY8A 5CPJB 4LD9A 3REIA 4KUDB 2PYOA 5B32A 1KX3B 1P3KA 5GSUD 5GSUC 3LZ0B 4DRAA 3UTAD 3UTAC 1P3GA 1EQZA 1P3FD 2FJ7B 2JSSA 3TU4A 3AV2D 3AV2C 4XZQB 3MVDD 3WKJA 3MVDC 3WAAD 3X1UA 3WAAC 3WTPB 3UT9A 2HIOA 5B1LB 1F66D 5CPJD 3B0BA 4Z5TD 5CPJC 4Z5TC 1F66C 3AYWD 4KUDD 3C1CA 3AYWC 4KUDC 3LELB 1KX3D 1KX3C 1HQ3B 3LZ0D 2F8NB 3LZ0C 3AZNA 3KXBB 3REKB 5FUGA 2FJ7D 5BNXB 2NZDA 4G91B 1P3OD 2FJ7C 1P3OC 3KSYA 4XZQD 4WV4B 4XZQC 3B6FB 3AZFA 3WTPD 4LD9B 3WTPC 5B31A 1S32B 4WU9B 5B2ID 5B2IC 2NQBA 3MGRB 3LELD 3LELC 3WA9D 3WA9C 1HQ3D 5CP6A 3AZGA 1HQ3C 5B1MD 5BNVB 5B1MC 5B40A 2CV5C 2F8ND 3C1BB 1BH8A 3NQUA 3REKD 3REKC 3VH5W 1P3LB 3REJB 3AZKB 4YM6B 1ID3A 5GSUA 2CV5B 3O62B 3UTAA 3W97B 3AZLA 1S32D 1S32C 1P3MA 3VH5T 3MGRD 3MGRC 5AV8A 4KHAB 2L5AA 4Z66B 4H9QB 3W99A 3V9RA 1M19B 3C1BD 3AFAA 3C1BC 5B33B 3MGPA 3B0CW 4J8WB 5B32G 5GXQB 1F66A 5CPJA 4M6BA 2BYMB 4KUDA 1P3LD 1KX3A 1P3LC 3REJD 3AZKD 4YM6D 3REJC 3AZHB 4YM6C 3AZKC 1ULYA 3B0DB 4H9SA 3LZ0A 3AV1D 2CV5D 3O62D 3AV1C 3WTPE 5B2JD 5DNNB 4CAYB 5B2JC 5AVCD 5AVCC 3O62C 3VH6A 3AZEB 5JA4B 1KX4B 5BS7A 2FJ7A 4XZQA 4Z66D 4H9OB 4Z2MH 4Z66C 4JJNB 1P3AB 3KWQD 3WTPA 3KWQC 4HGAB 5B1LA 3AZMD 4J8WD 3AZMC 4J8WC 5GXQD 5GXQC 3A6NB 5CPKD 5CPKC 4QLCB 3LELA 4AWLB 3NQJB 5AV9B 1HQ3A 2F8NA 4KGCD 4KGCC 5DNND 4WZSB 1P3FB 5DNNC 3KXBA 4XUJD 4XUJC 3AV2B 3MVDB 1ZLAD 3REKA 1KX4D 1KX4C 3WAAB 5BNXA 2F8NH 1M1AD 4JJND 1M1AC 5B31G 4JJNC 3B6FA 1P3AD 2AROB 4R8PD 1P3AC 4R8PC 4Z5TB 3AYWB 4HGAC 1S32A 4WU9A 3A6ND 4NE3A 3A6NC 4QLCD 3MGRA 4QLCC 4AWLC 5AV9D 5AV9C 5BNVA 1AOID 1AOIC 3B6GB 5C3IB 3C1BA 3R45B 1P3FC 1P3OB 5F99D 3X1VD 5F99C 3X1VC 1P3LA 3REJA 3AZKA 4YM6A 5AVBB 3X1TD 3X1TC 1H3OB 2AROD 1TAFB 2AROC 2CV5A 3O62A 3W97A 5B2IB 4YS3B 1KX5B 1B6WA 3WA9B 5B1MB 3VH5A 4KHAA 4Z66A 4H9QA 5AV6B 1M19A 4H9NB 3B6GD 3B6GC 5C3IC 5B33A 4J8WA 5GXQA 2BYMA 3AZHA 4Z2MG 1KU5A 5AVBD 5AVBC 4ZBJB 4KGCA 4YS3D 5DNMD 1KX5D 4YS3C 5DNMC 5DNNA 4CAYA 4X23B 3AZEA 1KX5C 5CPIB 5JA4A 1KX4A 4H9OA 4JJNA 2CWEA 5AV6D 1P3AA 5AV6C 4J8XD 4J8XC 5JRGB 3A6NA 4QLCA 2F8NG 3AV1B 1WWIA 3NQJA 5B2JB 5AVCB 5BO0B 5AV9A 2F8NK 4ZBJC 1P3FA 4X23D 3LZ1B 4G92C 4X23C 3AV2A 5CPID 5CPIC 3MVDA 3WAAA 3KWQB 3W98B 3AZJB 3MNNB 3AZMB 3UTBB 2AROA 4J8VB 4Z5TA 5CPKB 3AYWA 1HTAA 1TZYD 1TZYC 5AV5B 3MGQB 1JFIB 3KUYB 1N1JB 5JRGD 5AY8D 5JRGC 5AY8C 4NFTA 3LJAB 5B32D 5B32C 4XUJB 5G49B 1A7WA 3B6GA 1P34B 3R45A 3LZ1D 3LZ1C 1P3GD 1P3OA 1P3GC 1M1AB 1M18B 5E5AB 4R8PB 3W98D 3TU4D 3MNND 5AVBA 3TU4C 3MNNC 3AZJC 3AZJD 3W98C 3WKJD 2RVQD 3UTBD 3WKJC 2RVQC 4H9RB 1H3OA 5B0ZB 1TAFA 3X1SB 4J8VD 4J8VC 3UTBC 1P3PB 5B2IA 4YS3A 1KX5A 3UT9D 2HIOD 3UT9C 2HIOC 5AV5D 3MGQD 5AV5C 3MGQC 3KUYD 3KUYC 4WNNB 3WA9A 3AN2B 5B1MA 1BH9B 5GT0B 3LJAD 1AOIB 3LJAC 2LY8A 5BT1D 5BT1C 5AV6A 4H9NA 4H9PB 5F99B 4J8XA 3AZIB 3X1VB 1P34D 1P34C 3AZND 3AZNC 1P3IB 3X1TB 1M18D 5E5AD 1M18C 5E5AC 1ZLAB 5B24B 2NZDD 2NZDC 4CSRB 3X1SD 5B0ZD 4UUZB 4J8UB 5B0ZC 3X1SC 2BYKB 1P3PD 1P3PC 4X23A 5CPIA 3AN2D 5GT0D 3AN2C 5GT0C 5CP6D 3AZGD 5CP6C 3AZGC 3AZID 3AZIC 1P3ID 5JRGA 1P3IC 4E45A 1R4VA 5B0YB 4EO5B 3AV1A 5B24D 1ZLAC 5DNMB 5B2JA 5B24C 5BO0A 5AVCA 1ID3D 1ID3C 3REHB 4J8UD 4E44A 4J8UC 1F1EA 3VH6T 3LZ1A 3AZLD 2HUEC 3AZLC 5CHLB 1P3MD 3W96B 1P3MC 3KWQA 4J8XB 3W98A 5KDMB 3AZJA 3MNNA 3AZMA 5AV8D 3W99D 5AV8C
chains in the Genus database with same CATH superfamily
3UTBA 3W99C 4J8VA 2YFVB 5CPKA 3RELB 3AFAD 2ZY5A 3AFAC 5AV5A 3MGPD 3MGQA 3KUYA 1N1JA 3MGPC 1JFIA 4ZUXB 3LJAA 1P3BB 5B0YD 5B0YC 2XD5A 4EO5C 4G92B 4XUJA 5GT3B 5G49A 3REHD 4H9SC 3REHC 1P34A 1B67A 3MGSB 2JCHA 1M1AA 1M18A 5E5AA 2VQRA 2YFWB 1U35B 4R8PA 3W96D 3W96C 5BS7C 1TZYB 4WU8B 2Y2NA 3X1SA 4H9RA 5B0ZA 4NE5A 1P3PA 5AY8B 3RELD 3REIB 3RELC 5B1LD 2PYOB 5B1LC 5B32B 4WNNA 2Y2HA 4ZUXD 3AN2A 4ZUXC 1P3KB 5GT0A 1BH9A 2FFFB 1AOIA 1BFMA 1P3BD 1P3BC 4KGCB 5GT3D 1P3GB 1EQZB 5GT3C 4H9PA 5F99A 3AZIA 3X1VA 3KXBD 3MGSD 1P3IA 3KXBC 3MGSC 3TU4B 3X1TA 3WKJB 1U35D 1U35C 3X1UB 1ZLAA 5B24A 4G91C 4CSRA 3UT9B 2HIOB 4WU8D 2IO5B 4WU8C 4J8UA 3B6FD 4UUZA 3B6FC 2BYKA 4LD9D 4LD9C 3REID 3C1CB 3REIC 2PYOD 1Q9CA 3A1IA 2PYOC 4WU9D 4WU9C 1P3KD 1P3KC 3AZNB 1EQZD 1EQZC 3A1KA 5FUGB 2NZDB 3AZFB 3X1UD 5B0YA 3X1UC 5DNMA 5B31B 3REHA 2IO5C 2Y2MA 3W97D 3W97C 3C1CD 2NQBB 3C1CC 3B0CT 5CP6B 3W96A 3AZGB 5B40B 5KDMA 1M19D 1BH8B 2YFVA 3NQUB 1M19C 3RELA 4DQYB 5B33D 5B33C 4ZUXA 1ID3B 5GSUB 3AZFD 1P3BA 3AZFC 3AZHD 3UTAB 2G5IC 5B31D 2HUEB 5GT3A 5B31C 3AZHC 3B0DC 3AZLB 1P3MB 2NQBD 1WWSA 3AZED 3MGSA 3AZEC 2NQBC 4NE6A 5AV8B 4DRBA 3W99B 2YFWA 3V9RB 1U35A 5B40D 5B40C 3VH6W 3AFAB 1TZYA 4WU8A 3MGPB 1F66B 5AY8A 2Y2LA 5CPJB 4LD9A 3P5JB 3REIA 4KUDB 2PYOA 5B32A 1KX3B 1P3KA 5GSUD 5GSUC 3LZ0B 4DRAA 3UTAD 3UTAC 1P3GA 1EQZA 2ZY3A 1P3FD 2FJ7B 2JSSA 3TU4A 3AV2D 3AV2C 4XZQB 3MVDD 3WKJA 3MVDC 2Y2OA 3WAAD 3X1UA 3WAAC 3WTPB 3UT9A 2HIOA 5B1LB 1F66D 5CPJD 3B0BA 4Z5TD 5CPJC 4Z5TC 1F66C 3AYWD 4KUDD 3C1CA 3AYWC 4KUDC 3KFUG 3LELB 1KX3D 1KX3C 4UPKA 1HQ3B 3LZ0D 2F8NB 3LZ0C 3AZNA 3KXBB 2Y2QA 3REKB 5FUGA 2FJ7D 5BNXB 2NZDA 4G91B 1P3OD 2FJ7C 1P3OC 3KSYA 4XZQD 4WV4B 4XZQC 3B6FB 3AZFA 3WTPD 4LD9B 3WTPC 5B31A 1S32B 2W8SA 4WU9B 5B2ID 5B2IC 2NQBA 3MGRB 3LELD 3LELC 3EPJA 3WA9D 3WA9C 1Z2CB 1HQ3D 5CP6A 3AZGA 1HQ3C 5B1MD 5BNVB 5B1MC 5B40A 2CV5C 2F8ND 3C1BB 1BH8A 3NQUA 3H0LC 3REKD 3REKC 3VH5W 1P3LB 3REJB 3AZKB 4YM6B 1ID3A 5GSUA 2CV5B 3O62B 3UTAA 3W97B 3AZLA 1S32D 1S32C 3F6TA 1P3MA 3VH5T 3MGRD 3MGRC 5AV8A 4KHAB 2L5AA 4Z66B 4H9QB 3W99A 3V9RA 1M19B 2ZY4A 3EPLA 3C1BD 3AFAA 3C1BC 5B33B 3MGPA 3B0CW 4J8WB 5B32G 5GXQB 1F66A 5CPJA 4M6BA 2BYMB 4KUDA 1P3LD 1KX3A 2UWXA 1P3LC 3REJD 3AZKD 4YM6D 3REJC 3AZHB 4YM6C 3AZKC 1ULYA 3B0DB 4H9SA 3LZ0A 3AV1D 2CV5D 3O62D 3AV1C 3WTPE 5B2JD 5DNNB 4CAYB 5B2JC 5AVCC 5AVCD 3O62C 3VH6A 3AZEB 5JA4B 1KX4B 5BS7A 2FJ7A 4XZQA 4Z66D 4H9OB 4Z2MH 4Z66C 4JJNB 1P3AB 3KWQD 3WTPA 3KWQC 4HGAB 5B1LA 3AZMD 2Y2KA 4J8WD 3AZMC 4J8WC 5GXQD 5GXQC 3A6NB 5CPKD 5CPKC 2RIQA 4QLCB 3LELA 4AWLB 3NQJB 5AV9B 1HQ3A 2F8NA 4WJ3C 4KGCD 4KGCC 5DNND 4WZSB 1P3FB 5DNNC 3KXBA 4XUJD 4XUJC 3AV2B 3MVDB 1ZLAD 3REKA 1KX4D 1KX4C 3WAAB 3IP4C 5BNXA 2F8NH 1M1AD 3FDDA 4JJND 1M1AC 5B31G 4JJNC 3B6FA 1P3AD 2AROB 4R8PD 1P3AC 4R8PC 4Z5TB 2DQNC 3AYWB 4HGAC 1S32A 4WU9A 3A6ND 4NE3A 3A6NC 4QLCD 3MGRA 4QLCC 4AWLC 5AV9D 5AV9C 1T3UA 5BNVA 1AOID 1AOIC 3B6GB 5C3IB 3C1BA 3R45B 1P3FC 1P3OB 5F99D 3X1VD 5F99C 3X1VC 1P3LA 3REJA 3AZKA 4YM6A 5AVBB 3X1TD 3X1TC 1H3OB 2AROD 1TAFB 2AROC 3H0RC 2CV5A 3O62A 3W97A 5B2IB 4YS3B 1KX5B 1B6WA 3WA9B 5B1MB 3EG5B 3VH5A 4KHAA 4Z66A 4H9QA 5AV6B 1M19A 4H9NB 3B6GD 3B6GC 5C3IC 5B33A 4J8WA 5GXQA 2BYMA 2Y2GA 3AZHA 4Z2MG 1KU5A 2F2AC 5AVBD 5AVBC 4ZBJB 4KGCA 4YS3D 5DNMD 1KX5D 5DNNA 5DNMC 4CAYA 4YS3C 4X23B 3AZEA 1KX5C 5CPIB 2J8PA 5JA4A 1KX4A 4H9OA 4JJNA 2CWEA 5AV6D 1P3AA 5AV6C 4J8XD 4J8XC 5JRGB 3A6NA 4QLCA 2F8NG 3AV1B 1WWIA 3NQJA 5B2JB 5AVCB 5BO0B 5AV9A 2F8NK 2ZM5A 4ZBJC 1P3FA 4X23D 3LZ1B 4G92C 4X23C 3AV2A 5CPID 5CPIC 3MVDA 2Y2PA 3WAAA 3KWQB 3W98B 3AZJB 3MNNB 3AZMB 3UTBB 2AROA 4J8VB 4Z5TA 2BG1A 5CPKB 3AYWA 1HTAA 1TZYD 1TZYC 5AV5B 3MGQB 1JFIB 3KUYB 1N1JB 5JRGD 5AY8D 5JRGC 5AY8C 4NFTA 3LJAB 5B32D 3EPHA 5B32C 4XUJB 5G49B 1A7WA 3B6GA 1P34B 3R45A 3LZ1D 3LZ1C 1P3GD 1P3OA 1P3GC 1M1AB 1M18B 5E5AB 4R8PB 3W98D 3TU4D 3MNND 5AVBA 3TU4C 3MNNC 3AZJC 3AZJD 3W98C 3WKJD 2RVQD 3UTBD 3WKJC 2RVQC 4H9RB 1H3OA 5B0ZB 1TAFA 3X1SB 4J8VD 4J8VC 3UTBC 1P3PB 5B2IA 4YS3A 1KX5A 3UT9D 2HIOD 3UT9C 2HIOC 5AV5D 3MGQD 5AV5C 3MGQC 3KUYD 3KUYC 4WNNB 3WA9A 2G5HC 3AN2B 5B1MA 1BH9B 5GT0B 3LJAD 1AOIB 3LJAC 2LY8A 5BT1D 5BT1C 2ZY2A 5AV6A 4H9NA 1PZRA 4H9PB 5F99B 4J8XA 3AZIB 3X1VB 1P34D 1P34C 2DF4C 3AZND 3AZNC 1P3IB 2Y2IA 3X1TB 1M18D 5E5AD 1M18C 5E5AC 1ZLAB 5B24B 2NZDD 2NZDC 4CSRB 3X1SD 5B0ZD 4UUZB 4J8UB 5B0ZC 3X1SC 2BYKB 1P3PD 1P3PC 4X23A 3EPKA 5CPIA 3AN2D 5GT0D 3AN2C 5GT0C 3AL0C 2JE5A 5CP6D 3AZGD 5CP6C 3AZGC 3AZID 2XD1A 3AZIC 1P3ID 5JRGA 1P3IC 4E45A 3H0MC 1R4VA 5B0YB 4EO5B 3AV1A 5B24D 1ZLAC 5DNMB 5B2JA 5B24C 5BO0A 5AVCA 1ID3D 1ID3C 3REHB 4J8UD 1W2EA 4E44A 4J8UC 1F1EA 3VH6T 3LZ1A 3AZLD 2HUEC 3AZLC 5CHLB 1P3MD 2Y2JA 1P3MC 3KWQA 4J8XB 3W96B 3W98A 5KDMB 3AZJA 3MNNA 3AZMA 5AV8D 3W99D 5AV8C
chains in the Genus database with same CATH topology
3UTBA 3W99C 4J8VA 2YFVB 5CPKA 3RELB 3AFAD 2ZY5A 3AFAC 5AV5A 3MGPD 3MGQA 3KUYA 1N1JA 3MGPC 1JFIA 4ZUXB 3LJAA 1P3BB 5B0YD 5B0YC 2XD5A 4EO5C 4G92B 4XUJA 5GT3B 5G49A 3REHD 4H9SC 3REHC 1P34A 1B67A 3MGSB 2JCHA 1M1AA 1M18A 5E5AA 2VQRA 2YFWB 1U35B 4R8PA 3W96D 3W96C 5BS7C 1TZYB 4WU8B 2Y2NA 3X1SA 4H9RA 5B0ZA 4NE5A 1P3PA 5AY8B 3RELD 3REIB 3RELC 5B1LD 2PYOB 5B1LC 5B32B 4WNNA 2Y2HA 4ZUXD 3AN2A 4ZUXC 1P3KB 5GT0A 1BH9A 2FFFB 1AOIA 1BFMA 1P3BD 1P3BC 4KGCB 5GT3D 1P3GB 1EQZB 5GT3C 4H9PA 5F99A 3AZIA 3X1VA 3KXBD 3MGSD 1P3IA 3KXBC 3MGSC 3TU4B 3X1TA 3WKJB 1U35D 1U35C 3X1UB 1ZLAA 5B24A 4G91C 4CSRA 3UT9B 2HIOB 4WU8D 2IO5B 4WU8C 4J8UA 3B6FD 4UUZA 3B6FC 2BYKA 4LD9D 4LD9C 3REID 3C1CB 3REIC 2PYOD 1Q9CA 3A1IA 2PYOC 4WU9D 4WU9C 1P3KD 1P3KC 3AZNB 1EQZD 1EQZC 3A1KA 5FUGB 2NZDB 3AZFB 3X1UD 5B0YA 3X1UC 5DNMA 5B31B 3REHA 2IO5C 2Y2MA 3W97D 3W97C 3C1CD 2NQBB 3C1CC 3B0CT 5CP6B 3W96A 3AZGB 5B40B 5KDMA 1M19D 1BH8B 2YFVA 3NQUB 1M19C 3RELA 4DQYB 5B33D 5B33C 4ZUXA 1ID3B 5GSUB 3AZFD 1P3BA 3AZFC 3AZHD 3UTAB 2G5IC 5B31D 2HUEB 5GT3A 5B31C 3AZHC 3B0DC 3AZLB 1P3MB 2NQBD 1WWSA 3AZED 3MGSA 3AZEC 2NQBC 4NE6A 5AV8B 4DRBA 3W99B 2YFWA 3V9RB 1U35A 5B40D 5B40C 3VH6W 3AFAB 1TZYA 4WU8A 3MGPB 1F66B 5AY8A 2Y2LA 5CPJB 4LD9A 3P5JB 3REIA 4KUDB 2PYOA 5B32A 1KX3B 1P3KA 5GSUD 5GSUC 3LZ0B 4DRAA 3UTAD 3UTAC 1P3GA 1EQZA 2ZY3A 1P3FD 2FJ7B 2JSSA 3TU4A 3AV2D 3AV2C 4XZQB 3MVDD 3WKJA 3MVDC 2Y2OA 3WAAD 3X1UA 3WAAC 3WTPB 3UT9A 2HIOA 5B1LB 1F66D 5CPJD 3B0BA 4Z5TD 5CPJC 4Z5TC 1F66C 3AYWD 4KUDD 3C1CA 3AYWC 4KUDC 3KFUG 3LELB 1KX3D 1KX3C 4UPKA 1HQ3B 3LZ0D 2F8NB 3LZ0C 3AZNA 3KXBB 2Y2QA 3REKB 5FUGA 2FJ7D 5BNXB 2NZDA 4G91B 1P3OD 2FJ7C 1P3OC 3KSYA 4XZQD 4WV4B 4XZQC 3B6FB 3AZFA 3WTPD 4LD9B 3WTPC 5B31A 1S32B 2W8SA 4WU9B 5B2ID 5B2IC 2NQBA 3MGRB 3LELD 3LELC 3EPJA 3WA9D 3WA9C 1Z2CB 1HQ3D 5CP6A 3AZGA 1HQ3C 5B1MD 5BNVB 5B1MC 5B40A 2CV5C 2F8ND 3C1BB 1BH8A 3NQUA 3H0LC 3REKD 3REKC 3VH5W 1P3LB 3REJB 3AZKB 4YM6B 1ID3A 5GSUA 2CV5B 3O62B 3UTAA 3W97B 3AZLA 1S32D 1S32C 3F6TA 1P3MA 3VH5T 3MGRD 3MGRC 5AV8A 4KHAB 2L5AA 4Z66B 4H9QB 3W99A 3V9RA 1M19B 2ZY4A 3EPLA 3C1BD 3AFAA 3C1BC 5B33B 3MGPA 3B0CW 4J8WB 5B32G 5GXQB 1F66A 5CPJA 4M6BA 2BYMB 4KUDA 1P3LD 1KX3A 2UWXA 1P3LC 3REJD 3AZKD 4YM6D 3REJC 3AZHB 4YM6C 3AZKC 1ULYA 3B0DB 4H9SA 3LZ0A 3AV1D 2CV5D 3O62D 3AV1C 3WTPE 5B2JD 5DNNB 4CAYB 5B2JC 5AVCC 5AVCD 3O62C 3VH6A 3AZEB 5JA4B 1KX4B 5BS7A 2FJ7A 4XZQA 4Z66D 4H9OB 4Z2MH 4Z66C 4JJNB 1P3AB 3KWQD 3WTPA 3KWQC 4HGAB 5B1LA 3AZMD 2Y2KA 4J8WD 3AZMC 4J8WC 5GXQD 5GXQC 3A6NB 5CPKD 5CPKC 2RIQA 4QLCB 3LELA 4AWLB 3NQJB 5AV9B 1HQ3A 2F8NA 4WJ3C 4KGCD 4KGCC 5DNND 4WZSB 1P3FB 5DNNC 3KXBA 4XUJD 4XUJC 3AV2B 3MVDB 1ZLAD 3REKA 1KX4D 1KX4C 3WAAB 3IP4C 5BNXA 2F8NH 1M1AD 3FDDA 4JJND 1M1AC 5B31G 4JJNC 3B6FA 1P3AD 2AROB 4R8PD 1P3AC 4R8PC 4Z5TB 2DQNC 3AYWB 4HGAC 1S32A 4WU9A 3A6ND 4NE3A 3A6NC 4QLCD 3MGRA 4QLCC 4AWLC 5AV9D 5AV9C 1T3UA 5BNVA 1AOID 1AOIC 3B6GB 5C3IB 3C1BA 3R45B 1P3FC 1P3OB 5F99D 3X1VD 5F99C 3X1VC 1P3LA 3REJA 3AZKA 4YM6A 5AVBB 3X1TD 3X1TC 1H3OB 2AROD 1TAFB 2AROC 3H0RC 2CV5A 3O62A 3W97A 5B2IB 4YS3B 1KX5B 1B6WA 3WA9B 5B1MB 3EG5B 3VH5A 4KHAA 4Z66A 4H9QA 5AV6B 1M19A 4H9NB 3B6GD 3B6GC 5C3IC 5B33A 4J8WA 5GXQA 2BYMA 2Y2GA 3AZHA 4Z2MG 1KU5A 2F2AC 5AVBD 5AVBC 4ZBJB 4KGCA 4YS3D 5DNMD 1KX5D 5DNNA 5DNMC 4CAYA 4YS3C 4X23B 3AZEA 1KX5C 5CPIB 2J8PA 5JA4A 1KX4A 4H9OA 4JJNA 2CWEA 5AV6D 1P3AA 5AV6C 4J8XD 4J8XC 5JRGB 3A6NA 4QLCA 2F8NG 3AV1B 1WWIA 3NQJA 5B2JB 5AVCB 5BO0B 5AV9A 2F8NK 2ZM5A 4ZBJC 1P3FA 4X23D 3LZ1B 4G92C 4X23C 3AV2A 5CPID 5CPIC 3MVDA 2Y2PA 3WAAA 3KWQB 3W98B 3AZJB 3MNNB 3AZMB 3UTBB 2AROA 4J8VB 4Z5TA 2BG1A 5CPKB 3AYWA 1HTAA 1TZYD 1TZYC 5AV5B 3MGQB 1JFIB 3KUYB 1N1JB 5JRGD 5AY8D 5JRGC 5AY8C 4NFTA 3LJAB 5B32D 3EPHA 5B32C 4XUJB 5G49B 1A7WA 3B6GA 1P34B 3R45A 3LZ1D 3LZ1C 1P3GD 1P3OA 1P3GC 1M1AB 1M18B 5E5AB 4R8PB 3W98D 3TU4D 3MNND 5AVBA 3TU4C 3MNNC 3AZJC 3AZJD 3W98C 3WKJD 2RVQD 3UTBD 3WKJC 2RVQC 4H9RB 1H3OA 5B0ZB 1TAFA 3X1SB 4J8VD 4J8VC 3UTBC 1P3PB 5B2IA 4YS3A 1KX5A 3UT9D 2HIOD 3UT9C 2HIOC 5AV5D 3MGQD 5AV5C 3MGQC 3KUYD 3KUYC 4WNNB 3WA9A 2G5HC 3AN2B 5B1MA 1BH9B 5GT0B 3LJAD 1AOIB 3LJAC 2LY8A 5BT1D 5BT1C 2ZY2A 5AV6A 4H9NA 1PZRA 4H9PB 5F99B 4J8XA 3AZIB 3X1VB 1P34D 1P34C 2DF4C 3AZND 3AZNC 1P3IB 2Y2IA 3X1TB 1M18D 5E5AD 1M18C 5E5AC 1ZLAB 5B24B 2NZDD 2NZDC 4CSRB 3X1SD 5B0ZD 4UUZB 4J8UB 5B0ZC 3X1SC 2BYKB 1P3PD 1P3PC 4X23A 3EPKA 5CPIA 3AN2D 5GT0D 3AN2C 5GT0C 3AL0C 2JE5A 5CP6D 3AZGD 5CP6C 3AZGC 3AZID 2XD1A 3AZIC 1P3ID 5JRGA 1P3IC 4E45A 3H0MC 1R4VA 5B0YB 4EO5B 3AV1A 5B24D 1ZLAC 5DNMB 5B2JA 5B24C 5BO0A 5AVCA 1ID3D 1ID3C 3REHB 4J8UD 1W2EA 4E44A 4J8UC 1F1EA 3VH6T 3LZ1A 3AZLD 2HUEC 3AZLC 5CHLB 1P3MD 2Y2JA 1P3MC 3KWQA 4J8XB 3W96B 3W98A 5KDMB 3AZJA 3MNNA 3AZMA 5AV8D 3W99D 5AV8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  3W99 C;  4J8V A;  2YFV B;  5CPK A;  3REL B;  3AFA D;  3AFA C;  5AV5 A;  3MGP D;  3MGQ A;  3KUY A;  1N1J A;  3MGP C;  1JFI A;  4ZUX B;  3LJA A;  1P3B B;  5B0Y D;  5B0Y C;  4EO5 C;  4G92 B;  4XUJ A;  5GT3 B;  5G49 A;  3REH D;  4H9S C;  3REH C;  1P34 A;  1B67 A;  3MGS B;  1M1A A;  1M18 A;  5E5A A;  2YFW B;  1U35 B;  4R8P A;  3W96 D;  3W96 C;  5BS7 C;  1TZY B;  4WU8 B;  3X1S A;  4H9R A;  5B0Z A;  4NE5 A;  1P3P A;  5AY8 B;  3REL D;  3REI B;  3REL C;  5B1L D;  2PYO B;  5B1L C;  5B32 B;  4WNN A;  4ZUX D;  3AN2 A;  4ZUX C;  1P3K B;  5GT0 A;  1BH9 A;  1AOI A;  1BFM A;  1P3B D;  1P3B C;  4KGC B;  5GT3 D;  1P3G B;  1EQZ B;  5GT3 C;  4H9P A;  5F99 A;  3AZI A;  3X1V A;  3KXB D;  3MGS D;  1P3I A;  3KXB C;  3MGS C;  3TU4 B;  3X1T A;  3WKJ B;  1U35 D;  1U35 C;  3X1U B;  1ZLA A;  5B24 A;  4G91 C;  4CSR A;  3UT9 B;  2HIO B;  4WU8 D;  2IO5 B;  4WU8 C;  4J8U A;  3B6F D;  4UUZ A;  3B6F C;  2BYK A;  4LD9 D;  4LD9 C;  3REI D;  3C1C B;  3REI C;  2PYO D;  1Q9C A;  2PYO C;  4WU9 D;  4WU9 C;  1P3K D;  1P3K C;  3AZN B;  1EQZ D;  1EQZ C;  5FUG B;  2NZD B;  3AZF B;  3X1U D;  5B0Y A;  3X1U C;  5DNM A;  5B31 B;  3REH A;  2IO5 C;  3W97 D;  3W97 C;  3C1C D;  2NQB B;  3C1C C;  3B0C T;  5CP6 B;  3W96 A;  3AZG B;  5B40 B;  5KDM A;  1M19 D;  1BH8 B;  2YFV A;  3NQU B;  1M19 C;  3REL A;  5B33 D;  5B33 C;  4ZUX A;  1ID3 B;  5GSU B;  3AZF D;  1P3B A;  3AZF C;  3AZH D;  3UTA B;  5B31 D;  3AZH C;  2HUE B;  5GT3 A;  5B31 C;  3AZL B;  3B0D C;  1P3M B;  2NQB D;  1WWS A;  3AZE D;  3MGS A;  3AZE C;  2NQB C;  4NE6 A;  5AV8 B;  4DRB A;  3W99 B;  2YFW A;  3V9R B;  1U35 A;  5B40 D;  5B40 C;  3VH6 W;  3AFA B;  1TZY A;  4WU8 A;  3MGP B;  1F66 B;  5AY8 A;  5CPJ B;  4LD9 A;  3REI A;  4KUD B;  2PYO A;  5B32 A;  1KX3 B;  1P3K A;  5GSU D;  5GSU C;  3LZ0 B;  4DRA A;  3UTA D;  3UTA C;  1P3G A;  1EQZ A;  1P3F D;  2FJ7 B;  2JSS A;  3TU4 A;  3AV2 D;  3AV2 C;  4XZQ B;  3MVD D;  3WKJ A;  3MVD C;  3WAA D;  3X1U A;  3WAA C;  3WTP B;  3UT9 A;  2HIO A;  5B1L B;  1F66 D;  5CPJ D;  3B0B A;  4Z5T D;  5CPJ C;  4Z5T C;  1F66 C;  3AYW D;  4KUD D;  3C1C A;  3AYW C;  4KUD C;  3LEL B;  1KX3 D;  1KX3 C;  1HQ3 B;  3LZ0 D;  2F8N B;  3LZ0 C;  3AZN A;  3KXB B;  3REK B;  5FUG A;  2FJ7 D;  5BNX B;  2NZD A;  4G91 B;  1P3O D;  2FJ7 C;  1P3O C;  3KSY A;  4XZQ D;  4WV4 B;  4XZQ C;  3B6F B;  3AZF A;  3WTP D;  4LD9 B;  3WTP C;  5B31 A;  1S32 B;  4WU9 B;  5B2I D;  5B2I C;  2NQB A;  3MGR B;  3LEL D;  3LEL C;  3WA9 D;  3WA9 C;  1HQ3 D;  5CP6 A;  3AZG A;  1HQ3 C;  5B1M D;  5BNV B;  5B1M C;  5B40 A;  2CV5 C;  2F8N D;  3C1B B;  1BH8 A;  3NQU A;  3REK D;  3REK C;  3VH5 W;  1P3L B;  3REJ B;  3AZK B;  4YM6 B;  1ID3 A;  5GSU A;  2CV5 B;  3O62 B;  3UTA A;  3W97 B;  3AZL A;  1S32 D;  1S32 C;  1P3M A;  3VH5 T;  3MGR D;  3MGR C;  5AV8 A;  4KHA B;  2L5A A;  4Z66 B;  4H9Q B;  3W99 A;  3V9R A;  1M19 B;  3C1B D;  3AFA A;  3C1B C;  5B33 B;  3MGP A;  3B0C W;  4J8W B;  5B32 G;  5GXQ B;  1F66 A;  5CPJ A;  4M6B A;  2BYM B;  4KUD A;  1P3L D;  1KX3 A;  1P3L C;  3REJ D;  3AZK D;  4YM6 D;  3REJ C;  3AZH B;  4YM6 C;  3AZK C;  1ULY A;  3B0D B;  4H9S A;  3LZ0 A;  3AV1 D;  2CV5 D;  3O62 D;  3AV1 C;  3WTP E;  5B2J D;  5DNN B;  4CAY B;  5B2J C;  5AVC D;  5AVC C;  3O62 C;  3VH6 A;  3AZE B;  5JA4 B;  1KX4 B;  5BS7 A;  2FJ7 A;  4XZQ A;  4Z66 D;  4H9O B;  4Z2M H;  4Z66 C;  4JJN B;  1P3A B;  3KWQ D;  3WTP A;  3KWQ C;  4HGA B;  5B1L A;  3AZM D;  4J8W D;  3AZM C;  4J8W C;  5GXQ D;  5GXQ C;  3A6N B;  5CPK D;  5CPK C;  4QLC B;  3LEL A;  4AWL B;  3NQJ B;  5AV9 B;  1HQ3 A;  2F8N A;  4KGC D;  4KGC C;  5DNN D;  4WZS B;  1P3F B;  5DNN C;  3KXB A;  4XUJ D;  4XUJ C;  3AV2 B;  3MVD B;  1ZLA D;  3REK A;  1KX4 D;  1KX4 C;  3WAA B;  5BNX A;  2F8N H;  1M1A D;  4JJN D;  1M1A C;  5B31 G;  4JJN C;  3B6F A;  1P3A D;  2ARO B;  4R8P D;  1P3A C;  4R8P C;  4Z5T B;  3AYW B;  4HGA C;  1S32 A;  4WU9 A;  3A6N D;  4NE3 A;  3A6N C;  4QLC D;  3MGR A;  4QLC C;  4AWL C;  5AV9 D;  5AV9 C;  5BNV A;  1AOI D;  1AOI C;  3B6G B;  5C3I B;  3C1B A;  3R45 B;  1P3F C;  1P3O B;  5F99 D;  3X1V D;  5F99 C;  3X1V C;  1P3L A;  3REJ A;  3AZK A;  4YM6 A;  5AVB B;  3X1T D;  3X1T C;  1H3O B;  2ARO D;  1TAF B;  2ARO C;  2CV5 A;  3O62 A;  3W97 A;  5B2I B;  4YS3 B;  1KX5 B;  1B6W A;  3WA9 B;  5B1M B;  3VH5 A;  4KHA A;  4Z66 A;  4H9Q A;  5AV6 B;  1M19 A;  4H9N B;  3B6G D;  3B6G C;  5C3I C;  5B33 A;  4J8W A;  5GXQ A;  2BYM A;  3AZH A;  4Z2M G;  1KU5 A;  5AVB D;  5AVB C;  4ZBJ B;  4KGC A;  4YS3 D;  5DNM D;  1KX5 D;  4YS3 C;  5DNM C;  5DNN A;  4CAY A;  4X23 B;  3AZE A;  1KX5 C;  5CPI B;  5JA4 A;  1KX4 A;  4H9O A;  4JJN A;  2CWE A;  5AV6 D;  1P3A A;  5AV6 C;  4J8X D;  4J8X C;  5JRG B;  3A6N A;  4QLC A;  2F8N G;  3AV1 B;  1WWI A;  3NQJ A;  5B2J B;  5AVC B;  5BO0 B;  5AV9 A;  2F8N K;  4ZBJ C;  1P3F A;  4X23 D;  3LZ1 B;  4G92 C;  4X23 C;  3AV2 A;  5CPI D;  5CPI C;  3MVD A;  3WAA A;  3KWQ B;  3W98 B;  3AZJ B;  3MNN B;  3AZM B;  3UTB B;  2ARO A;  4J8V B;  4Z5T A;  5CPK B;  3AYW A;  1HTA A;  1TZY D;  1TZY C;  5AV5 B;  3MGQ B;  1JFI B;  3KUY B;  1N1J B;  5JRG D;  5AY8 D;  5JRG C;  5AY8 C;  4NFT A;  3LJA B;  5B32 D;  5B32 C;  4XUJ B;  5G49 B;  1A7W A;  3B6G A;  1P34 B;  3R45 A;  3LZ1 D;  3LZ1 C;  1P3G D;  1P3O A;  1P3G C;  1M1A B;  1M18 B;  5E5A B;  4R8P B;  3W98 D;  3TU4 D;  3MNN D;  5AVB A;  3TU4 C;  3MNN C;  3AZJ C;  3AZJ D;  3W98 C;  3WKJ D;  2RVQ D;  3UTB D;  3WKJ C;  2RVQ C;  4H9R B;  1H3O A;  5B0Z B;  1TAF A;  3X1S B;  4J8V D;  4J8V C;  3UTB C;  1P3P B;  5B2I A;  4YS3 A;  1KX5 A;  3UT9 D;  2HIO D;  3UT9 C;  2HIO C;  5AV5 D;  3MGQ D;  5AV5 C;  3MGQ C;  3KUY D;  3KUY C;  4WNN B;  3WA9 A;  3AN2 B;  5B1M A;  1BH9 B;  5GT0 B;  3LJA D;  1AOI B;  3LJA C;  2LY8 A;  5BT1 D;  5BT1 C;  5AV6 A;  4H9N A;  4H9P B;  5F99 B;  4J8X A;  3AZI B;  3X1V B;  1P34 D;  1P34 C;  3AZN D;  3AZN C;  1P3I B;  3X1T B;  1M18 D;  5E5A D;  1M18 C;  5E5A C;  1ZLA B;  5B24 B;  2NZD D;  2NZD C;  4CSR B;  3X1S D;  5B0Z D;  4UUZ B;  4J8U B;  5B0Z C;  3X1S C;  2BYK B;  1P3P D;  1P3P C;  4X23 A;  5CPI A;  3AN2 D;  5GT0 D;  3AN2 C;  5GT0 C;  5CP6 D;  3AZG D;  5CP6 C;  3AZG C;  3AZI D;  3AZI C;  1P3I D;  5JRG A;  1P3I C;  4E45 A;  1R4V A;  5B0Y B;  4EO5 B;  3AV1 A;  5B24 D;  1ZLA C;  5DNM B;  5B2J A;  5B24 C;  5BO0 A;  5AVC A;  1ID3 D;  1ID3 C;  3REH B;  4J8U D;  4E44 A;  4J8U C;  1F1E A;  3VH6 T;  3LZ1 A;  3AZL D;  2HUE C;  3AZL C;  5CHL B;  1P3M D;  3W96 B;  1P3M C;  3KWQ A;  4J8X B;  3W98 A;  5KDM B;  3AZJ A;  3MNN A;  3AZM A;  5AV8 D;  3W99 D;  5AV8 C; 
#chains in the Genus database with same CATH topology
 3UTB A;  3W99 C;  4J8V A;  2YFV B;  5CPK A;  3REL B;  3AFA D;  2ZY5 A;  3AFA C;  5AV5 A;  3MGP D;  3MGQ A;  3KUY A;  1N1J A;  3MGP C;  1JFI A;  4ZUX B;  3LJA A;  1P3B B;  5B0Y D;  5B0Y C;  2XD5 A;  4EO5 C;  4G92 B;  4XUJ A;  5GT3 B;  5G49 A;  3REH D;  4H9S C;  3REH C;  1P34 A;  1B67 A;  3MGS B;  2JCH A;  1M1A A;  1M18 A;  5E5A A;  2VQR A;  2YFW B;  1U35 B;  4R8P A;  3W96 D;  3W96 C;  5BS7 C;  1TZY B;  4WU8 B;  2Y2N A;  3X1S A;  4H9R A;  5B0Z A;  4NE5 A;  1P3P A;  5AY8 B;  3REL D;  3REI B;  3REL C;  5B1L D;  2PYO B;  5B1L C;  5B32 B;  4WNN A;  2Y2H A;  4ZUX D;  3AN2 A;  4ZUX C;  1P3K B;  5GT0 A;  1BH9 A;  2FFF B;  1AOI A;  1BFM A;  1P3B D;  1P3B C;  4KGC B;  5GT3 D;  1P3G B;  1EQZ B;  5GT3 C;  4H9P A;  5F99 A;  3AZI A;  3X1V A;  3KXB D;  3MGS D;  1P3I A;  3KXB C;  3MGS C;  3TU4 B;  3X1T A;  3WKJ B;  1U35 D;  1U35 C;  3X1U B;  1ZLA A;  5B24 A;  4G91 C;  4CSR A;  3UT9 B;  2HIO B;  4WU8 D;  2IO5 B;  4WU8 C;  4J8U A;  3B6F D;  4UUZ A;  3B6F C;  2BYK A;  4LD9 D;  4LD9 C;  3REI D;  3C1C B;  3REI C;  2PYO D;  1Q9C A;  3A1I A;  2PYO C;  4WU9 D;  4WU9 C;  1P3K D;  1P3K C;  3AZN B;  1EQZ D;  1EQZ C;  3A1K A;  5FUG B;  2NZD B;  3AZF B;  3X1U D;  5B0Y A;  3X1U C;  5DNM A;  5B31 B;  3REH A;  2IO5 C;  2Y2M A;  3W97 D;  3W97 C;  3C1C D;  2NQB B;  3C1C C;  3B0C T;  5CP6 B;  3W96 A;  3AZG B;  5B40 B;  5KDM A;  1M19 D;  1BH8 B;  2YFV A;  3NQU B;  1M19 C;  3REL A;  4DQY B;  5B33 D;  5B33 C;  4ZUX A;  1ID3 B;  5GSU B;  3AZF D;  1P3B A;  3AZF C;  3AZH D;  3UTA B;  2G5I C;  5B31 D;  2HUE B;  5GT3 A;  5B31 C;  3AZH C;  3B0D C;  3AZL B;  1P3M B;  2NQB D;  1WWS A;  3AZE D;  3MGS A;  3AZE C;  2NQB C;  4NE6 A;  5AV8 B;  4DRB A;  3W99 B;  2YFW A;  3V9R B;  1U35 A;  5B40 D;  5B40 C;  3VH6 W;  3AFA B;  1TZY A;  4WU8 A;  3MGP B;  1F66 B;  5AY8 A;  2Y2L A;  5CPJ B;  4LD9 A;  3P5J B;  3REI A;  4KUD B;  2PYO A;  5B32 A;  1KX3 B;  1P3K A;  5GSU D;  5GSU C;  3LZ0 B;  4DRA A;  3UTA D;  3UTA C;  1P3G A;  1EQZ A;  2ZY3 A;  1P3F D;  2FJ7 B;  2JSS A;  3TU4 A;  3AV2 D;  3AV2 C;  4XZQ B;  3MVD D;  3WKJ A;  3MVD C;  2Y2O A;  3WAA D;  3X1U A;  3WAA C;  3WTP B;  3UT9 A;  2HIO A;  5B1L B;  1F66 D;  5CPJ D;  3B0B A;  4Z5T D;  5CPJ C;  4Z5T C;  1F66 C;  3AYW D;  4KUD D;  3C1C A;  3AYW C;  4KUD C;  3KFU G;  3LEL B;  1KX3 D;  1KX3 C;  4UPK A;  1HQ3 B;  3LZ0 D;  2F8N B;  3LZ0 C;  3AZN A;  3KXB B;  2Y2Q A;  3REK B;  5FUG A;  2FJ7 D;  5BNX B;  2NZD A;  4G91 B;  1P3O D;  2FJ7 C;  1P3O C;  3KSY A;  4XZQ D;  4WV4 B;  4XZQ C;  3B6F B;  3AZF A;  3WTP D;  4LD9 B;  3WTP C;  5B31 A;  1S32 B;  2W8S A;  4WU9 B;  5B2I D;  5B2I C;  2NQB A;  3MGR B;  3LEL D;  3LEL C;  3EPJ A;  3WA9 D;  3WA9 C;  1Z2C B;  1HQ3 D;  5CP6 A;  3AZG A;  1HQ3 C;  5B1M D;  5BNV B;  5B1M C;  5B40 A;  2CV5 C;  2F8N D;  3C1B B;  1BH8 A;  3NQU A;  3H0L C;  3REK D;  3REK C;  3VH5 W;  1P3L B;  3REJ B;  3AZK B;  4YM6 B;  1ID3 A;  5GSU A;  2CV5 B;  3O62 B;  3UTA A;  3W97 B;  3AZL A;  1S32 D;  1S32 C;  3F6T A;  1P3M A;  3VH5 T;  3MGR D;  3MGR C;  5AV8 A;  4KHA B;  2L5A A;  4Z66 B;  4H9Q B;  3W99 A;  3V9R A;  1M19 B;  2ZY4 A;  3EPL A;  3C1B D;  3AFA A;  3C1B C;  5B33 B;  3MGP A;  3B0C W;  4J8W B;  5B32 G;  5GXQ B;  1F66 A;  5CPJ A;  4M6B A;  2BYM B;  4KUD A;  1P3L D;  1KX3 A;  2UWX A;  1P3L C;  3REJ D;  3AZK D;  4YM6 D;  3REJ C;  3AZH B;  4YM6 C;  3AZK C;  1ULY A;  3B0D B;  4H9S A;  3LZ0 A;  3AV1 D;  2CV5 D;  3O62 D;  3AV1 C;  3WTP E;  5B2J D;  5DNN B;  4CAY B;  5B2J C;  5AVC C;  5AVC D;  3O62 C;  3VH6 A;  3AZE B;  5JA4 B;  1KX4 B;  5BS7 A;  2FJ7 A;  4XZQ A;  4Z66 D;  4H9O B;  4Z2M H;  4Z66 C;  4JJN B;  1P3A B;  3KWQ D;  3WTP A;  3KWQ C;  4HGA B;  5B1L A;  3AZM D;  2Y2K A;  4J8W D;  3AZM C;  4J8W C;  5GXQ D;  5GXQ C;  3A6N B;  5CPK D;  5CPK C;  2RIQ A;  4QLC B;  3LEL A;  4AWL B;  3NQJ B;  5AV9 B;  1HQ3 A;  2F8N A;  4WJ3 C;  4KGC D;  4KGC C;  5DNN D;  4WZS B;  1P3F B;  5DNN C;  3KXB A;  4XUJ D;  4XUJ C;  3AV2 B;  3MVD B;  1ZLA D;  3REK A;  1KX4 D;  1KX4 C;  3WAA B;  3IP4 C;  5BNX A;  2F8N H;  1M1A D;  3FDD A;  4JJN D;  1M1A C;  5B31 G;  4JJN C;  3B6F A;  1P3A D;  2ARO B;  4R8P D;  1P3A C;  4R8P C;  4Z5T B;  2DQN C;  3AYW B;  4HGA C;  1S32 A;  4WU9 A;  3A6N D;  4NE3 A;  3A6N C;  4QLC D;  3MGR A;  4QLC C;  4AWL C;  5AV9 D;  5AV9 C;  1T3U A;  5BNV A;  1AOI D;  1AOI C;  3B6G B;  5C3I B;  3C1B A;  3R45 B;  1P3F C;  1P3O B;  5F99 D;  3X1V D;  5F99 C;  3X1V C;  1P3L A;  3REJ A;  3AZK A;  4YM6 A;  5AVB B;  3X1T D;  3X1T C;  1H3O B;  2ARO D;  1TAF B;  2ARO C;  3H0R C;  2CV5 A;  3O62 A;  3W97 A;  5B2I B;  4YS3 B;  1KX5 B;  1B6W A;  3WA9 B;  5B1M B;  3EG5 B;  3VH5 A;  4KHA A;  4Z66 A;  4H9Q A;  5AV6 B;  1M19 A;  4H9N B;  3B6G D;  3B6G C;  5C3I C;  5B33 A;  4J8W A;  5GXQ A;  2BYM A;  2Y2G A;  3AZH A;  4Z2M G;  1KU5 A;  2F2A C;  5AVB D;  5AVB C;  4ZBJ B;  4KGC A;  4YS3 D;  5DNM D;  1KX5 D;  5DNN A;  5DNM C;  4CAY A;  4YS3 C;  4X23 B;  3AZE A;  1KX5 C;  5CPI B;  2J8P A;  5JA4 A;  1KX4 A;  4H9O A;  4JJN A;  2CWE A;  5AV6 D;  1P3A A;  5AV6 C;  4J8X D;  4J8X C;  5JRG B;  3A6N A;  4QLC A;  2F8N G;  3AV1 B;  1WWI A;  3NQJ A;  5B2J B;  5AVC B;  5BO0 B;  5AV9 A;  2F8N K;  2ZM5 A;  4ZBJ C;  1P3F A;  4X23 D;  3LZ1 B;  4G92 C;  4X23 C;  3AV2 A;  5CPI D;  5CPI C;  3MVD A;  2Y2P A;  3WAA A;  3KWQ B;  3W98 B;  3AZJ B;  3MNN B;  3AZM B;  3UTB B;  2ARO A;  4J8V B;  4Z5T A;  2BG1 A;  5CPK B;  3AYW A;  1HTA A;  1TZY D;  1TZY C;  5AV5 B;  3MGQ B;  1JFI B;  3KUY B;  1N1J B;  5JRG D;  5AY8 D;  5JRG C;  5AY8 C;  4NFT A;  3LJA B;  5B32 D;  3EPH A;  5B32 C;  4XUJ B;  5G49 B;  1A7W A;  3B6G A;  1P34 B;  3R45 A;  3LZ1 D;  3LZ1 C;  1P3G D;  1P3O A;  1P3G C;  1M1A B;  1M18 B;  5E5A B;  4R8P B;  3W98 D;  3TU4 D;  3MNN D;  5AVB A;  3TU4 C;  3MNN C;  3AZJ C;  3AZJ D;  3W98 C;  3WKJ D;  2RVQ D;  3UTB D;  3WKJ C;  2RVQ C;  4H9R B;  1H3O A;  5B0Z B;  1TAF A;  3X1S B;  4J8V D;  4J8V C;  3UTB C;  1P3P B;  5B2I A;  4YS3 A;  1KX5 A;  3UT9 D;  2HIO D;  3UT9 C;  2HIO C;  5AV5 D;  3MGQ D;  5AV5 C;  3MGQ C;  3KUY D;  3KUY C;  4WNN B;  3WA9 A;  2G5H C;  3AN2 B;  5B1M A;  1BH9 B;  5GT0 B;  3LJA D;  1AOI B;  3LJA C;  2LY8 A;  5BT1 D;  5BT1 C;  2ZY2 A;  5AV6 A;  4H9N A;  1PZR A;  4H9P B;  5F99 B;  4J8X A;  3AZI B;  3X1V B;  1P34 D;  1P34 C;  2DF4 C;  3AZN D;  3AZN C;  1P3I B;  2Y2I A;  3X1T B;  1M18 D;  5E5A D;  1M18 C;  5E5A C;  1ZLA B;  5B24 B;  2NZD D;  2NZD C;  4CSR B;  3X1S D;  5B0Z D;  4UUZ B;  4J8U B;  5B0Z C;  3X1S C;  2BYK B;  1P3P D;  1P3P C;  4X23 A;  3EPK A;  5CPI A;  3AN2 D;  5GT0 D;  3AN2 C;  5GT0 C;  3AL0 C;  2JE5 A;  5CP6 D;  3AZG D;  5CP6 C;  3AZG C;  3AZI D;  2XD1 A;  3AZI C;  1P3I D;  5JRG A;  1P3I C;  4E45 A;  3H0M C;  1R4V A;  5B0Y B;  4EO5 B;  3AV1 A;  5B24 D;  1ZLA C;  5DNM B;  5B2J A;  5B24 C;  5BO0 A;  5AVC A;  1ID3 D;  1ID3 C;  3REH B;  4J8U D;  1W2E A;  4E44 A;  4J8U C;  1F1E A;  3VH6 T;  3LZ1 A;  3AZL D;  2HUE C;  3AZL C;  5CHL B;  1P3M D;  2Y2J A;  1P3M C;  3KWQ A;  4J8X B;  3W96 B;  3W98 A;  5KDM B;  3AZJ A;  3MNN A;  3AZM A;  5AV8 D;  3W99 D;  5AV8 C; 
#chains in the Genus database with same CATH homology
 3UTB A;  3W99 C;  4J8V A;  2YFV B;  5CPK A;  3REL B;  3AFA D;  2ZY5 A;  3AFA C;  5AV5 A;  3MGP D;  3MGQ A;  3KUY A;  1N1J A;  3MGP C;  1JFI A;  4ZUX B;  3LJA A;  1P3B B;  5B0Y D;  5B0Y C;  2XD5 A;  4EO5 C;  4G92 B;  4XUJ A;  5GT3 B;  5G49 A;  3REH D;  4H9S C;  3REH C;  1P34 A;  1B67 A;  3MGS B;  2JCH A;  1M1A A;  1M18 A;  5E5A A;  2VQR A;  2YFW B;  1U35 B;  4R8P A;  3W96 D;  3W96 C;  5BS7 C;  1TZY B;  4WU8 B;  2Y2N A;  3X1S A;  4H9R A;  5B0Z A;  4NE5 A;  1P3P A;  5AY8 B;  3REL D;  3REI B;  3REL C;  5B1L D;  2PYO B;  5B1L C;  5B32 B;  4WNN A;  2Y2H A;  4ZUX D;  3AN2 A;  4ZUX C;  1P3K B;  5GT0 A;  1BH9 A;  2FFF B;  1AOI A;  1BFM A;  1P3B D;  1P3B C;  4KGC B;  5GT3 D;  1P3G B;  1EQZ B;  5GT3 C;  4H9P A;  5F99 A;  3AZI A;  3X1V A;  3KXB D;  3MGS D;  1P3I A;  3KXB C;  3MGS C;  3TU4 B;  3X1T A;  3WKJ B;  1U35 D;  1U35 C;  3X1U B;  1ZLA A;  5B24 A;  4G91 C;  4CSR A;  3UT9 B;  2HIO B;  4WU8 D;  2IO5 B;  4WU8 C;  4J8U A;  3B6F D;  4UUZ A;  3B6F C;  2BYK A;  4LD9 D;  4LD9 C;  3REI D;  3C1C B;  3REI C;  2PYO D;  1Q9C A;  3A1I A;  2PYO C;  4WU9 D;  4WU9 C;  1P3K D;  1P3K C;  3AZN B;  1EQZ D;  1EQZ C;  3A1K A;  5FUG B;  2NZD B;  3AZF B;  3X1U D;  5B0Y A;  3X1U C;  5DNM A;  5B31 B;  3REH A;  2IO5 C;  2Y2M A;  3W97 D;  3W97 C;  3C1C D;  2NQB B;  3C1C C;  3B0C T;  5CP6 B;  3W96 A;  3AZG B;  5B40 B;  5KDM A;  1M19 D;  1BH8 B;  2YFV A;  3NQU B;  1M19 C;  3REL A;  4DQY B;  5B33 D;  5B33 C;  4ZUX A;  1ID3 B;  5GSU B;  3AZF D;  1P3B A;  3AZF C;  3AZH D;  3UTA B;  2G5I C;  5B31 D;  2HUE B;  5GT3 A;  5B31 C;  3AZH C;  3B0D C;  3AZL B;  1P3M B;  2NQB D;  1WWS A;  3AZE D;  3MGS A;  3AZE C;  2NQB C;  4NE6 A;  5AV8 B;  4DRB A;  3W99 B;  2YFW A;  3V9R B;  1U35 A;  5B40 D;  5B40 C;  3VH6 W;  3AFA B;  1TZY A;  4WU8 A;  3MGP B;  1F66 B;  5AY8 A;  2Y2L A;  5CPJ B;  4LD9 A;  3P5J B;  3REI A;  4KUD B;  2PYO A;  5B32 A;  1KX3 B;  1P3K A;  5GSU D;  5GSU C;  3LZ0 B;  4DRA A;  3UTA D;  3UTA C;  1P3G A;  1EQZ A;  2ZY3 A;  1P3F D;  2FJ7 B;  2JSS A;  3TU4 A;  3AV2 D;  3AV2 C;  4XZQ B;  3MVD D;  3WKJ A;  3MVD C;  2Y2O A;  3WAA D;  3X1U A;  3WAA C;  3WTP B;  3UT9 A;  2HIO A;  5B1L B;  1F66 D;  5CPJ D;  3B0B A;  4Z5T D;  5CPJ C;  4Z5T C;  1F66 C;  3AYW D;  4KUD D;  3C1C A;  3AYW C;  4KUD C;  3KFU G;  3LEL B;  1KX3 D;  1KX3 C;  4UPK A;  1HQ3 B;  3LZ0 D;  2F8N B;  3LZ0 C;  3AZN A;  3KXB B;  2Y2Q A;  3REK B;  5FUG A;  2FJ7 D;  5BNX B;  2NZD A;  4G91 B;  1P3O D;  2FJ7 C;  1P3O C;  3KSY A;  4XZQ D;  4WV4 B;  4XZQ C;  3B6F B;  3AZF A;  3WTP D;  4LD9 B;  3WTP C;  5B31 A;  1S32 B;  2W8S A;  4WU9 B;  5B2I D;  5B2I C;  2NQB A;  3MGR B;  3LEL D;  3LEL C;  3EPJ A;  3WA9 D;  3WA9 C;  1Z2C B;  1HQ3 D;  5CP6 A;  3AZG A;  1HQ3 C;  5B1M D;  5BNV B;  5B1M C;  5B40 A;  2CV5 C;  2F8N D;  3C1B B;  1BH8 A;  3NQU A;  3H0L C;  3REK D;  3REK C;  3VH5 W;  1P3L B;  3REJ B;  3AZK B;  4YM6 B;  1ID3 A;  5GSU A;  2CV5 B;  3O62 B;  3UTA A;  3W97 B;  3AZL A;  1S32 D;  1S32 C;  3F6T A;  1P3M A;  3VH5 T;  3MGR D;  3MGR C;  5AV8 A;  4KHA B;  2L5A A;  4Z66 B;  4H9Q B;  3W99 A;  3V9R A;  1M19 B;  2ZY4 A;  3EPL A;  3C1B D;  3AFA A;  3C1B C;  5B33 B;  3MGP A;  3B0C W;  4J8W B;  5B32 G;  5GXQ B;  1F66 A;  5CPJ A;  4M6B A;  2BYM B;  4KUD A;  1P3L D;  1KX3 A;  2UWX A;  1P3L C;  3REJ D;  3AZK D;  4YM6 D;  3REJ C;  3AZH B;  4YM6 C;  3AZK C;  1ULY A;  3B0D B;  4H9S A;  3LZ0 A;  3AV1 D;  2CV5 D;  3O62 D;  3AV1 C;  3WTP E;  5B2J D;  5DNN B;  4CAY B;  5B2J C;  5AVC C;  5AVC D;  3O62 C;  3VH6 A;  3AZE B;  5JA4 B;  1KX4 B;  5BS7 A;  2FJ7 A;  4XZQ A;  4Z66 D;  4H9O B;  4Z2M H;  4Z66 C;  4JJN B;  1P3A B;  3KWQ D;  3WTP A;  3KWQ C;  4HGA B;  5B1L A;  3AZM D;  2Y2K A;  4J8W D;  3AZM C;  4J8W C;  5GXQ D;  5GXQ C;  3A6N B;  5CPK D;  5CPK C;  2RIQ A;  4QLC B;  3LEL A;  4AWL B;  3NQJ B;  5AV9 B;  1HQ3 A;  2F8N A;  4WJ3 C;  4KGC D;  4KGC C;  5DNN D;  4WZS B;  1P3F B;  5DNN C;  3KXB A;  4XUJ D;  4XUJ C;  3AV2 B;  3MVD B;  1ZLA D;  3REK A;  1KX4 D;  1KX4 C;  3WAA B;  3IP4 C;  5BNX A;  2F8N H;  1M1A D;  3FDD A;  4JJN D;  1M1A C;  5B31 G;  4JJN C;  3B6F A;  1P3A D;  2ARO B;  4R8P D;  1P3A C;  4R8P C;  4Z5T B;  2DQN C;  3AYW B;  4HGA C;  1S32 A;  4WU9 A;  3A6N D;  4NE3 A;  3A6N C;  4QLC D;  3MGR A;  4QLC C;  4AWL C;  5AV9 D;  5AV9 C;  1T3U A;  5BNV A;  1AOI D;  1AOI C;  3B6G B;  5C3I B;  3C1B A;  3R45 B;  1P3F C;  1P3O B;  5F99 D;  3X1V D;  5F99 C;  3X1V C;  1P3L A;  3REJ A;  3AZK A;  4YM6 A;  5AVB B;  3X1T D;  3X1T C;  1H3O B;  2ARO D;  1TAF B;  2ARO C;  3H0R C;  2CV5 A;  3O62 A;  3W97 A;  5B2I B;  4YS3 B;  1KX5 B;  1B6W A;  3WA9 B;  5B1M B;  3EG5 B;  3VH5 A;  4KHA A;  4Z66 A;  4H9Q A;  5AV6 B;  1M19 A;  4H9N B;  3B6G D;  3B6G C;  5C3I C;  5B33 A;  4J8W A;  5GXQ A;  2BYM A;  2Y2G A;  3AZH A;  4Z2M G;  1KU5 A;  2F2A C;  5AVB D;  5AVB C;  4ZBJ B;  4KGC A;  4YS3 D;  5DNM D;  1KX5 D;  5DNN A;  5DNM C;  4CAY A;  4YS3 C;  4X23 B;  3AZE A;  1KX5 C;  5CPI B;  2J8P A;  5JA4 A;  1KX4 A;  4H9O A;  4JJN A;  2CWE A;  5AV6 D;  1P3A A;  5AV6 C;  4J8X D;  4J8X C;  5JRG B;  3A6N A;  4QLC A;  2F8N G;  3AV1 B;  1WWI A;  3NQJ A;  5B2J B;  5AVC B;  5BO0 B;  5AV9 A;  2F8N K;  2ZM5 A;  4ZBJ C;  1P3F A;  4X23 D;  3LZ1 B;  4G92 C;  4X23 C;  3AV2 A;  5CPI D;  5CPI C;  3MVD A;  2Y2P A;  3WAA A;  3KWQ B;  3W98 B;  3AZJ B;  3MNN B;  3AZM B;  3UTB B;  2ARO A;  4J8V B;  4Z5T A;  2BG1 A;  5CPK B;  3AYW A;  1HTA A;  1TZY D;  1TZY C;  5AV5 B;  3MGQ B;  1JFI B;  3KUY B;  1N1J B;  5JRG D;  5AY8 D;  5JRG C;  5AY8 C;  4NFT A;  3LJA B;  5B32 D;  3EPH A;  5B32 C;  4XUJ B;  5G49 B;  1A7W A;  3B6G A;  1P34 B;  3R45 A;  3LZ1 D;  3LZ1 C;  1P3G D;  1P3O A;  1P3G C;  1M1A B;  1M18 B;  5E5A B;  4R8P B;  3W98 D;  3TU4 D;  3MNN D;  5AVB A;  3TU4 C;  3MNN C;  3AZJ C;  3AZJ D;  3W98 C;  3WKJ D;  2RVQ D;  3UTB D;  3WKJ C;  2RVQ C;  4H9R B;  1H3O A;  5B0Z B;  1TAF A;  3X1S B;  4J8V D;  4J8V C;  3UTB C;  1P3P B;  5B2I A;  4YS3 A;  1KX5 A;  3UT9 D;  2HIO D;  3UT9 C;  2HIO C;  5AV5 D;  3MGQ D;  5AV5 C;  3MGQ C;  3KUY D;  3KUY C;  4WNN B;  3WA9 A;  2G5H C;  3AN2 B;  5B1M A;  1BH9 B;  5GT0 B;  3LJA D;  1AOI B;  3LJA C;  2LY8 A;  5BT1 D;  5BT1 C;  2ZY2 A;  5AV6 A;  4H9N A;  1PZR A;  4H9P B;  5F99 B;  4J8X A;  3AZI B;  3X1V B;  1P34 D;  1P34 C;  2DF4 C;  3AZN D;  3AZN C;  1P3I B;  2Y2I A;  3X1T B;  1M18 D;  5E5A D;  1M18 C;  5E5A C;  1ZLA B;  5B24 B;  2NZD D;  2NZD C;  4CSR B;  3X1S D;  5B0Z D;  4UUZ B;  4J8U B;  5B0Z C;  3X1S C;  2BYK B;  1P3P D;  1P3P C;  4X23 A;  3EPK A;  5CPI A;  3AN2 D;  5GT0 D;  3AN2 C;  5GT0 C;  3AL0 C;  2JE5 A;  5CP6 D;  3AZG D;  5CP6 C;  3AZG C;  3AZI D;  2XD1 A;  3AZI C;  1P3I D;  5JRG A;  1P3I C;  4E45 A;  3H0M C;  1R4V A;  5B0Y B;  4EO5 B;  3AV1 A;  5B24 D;  1ZLA C;  5DNM B;  5B2J A;  5B24 C;  5BO0 A;  5AVC A;  1ID3 D;  1ID3 C;  3REH B;  4J8U D;  1W2E A;  4E44 A;  4J8U C;  1F1E A;  3VH6 T;  3LZ1 A;  3AZL D;  2HUE C;  3AZL C;  5CHL B;  1P3M D;  2Y2J A;  1P3M C;  3KWQ A;  4J8X B;  3W96 B;  3W98 A;  5KDM B;  3AZJ A;  3MNN A;  3AZM A;  5AV8 D;  3W99 D;  5AV8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...