1P3OD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oD00
3MGRA 3C1CD 5BS7C 5GT0C 1KX5C 5BT1C 4QLCB 4Z66A 3R45A 1P3KD 3C1BB 4Z2MG 4CSRA 5AVCA 5B32G 1P3BA 3VH6T 4AWLB 4G92B 2NZDD 3AZLA 3AFAC 4YM6A 2YFWB 4WU8B 3KXBC 3B0CW 1S32A 5BT1D 3KWQD 3B0BA 3AZND 3O62B 1P3KC 4QLCC 4KGCD 1HTAA 5CPID 1KX5B 1M1AA 3C1BC 5AY8A 5B40B 5DNMB 5B1MD 3VH6W 5GSUD 3UTBA 4LD9B 5AV6A 4Z66C 3AZEB 3UTAB 3KXBA 4G92C 5C3IC 1HQ3A 4H9PA 1R4VA 1Q9CA 3UTAD 3REHD 1P3FA 1M19B 5AV5C 3RELC 1P3BB 3KXBB 3W97C 1P3KB 3V9RA 4X23A 5B31B 3TU4D 3MVDC 1P3AC 1ZLAC 5B0ZB 3REID 2HUEC 1P3GA 1P3LB 3AN2A 5AV9D 1EQZA 4WZSB 3UT9D 2NZDC 5DNNA 3W99A 3UTAC 1B67A 3NQUB 3NQJB 3MNNB 3AZFA 3REKD 3WAAA 1U35D 4J8WB 5BNXA 1M19C 3REKC 5GXQA 5B1LA 3TU4C 3AZGC 3LZ0D 5CPIC 4WU8C 1ZLAB 4Z5TA 5AV9C 2HUEB 3A6NC 4R8PB 1P3OB 4J8VB 1ID3B 1P3PB 3LELB 2NZDB 4ZUXD 5AV8C 3WA9D 3AFAA 3UTBC 1KX3D 3B0DC 5B0YD 1N1JA 4J8WC 2F8ND 1KX4D 1P3MC 5B24C 3B6GD 3W96C 3LELA 1ZLAD 5B1LC 3AZIB 5AV9B 3AZLB 4G91C 3B6GC 4WNNA 4NE5A 5DNMD 4J8XA 5AV5D 2YFVA 4ZUXC 3REJA 5B0ZC 1P3PC 1AOIA 3KWQB 3R45B 4Z5TB 3AZKC 3C1BD 5AV8A 1BH8B 4XZQA 1M19D 1P3LD 5CPJD 1P34B 4WU9A 3LZ0C 3AZFC 3KUYB 2PYOC 4H9QB 5CPJB 5AVBA 5JRGA 3AZHB 2CV5A 1P34D 3MGPC 3AZGB 2F8NK 3AN2C 3W99B 1P34A 3MGQA 3X1VA 1P3IC 5KDMA 3LZ0A 3O62D 3KUYA 3AV1C 5BO0B 3WAAC 4YS3D 4WU9D 5B31A 2HIOB 1U35A 1M18C 3X1SD 5E5AA 4LD9D 3C1BA 1WWIA 4YS3B 1P3MA 2YFVB 1JFIA 3W96D 4XUJB 3X1SC 1AOIB 5KDMB 3LZ0B 5DNND 3AZHC 4UUZA 5G49A 5AV5B 3REJD 4KHAA 5B2IA 5AV6B 4J8XD 3C1CC 4YM6C 3VH5T 4H9NA 4G91B 3B6GB 3LELD 5B24D 4JJNB 3AZID 1P3IB 3X1TC 5B33B 3AZMD 3AZGA 1BH9A 1KX4B 1EQZB 4NFTA 5B0YA 5BNVB 5B1MC 3AFAD 1KX3A 4KUDB 1HQ3D 5B32B 3KXBD 5AV6D 3C1CB 4J8XB 3REKB 3MGPA 1U35B 5AY8D 1M1AD 3WTPC 3AV1A 3UT9B 5B1LD 4XZQC 4J8UB 3MVDB 5GSUB 1P3AB 3MNND 3AZJC 1EQZC 4NE3A 2NZDA 1ID3D 5JRGC 2F8NG 4J8XC 3UT9A 3REHB 5AVCD 4XUJC 3X1SB 3MVDA 1P3AA 1P3GD 1B6WA 5B24B 4JJND 3MGQC 2AROA 3AV2B 4YM6B 3TU4B 5DNNC 5F99D 3X1TA 5GSUC 1P3FD 5B2JD 5B33C 5B0YC 3VH5A 4KGCB 3AZJB 5B40A 4Z2MH 4J8VC 3AZEA 3X1UB 3RELA 5B1MB 3UTBB 1P3GB 5GSUA 2BYMA 3AZED 4WU9B 5FUGB 5CPIA 3AZNB 4KGCA 3W96B 1S32D 3W98B 3B6FD 5F99A 4J8VD 5CP6D 3AZLD 2AROD 4H9RB 1P3GC 5GXQC 5B40C 2BYKB 4Z66D 3MGRC 5BS7A 3A6NA 5CP6A 3MGSC 3NQJA 3MNNA 3AZFB 3MGRD 4HGAC 1BFMA 2IO5B 3B6FA 2RVQD 2AROC 3WKJD 3AN2B 3W97B 2F8NB 1A7WA 3AZKA 3AV1B 3LZ1A 1WWSA 5AV8B 5B32C 3REJB 4H9OB 1TAFB 1HQ3B 5B32D 5B2JA 3NQUA 2L5AA 4X23C 5B2IC 5GT0D 4HGAB 1P3ID 3WKJB 5BNVA 2LY8A 5AV6C 5B33D 3X1TD 3AYWA 3AZIA 5B24A 1TZYC 4ZUXB 5F99C 4JJNA 4DRBA 1S32B 1M18A 1F66A 3MVDD 1P3AD 4R8PC 3LJAD 1P3OC 3AZHD 4NE6A 5CPKB 1ID3A 5GT3A 2NQBC 3V9RB 4X23B 1BH8A 3W98D 5B31D 5B31G 4YS3A 5B0ZD 1TZYD 1P3MB 1JFIB 5CHLB 3AV1D 5B31C 3MGQD 3KSYA 1TZYB 1KX5A 3MGPD 3WAAB 5JRGD 5AVBD 4J8UC 2CV5D 3AZJA 2NQBB 5CP6C 3MGSA 1P3PA 3MNNC 5CPKC 5CPJA 1P3LA 4WU9C 3WTPD 5AV8D 3AZGD 4XUJA 3AZMA 1AOID 5B2IB 3LZ1B 4E44A 2PYOD 5G49B 5AV5A 5AVBC 5BNXB 4J8UD 4QLCA 3MGPB 4WU8D 5GT0B 2CV5C 4WNNB 5B2ID 1ZLAA 4E45A 3W96A 3LELC 5AY8B 2FJ7B 5BO0A 1P3MD 4WV4B 1KX4A 2F8NA 4KUDC 3B0DB 5E5AD 4LD9A 3X1SA 3X1UA 3RELB 5E5AC 4ZUXA 4H9NB 3AFAB 2BYMB 3AV2D 3O62A 3LZ1C 3KUYD 4H9SA 2IO5C 3X1VD 3VH6A 4UUZB 5AVBB 2CV5B 4R8PA 4R8PD 3AZLC 1P3OD 1P3OA 3LJAB 4Z5TD 4M6BA 4DRAA 3B6FC 3AV2A 4KUDD 2FJ7C 2HIOA 4J8WD 3X1TB 3AZKB 4Z66B 3AZEC 4XZQD 1M19A 3REKA 3WAAD 5GXQB 4ZBJC 5JA4A 1P34C 4CAYB 5CPJC 3MGQB 5AV9A 3WKJC 2FJ7A 1P3BC 3A6NB 2YFWA 5DNMA 4WU8A 1U35C 4J8UA 2FJ7D 4X23D 2PYOA 4CAYA 3B6GA 1P3LC 1H3OB 4XUJD 4XZQB 2HIOC 4ZBJB 3B0CT 3X1UC 3WA9A 2HIOD 4H9RA 4J8WA 3AZJD 4KUDA 5E5AB 5CPIB 1KX5D 3O62C 4H9SC 3VH5W 3AZMB 3W98C 3AZNA 3WA9C 3AV2C 4EO5C 3X1VB 1M1AC 3KWQC 3LJAC 1TZYA 5B0ZA 5GXQD 4LD9C 3X1UD 3B6FB 1F1EA 3AZFD 5GT3D 1P3FB 3W99D 1P3BD 1EQZD 3LJAA 3AN2D 5GT3B 1F66D 3W99C 1P3KA 1KX3B 3REIA 4QLCD 4H9OA 5B1LB 3AZIC 3TU4A 2AROB 3AZMC 3C1CA 5B33A 4EO5B 3X1VC 1M1AB 1P3IA 3UT9C 3REHA 2RVQC 3WTPA 3WTPE 3AYWB 3UTAA 3REIC 4Z5TC 1P3FC 4H9QA 3MGSD 1P3PD 3REJC 5C3IB 5JRGB 5CP6B 1N1JB 5B1MA 2BYKA 3UTBD 1KX3C 2JSSA 1TAFA 5AVCB 4CSRB 4JJNC 4KHAB 5B2JB 3KWQA 3W98A 3WA9B 4YM6D 3AYWC 1ID3C 5B0YB 5F99B 1S32C 3A6ND 4H9PB 2NQBD 1M18B 4KGCC 5FUGA 3AZHA 1F66C 4YS3C 1BH9B 5AY8C 1AOIC 1M18D 1ULYA 3AZNC 2F8NH 5GT3C 2NQBA 1HQ3C 4J8VA 2CWEA 3AYWD 5B2JC 5GT0A 5JA4B 3W97D 5DNMC 5CPKD 5B32A 1H3OA 1KX4C 3REHC 3REIB 1F66B 3RELD 3LZ1D 3KUYC 2PYOB 3MGRB 3AZKD 5B40D 4AWLC 3MGSB 5CPKA 3W97A 5DNNB 3WTPB 3WKJA 5AVCC 1KU5A
chains in the Genus database with same CATH superfamily
3MGRA 3C1CD 5BS7C 5GT0C 1KX5C 5BT1C 4QLCB 4Z66A 3R45A 1P3KD 3C1BB 4Z2MG 4CSRA 5AVCA 5B32G 1P3BA 3VH6T 4AWLB 4G92B 2NZDD 3AZLA 3AFAC 4YM6A 2YFWB 4WU8B 3KXBC 3B0CW 1S32A 5BT1D 3KWQD 3B0BA 3AZND 3FDDA 3O62B 4QLCC 1P3KC 4KGCD 1HTAA 5CPID 1KX5B 1M1AA 3C1BC 3P5JB 5AY8A 5B40B 5DNMB 5B1MD 3VH6W 5GSUD 3UTBA 4LD9B 5AV6A 4Z66C 3AZEB 3UTAB 3KXBA 4G92C 5C3IC 1HQ3A 4H9PA 1R4VA 1Q9CA 3UTAD 3REHD 1P3FA 1M19B 5AV5C 2Y2PA 3RELC 1P3BB 2Y2LA 3KXBB 3W97C 1P3KB 3V9RA 4X23A 5B31B 3TU4D 3MVDC 1P3AC 1ZLAC 5B0ZB 3REID 2HUEC 1P3GA 1P3LB 3AN2A 5AV9D 1EQZA 4WZSB 3UT9D 2NZDC 5DNNA 3W99A 3UTAC 1B67A 3NQUB 3NQJB 3MNNB 3AZFA 3REKD 3WAAA 1U35D 4J8WB 5BNXA 1M19C 3REKC 5GXQA 5B1LA 3TU4C 3A1IA 3AZGC 3LZ0D 5CPIC 4WU8C 1ZLAB 4Z5TA 2Y2KA 5AV9C 2HUEB 3A6NC 2F2AC 4R8PB 1P3OB 4J8VB 1ID3B 1P3PB 3LELB 2NZDB 4ZUXD 5AV8C 3WA9D 3AFAA 3UTBC 1KX3D 1T3UA 3B0DC 5B0YD 1N1JA 4J8WC 2F8ND 1KX4D 1P3MC 5B24C 2W8SA 3B6GD 3W96C 3LELA 1ZLAD 5B1LC 3AZIB 5AV9B 2ZY2A 3AZLB 4G91C 3B6GC 2Y2HA 4WNNA 4NE5A 5DNMD 4J8XA 5AV5D 2YFVA 4ZUXC 3REJA 5B0ZC 1P3PC 1AOIA 3KWQB 3R45B 4Z5TB 3AZKC 3C1BD 5AV8A 1BH8B 4XZQA 1M19D 1P3LD 5CPJD 2XD1A 1P34B 4WU9A 3LZ0C 3AZFC 3KUYB 3F6TA 4H9QB 2PYOC 5CPJB 5AVBA 5JRGA 3AZHB 2CV5A 1P34D 3MGPC 3AZGB 2F8NK 3AN2C 3W99B 1P34A 3MGQA 3X1VA 1P3IC 5KDMA 3LZ0A 3O62D 3KUYA 3AV1C 5BO0B 3WAAC 4YS3D 4WU9D 5B31A 2HIOB 1U35A 1M18C 3X1SD 2Y2JA 5E5AA 4LD9D 3C1BA 1WWIA 4YS3B 1P3MA 2YFVB 1JFIA 3W96D 4XUJB 3X1SC 1AOIB 5KDMB 3LZ0B 5DNND 3AZHC 4UUZA 5G49A 5AV5B 3REJD 4KHAA 5B2IA 5AV6B 4J8XD 3C1CC 4YM6C 3VH5T 4H9NA 4G91B 3B6GB 3LELD 2ZY5A 5B24D 4JJNB 3AZID 1P3IB 3X1TC 5B33B 3AZMD 3AZGA 1BH9A 3EPLA 3EPHA 1KX4B 1EQZB 4NFTA 5B0YA 5BNVB 5B1MC 3AFAD 1KX3A 4KUDB 1HQ3D 5B32B 3KXBD 2VQRA 5AV6D 3C1CB 4J8XB 3REKB 3MGPA 1U35B 5AY8D 1M1AD 3WTPC 2Y2OA 3AV1A 2BG1A 3UT9B 5B1LD 4XZQC 4J8UB 3MVDB 5GSUB 1P3AB 3MNND 3AZJC 1EQZC 4NE3A 2NZDA 1ID3D 5JRGC 2F8NG 4J8XC 3UT9A 3REHB 5AVCD 4XUJC 3X1SB 3MVDA 1P3AA 1P3GD 1B6WA 5B24B 4JJND 3MGQC 2AROA 3AV2B 4YM6B 3TU4B 5DNNC 5F99D 3X1TA 5GSUC 2FFFB 1P3FD 5B2JD 5B33C 5B0YC 3AL0C 3VH5A 4KGCB 3AZJB 5B40A 4Z2MH 4J8VC 3AZEA 3X1UB 3RELA 5B1MB 3UTBB 1P3GB 5GSUA 2BYMA 3AZED 4WU9B 2JCHA 5FUGB 5CPIA 3AZNB 3EG5B 4KGCA 2ZM5A 2JE5A 2Y2NA 3W96B 1S32D 3W98B 3B6FD 2Y2IA 5F99A 4J8VD 5CP6D 1PZRA 3AZLD 2AROD 4H9RB 1P3GC 5GXQC 5B40C 2BYKB 2Y2QA 4Z66D 3MGRC 5BS7A 3A6NA 5CP6A 3MGSC 3NQJA 3MNNA 3AZFB 3MGRD 4HGAC 1BFMA 2IO5B 3B6FA 2RVQD 2AROC 3WKJD 1Z2CB 3IP4C 3AN2B 3W97B 2G5HC 2Y2MA 2F8NB 1A7WA 3AZKA 3AV1B 3LZ1A 1WWSA 5AV8B 5B32C 3REJB 4H9OB 1TAFB 1HQ3B 5B32D 5B2JA 3NQUA 2L5AA 4X23C 5B2IC 4HGAB 5GT0D 1P3ID 3WKJB 5BNVA 2LY8A 5AV6C 5B33D 3X1TD 3AYWA 3AZIA 5B24A 4UPKA 1TZYC 3H0MC 4ZUXB 5F99C 4JJNA 4DRBA 1S32B 1M18A 1F66A 3MVDD 1P3AD 4R8PC 3LJAD 1P3OC 3AZHD 4NE6A 5CPKB 1ID3A 5GT3A 2NQBC 2G5IC 3V9RB 4X23B 1BH8A 3W98D 5B31D 5B31G 4YS3A 5B0ZD 1TZYD 1P3MB 1JFIB 5CHLB 2XD5A 3AV1D 5B31C 3MGQD 3KSYA 1TZYB 1KX5A 2ZY3A 3MGPD 3WAAB 5JRGD 5AVBD 4J8UC 2CV5D 3AZJA 2NQBB 5CP6C 3MGSA 1P3PA 3MNNC 5CPKC 5CPJA 1P3LA 4WU9C 3WTPD 5AV8D 3AZGD 4XUJA 3AZMA 1AOID 5B2IB 3LZ1B 4E44A 2PYOD 5G49B 5AV5A 5AVBC 5BNXB 4J8UD 4QLCA 3MGPB 4WU8D 5GT0B 2CV5C 3H0LC 4WNNB 5B2ID 1ZLAA 4E45A 3W96A 3LELC 5AY8B 2FJ7B 2RIQA 5BO0A 4WV4B 1P3MD 1KX4A 2F8NA 3B0DB 5E5AD 4KUDC 4LD9A 3X1SA 4WJ3C 3X1UA 3RELB 5E5AC 4ZUXA 4H9NB 3AFAB 2BYMB 3AV2D 3O62A 3LZ1C 3KUYD 4H9SA 2IO5C 3X1VD 3VH6A 4UUZB 5AVBB 2CV5B 4R8PA 4R8PD 3AZLC 1P3OD 1P3OA 3EPJA 3LJAB 4Z5TD 4M6BA 4DRAA 3B6FC 3AV2A 4KUDD 2FJ7C 2HIOA 4J8WD 3X1TB 3AZKB 4Z66B 3AZEC 4XZQD 1M19A 3REKA 3WAAD 5GXQB 4ZBJC 5JA4A 1P34C 4CAYB 5CPJC 3MGQB 5AV9A 3WKJC 2FJ7A 1P3BC 3A6NB 4DQYB 2YFWA 5DNMA 4WU8A 1U35C 4J8UA 2FJ7D 4X23D 2PYOA 3H0RC 4CAYA 3B6GA 1P3LC 1H3OB 4XUJD 4XZQB 1W2EA 2HIOC 4ZBJB 3B0CT 3X1UC 3WA9A 2HIOD 4H9RA 4J8WA 3AZJD 4KUDA 5E5AB 5CPIB 1KX5D 3O62C 4H9SC 3VH5W 3AZMB 2UWXA 3W98C 3AZNA 3WA9C 3AV2C 4EO5C 3X1VB 1M1AC 3KWQC 3LJAC 1TZYA 5B0ZA 5GXQD 4LD9C 3X1UD 3B6FB 1F1EA 3AZFD 5GT3D 1P3FB 3W99D 1P3BD 1EQZD 3LJAA 3AN2D 5GT3B 1F66D 3W99C 1P3KA 1KX3B 3REIA 4QLCD 2Y2GA 2DF4C 3A1KA 4H9OA 5B1LB 3AZIC 3TU4A 2AROB 3AZMC 3C1CA 5B33A 4EO5B 3X1VC 1M1AB 2ZY4A 3UT9C 1P3IA 3REHA 2RVQC 3WTPA 3WTPE 3AYWB 3UTAA 3REIC 4Z5TC 1P3FC 4H9QA 3MGSD 1P3PD 3REJC 5C3IB 5JRGB 5CP6B 1N1JB 5B1MA 2BYKA 3UTBD 1KX3C 2JSSA 1TAFA 2J8PA 5AVCB 4CSRB 4JJNC 4KHAB 5B2JB 3KWQA 3KFUG 3W98A 3WA9B 4YM6D 3AYWC 1ID3C 5B0YB 5F99B 1S32C 3A6ND 4H9PB 2NQBD 1M18B 3EPKA 4KGCC 5FUGA 3AZHA 1F66C 4YS3C 1BH9B 5AY8C 1AOIC 1M18D 1ULYA 3AZNC 2F8NH 5GT3C 2NQBA 1HQ3C 4J8VA 2CWEA 3AYWD 5B2JC 5GT0A 5JA4B 3W97D 5DNMC 5CPKD 5B32A 1H3OA 1KX4C 3REHC 3REIB 1F66B 3RELD 3LZ1D 3KUYC 2PYOB 3MGRB 3AZKD 5B40D 4AWLC 3MGSB 5CPKA 3W97A 5DNNB 3WTPB 3WKJA 5AVCC 2DQNC 1KU5A
chains in the Genus database with same CATH topology
3MGRA 3C1CD 5BS7C 5GT0C 1KX5C 5BT1C 4QLCB 4Z66A 3R45A 1P3KD 3C1BB 4Z2MG 4CSRA 5AVCA 5B32G 1P3BA 3VH6T 4AWLB 4G92B 2NZDD 3AZLA 3AFAC 4YM6A 2YFWB 4WU8B 3KXBC 3B0CW 1S32A 5BT1D 3KWQD 3B0BA 3AZND 3FDDA 3O62B 4QLCC 1P3KC 4KGCD 1HTAA 5CPID 1KX5B 1M1AA 3C1BC 3P5JB 5AY8A 5B40B 5DNMB 5B1MD 3VH6W 5GSUD 3UTBA 4LD9B 5AV6A 4Z66C 3AZEB 3UTAB 3KXBA 4G92C 5C3IC 1HQ3A 4H9PA 1R4VA 1Q9CA 3UTAD 3REHD 1P3FA 1M19B 5AV5C 2Y2PA 3RELC 1P3BB 2Y2LA 3KXBB 3W97C 1P3KB 3V9RA 4X23A 5B31B 3TU4D 3MVDC 1P3AC 1ZLAC 5B0ZB 3REID 2HUEC 1P3GA 1P3LB 3AN2A 5AV9D 1EQZA 4WZSB 3UT9D 2NZDC 5DNNA 3W99A 3UTAC 1B67A 3NQUB 3NQJB 3MNNB 3AZFA 3REKD 3WAAA 1U35D 4J8WB 5BNXA 1M19C 3REKC 5GXQA 5B1LA 3TU4C 3A1IA 3AZGC 3LZ0D 5CPIC 4WU8C 1ZLAB 4Z5TA 2Y2KA 5AV9C 2HUEB 3A6NC 2F2AC 4R8PB 1P3OB 4J8VB 1ID3B 1P3PB 3LELB 2NZDB 4ZUXD 5AV8C 3WA9D 3AFAA 3UTBC 1KX3D 1T3UA 3B0DC 5B0YD 1N1JA 4J8WC 2F8ND 1KX4D 1P3MC 5B24C 2W8SA 3B6GD 3W96C 3LELA 1ZLAD 5B1LC 3AZIB 5AV9B 2ZY2A 3AZLB 4G91C 3B6GC 2Y2HA 4WNNA 4NE5A 5DNMD 4J8XA 5AV5D 2YFVA 4ZUXC 3REJA 5B0ZC 1P3PC 1AOIA 3KWQB 3R45B 4Z5TB 3AZKC 3C1BD 5AV8A 1BH8B 4XZQA 1M19D 1P3LD 5CPJD 2XD1A 1P34B 4WU9A 3LZ0C 3AZFC 3KUYB 3F6TA 4H9QB 2PYOC 5CPJB 5AVBA 5JRGA 3AZHB 2CV5A 1P34D 3MGPC 3AZGB 2F8NK 3AN2C 3W99B 1P34A 3MGQA 3X1VA 1P3IC 5KDMA 3LZ0A 3O62D 3KUYA 3AV1C 5BO0B 3WAAC 4YS3D 4WU9D 5B31A 2HIOB 1U35A 1M18C 3X1SD 2Y2JA 5E5AA 4LD9D 3C1BA 1WWIA 4YS3B 1P3MA 2YFVB 1JFIA 3W96D 4XUJB 3X1SC 1AOIB 5KDMB 3LZ0B 5DNND 3AZHC 4UUZA 5G49A 5AV5B 3REJD 4KHAA 5B2IA 5AV6B 4J8XD 3C1CC 4YM6C 3VH5T 4H9NA 4G91B 3B6GB 3LELD 2ZY5A 5B24D 4JJNB 3AZID 1P3IB 3X1TC 5B33B 3AZMD 3AZGA 1BH9A 3EPLA 3EPHA 1KX4B 1EQZB 4NFTA 5B0YA 5BNVB 5B1MC 3AFAD 1KX3A 4KUDB 1HQ3D 5B32B 3KXBD 2VQRA 5AV6D 3C1CB 4J8XB 3REKB 3MGPA 1U35B 5AY8D 1M1AD 3WTPC 2Y2OA 3AV1A 2BG1A 3UT9B 5B1LD 4XZQC 4J8UB 3MVDB 5GSUB 1P3AB 3MNND 3AZJC 1EQZC 4NE3A 2NZDA 1ID3D 5JRGC 2F8NG 4J8XC 3UT9A 3REHB 5AVCD 4XUJC 3X1SB 3MVDA 1P3AA 1P3GD 1B6WA 5B24B 4JJND 3MGQC 2AROA 3AV2B 4YM6B 3TU4B 5DNNC 5F99D 3X1TA 5GSUC 2FFFB 1P3FD 5B2JD 5B33C 5B0YC 3AL0C 3VH5A 4KGCB 3AZJB 5B40A 4Z2MH 4J8VC 3AZEA 3X1UB 3RELA 5B1MB 3UTBB 1P3GB 5GSUA 2BYMA 3AZED 4WU9B 2JCHA 5FUGB 5CPIA 3AZNB 3EG5B 4KGCA 2ZM5A 2JE5A 2Y2NA 3W96B 1S32D 3W98B 3B6FD 2Y2IA 5F99A 4J8VD 5CP6D 1PZRA 3AZLD 2AROD 4H9RB 1P3GC 5GXQC 5B40C 2BYKB 2Y2QA 4Z66D 3MGRC 5BS7A 3A6NA 5CP6A 3MGSC 3NQJA 3MNNA 3AZFB 3MGRD 4HGAC 1BFMA 2IO5B 3B6FA 2RVQD 2AROC 3WKJD 1Z2CB 3IP4C 3AN2B 3W97B 2G5HC 2Y2MA 2F8NB 1A7WA 3AZKA 3AV1B 3LZ1A 1WWSA 5AV8B 5B32C 3REJB 4H9OB 1TAFB 1HQ3B 5B32D 5B2JA 3NQUA 2L5AA 4X23C 5B2IC 4HGAB 5GT0D 1P3ID 3WKJB 5BNVA 2LY8A 5AV6C 5B33D 3X1TD 3AYWA 3AZIA 5B24A 4UPKA 1TZYC 3H0MC 4ZUXB 5F99C 4JJNA 4DRBA 1S32B 1M18A 1F66A 3MVDD 1P3AD 4R8PC 3LJAD 1P3OC 3AZHD 4NE6A 5CPKB 1ID3A 5GT3A 2NQBC 2G5IC 3V9RB 4X23B 1BH8A 3W98D 5B31D 5B31G 4YS3A 5B0ZD 1TZYD 1P3MB 1JFIB 5CHLB 2XD5A 3AV1D 5B31C 3MGQD 3KSYA 1TZYB 1KX5A 2ZY3A 3MGPD 3WAAB 5JRGD 5AVBD 4J8UC 2CV5D 3AZJA 2NQBB 5CP6C 3MGSA 1P3PA 3MNNC 5CPKC 5CPJA 1P3LA 4WU9C 3WTPD 5AV8D 3AZGD 4XUJA 3AZMA 1AOID 5B2IB 3LZ1B 4E44A 2PYOD 5G49B 5AV5A 5AVBC 5BNXB 4J8UD 4QLCA 3MGPB 4WU8D 5GT0B 2CV5C 3H0LC 4WNNB 5B2ID 1ZLAA 4E45A 3W96A 3LELC 5AY8B 2FJ7B 2RIQA 5BO0A 4WV4B 1P3MD 1KX4A 2F8NA 3B0DB 5E5AD 4KUDC 4LD9A 3X1SA 4WJ3C 3X1UA 3RELB 5E5AC 4ZUXA 4H9NB 3AFAB 2BYMB 3AV2D 3O62A 3LZ1C 3KUYD 4H9SA 2IO5C 3X1VD 3VH6A 4UUZB 5AVBB 2CV5B 4R8PA 4R8PD 3AZLC 1P3OD 1P3OA 3EPJA 3LJAB 4Z5TD 4M6BA 4DRAA 3B6FC 3AV2A 4KUDD 2FJ7C 2HIOA 4J8WD 3X1TB 3AZKB 4Z66B 3AZEC 4XZQD 1M19A 3REKA 3WAAD 5GXQB 4ZBJC 5JA4A 1P34C 4CAYB 5CPJC 3MGQB 5AV9A 3WKJC 2FJ7A 1P3BC 3A6NB 4DQYB 2YFWA 5DNMA 4WU8A 1U35C 4J8UA 2FJ7D 4X23D 2PYOA 3H0RC 4CAYA 3B6GA 1P3LC 1H3OB 4XUJD 4XZQB 1W2EA 2HIOC 4ZBJB 3B0CT 3X1UC 3WA9A 2HIOD 4H9RA 4J8WA 3AZJD 4KUDA 5E5AB 5CPIB 1KX5D 3O62C 4H9SC 3VH5W 3AZMB 2UWXA 3W98C 3AZNA 3WA9C 3AV2C 4EO5C 3X1VB 1M1AC 3KWQC 3LJAC 1TZYA 5B0ZA 5GXQD 4LD9C 3X1UD 3B6FB 1F1EA 3AZFD 5GT3D 1P3FB 3W99D 1P3BD 1EQZD 3LJAA 3AN2D 5GT3B 1F66D 3W99C 1P3KA 1KX3B 3REIA 4QLCD 2Y2GA 2DF4C 3A1KA 4H9OA 5B1LB 3AZIC 3TU4A 2AROB 3AZMC 3C1CA 5B33A 4EO5B 3X1VC 1M1AB 2ZY4A 3UT9C 1P3IA 3REHA 2RVQC 3WTPA 3WTPE 3AYWB 3UTAA 3REIC 4Z5TC 1P3FC 4H9QA 3MGSD 1P3PD 3REJC 5C3IB 5JRGB 5CP6B 1N1JB 5B1MA 2BYKA 3UTBD 1KX3C 2JSSA 1TAFA 2J8PA 5AVCB 4CSRB 4JJNC 4KHAB 5B2JB 3KWQA 3KFUG 3W98A 3WA9B 4YM6D 3AYWC 1ID3C 5B0YB 5F99B 1S32C 3A6ND 4H9PB 2NQBD 1M18B 3EPKA 4KGCC 5FUGA 3AZHA 1F66C 4YS3C 1BH9B 5AY8C 1AOIC 1M18D 1ULYA 3AZNC 2F8NH 5GT3C 2NQBA 1HQ3C 4J8VA 2CWEA 3AYWD 5B2JC 5GT0A 5JA4B 3W97D 5DNMC 5CPKD 5B32A 1H3OA 1KX4C 3REHC 3REIB 1F66B 3RELD 3LZ1D 3KUYC 2PYOB 3MGRB 3AZKD 5B40D 4AWLC 3MGSB 5CPKA 3W97A 5DNNB 3WTPB 3WKJA 5AVCC 2DQNC 1KU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR A;  3C1C D;  5BS7 C;  5GT0 C;  1KX5 C;  5BT1 C;  4QLC B;  4Z66 A;  3R45 A;  1P3K D;  3C1B B;  4Z2M G;  4CSR A;  5AVC A;  5B32 G;  1P3B A;  3VH6 T;  4AWL B;  4G92 B;  2NZD D;  3AZL A;  3AFA C;  4YM6 A;  2YFW B;  4WU8 B;  3KXB C;  3B0C W;  1S32 A;  5BT1 D;  3KWQ D;  3B0B A;  3AZN D;  3O62 B;  1P3K C;  4QLC C;  4KGC D;  1HTA A;  5CPI D;  1KX5 B;  1M1A A;  3C1B C;  5AY8 A;  5B40 B;  5DNM B;  5B1M D;  3VH6 W;  5GSU D;  3UTB A;  4LD9 B;  5AV6 A;  4Z66 C;  3AZE B;  3UTA B;  3KXB A;  4G92 C;  5C3I C;  1HQ3 A;  4H9P A;  1R4V A;  1Q9C A;  3UTA D;  3REH D;  1P3F A;  1M19 B;  5AV5 C;  3REL C;  1P3B B;  3KXB B;  3W97 C;  1P3K B;  3V9R A;  4X23 A;  5B31 B;  3TU4 D;  3MVD C;  1P3A C;  1ZLA C;  5B0Z B;  3REI D;  2HUE C;  1P3G A;  1P3L B;  3AN2 A;  5AV9 D;  1EQZ A;  4WZS B;  3UT9 D;  2NZD C;  5DNN A;  3W99 A;  3UTA C;  1B67 A;  3NQU B;  3NQJ B;  3MNN B;  3AZF A;  3REK D;  3WAA A;  1U35 D;  4J8W B;  5BNX A;  1M19 C;  3REK C;  5GXQ A;  5B1L A;  3TU4 C;  3AZG C;  3LZ0 D;  5CPI C;  4WU8 C;  1ZLA B;  4Z5T A;  5AV9 C;  2HUE B;  3A6N C;  4R8P B;  1P3O B;  4J8V B;  1ID3 B;  1P3P B;  3LEL B;  2NZD B;  4ZUX D;  5AV8 C;  3WA9 D;  3AFA A;  3UTB C;  1KX3 D;  3B0D C;  5B0Y D;  1N1J A;  4J8W C;  2F8N D;  1KX4 D;  1P3M C;  5B24 C;  3B6G D;  3W96 C;  3LEL A;  1ZLA D;  5B1L C;  3AZI B;  5AV9 B;  3AZL B;  4G91 C;  3B6G C;  4WNN A;  4NE5 A;  5DNM D;  4J8X A;  5AV5 D;  2YFV A;  4ZUX C;  3REJ A;  5B0Z C;  1P3P C;  1AOI A;  3KWQ B;  3R45 B;  4Z5T B;  3AZK C;  3C1B D;  5AV8 A;  1BH8 B;  4XZQ A;  1M19 D;  1P3L D;  5CPJ D;  1P34 B;  4WU9 A;  3LZ0 C;  3AZF C;  3KUY B;  2PYO C;  4H9Q B;  5CPJ B;  5AVB A;  5JRG A;  3AZH B;  2CV5 A;  1P34 D;  3MGP C;  3AZG B;  2F8N K;  3AN2 C;  3W99 B;  1P34 A;  3MGQ A;  3X1V A;  1P3I C;  5KDM A;  3LZ0 A;  3O62 D;  3KUY A;  3AV1 C;  5BO0 B;  3WAA C;  4YS3 D;  4WU9 D;  5B31 A;  2HIO B;  1U35 A;  1M18 C;  3X1S D;  5E5A A;  4LD9 D;  3C1B A;  1WWI A;  4YS3 B;  1P3M A;  2YFV B;  1JFI A;  3W96 D;  4XUJ B;  3X1S C;  1AOI B;  5KDM B;  3LZ0 B;  5DNN D;  3AZH C;  4UUZ A;  5G49 A;  5AV5 B;  3REJ D;  4KHA A;  5B2I A;  5AV6 B;  4J8X D;  3C1C C;  4YM6 C;  3VH5 T;  4H9N A;  4G91 B;  3B6G B;  3LEL D;  5B24 D;  4JJN B;  3AZI D;  1P3I B;  3X1T C;  5B33 B;  3AZM D;  3AZG A;  1BH9 A;  1KX4 B;  1EQZ B;  4NFT A;  5B0Y A;  5BNV B;  5B1M C;  3AFA D;  1KX3 A;  4KUD B;  1HQ3 D;  5B32 B;  3KXB D;  5AV6 D;  3C1C B;  4J8X B;  3REK B;  3MGP A;  1U35 B;  5AY8 D;  1M1A D;  3WTP C;  3AV1 A;  3UT9 B;  5B1L D;  4XZQ C;  4J8U B;  3MVD B;  5GSU B;  1P3A B;  3MNN D;  3AZJ C;  1EQZ C;  4NE3 A;  2NZD A;  1ID3 D;  5JRG C;  2F8N G;  4J8X C;  3UT9 A;  3REH B;  5AVC D;  4XUJ C;  3X1S B;  3MVD A;  1P3A A;  1P3G D;  1B6W A;  5B24 B;  4JJN D;  3MGQ C;  2ARO A;  3AV2 B;  4YM6 B;  3TU4 B;  5DNN C;  5F99 D;  3X1T A;  5GSU C;  1P3F D;  5B2J D;  5B33 C;  5B0Y C;  3VH5 A;  4KGC B;  3AZJ B;  5B40 A;  4Z2M H;  4J8V C;  3AZE A;  3X1U B;  3REL A;  5B1M B;  3UTB B;  1P3G B;  5GSU A;  2BYM A;  3AZE D;  4WU9 B;  5FUG B;  5CPI A;  3AZN B;  4KGC A;  3W96 B;  1S32 D;  3W98 B;  3B6F D;  5F99 A;  4J8V D;  5CP6 D;  3AZL D;  2ARO D;  4H9R B;  1P3G C;  5GXQ C;  5B40 C;  2BYK B;  4Z66 D;  3MGR C;  5BS7 A;  3A6N A;  5CP6 A;  3MGS C;  3NQJ A;  3MNN A;  3AZF B;  3MGR D;  4HGA C;  1BFM A;  2IO5 B;  3B6F A;  2RVQ D;  2ARO C;  3WKJ D;  3AN2 B;  3W97 B;  2F8N B;  1A7W A;  3AZK A;  3AV1 B;  3LZ1 A;  1WWS A;  5AV8 B;  5B32 C;  3REJ B;  4H9O B;  1TAF B;  1HQ3 B;  5B32 D;  5B2J A;  3NQU A;  2L5A A;  4X23 C;  5B2I C;  5GT0 D;  4HGA B;  1P3I D;  3WKJ B;  5BNV A;  2LY8 A;  5AV6 C;  5B33 D;  3X1T D;  3AYW A;  3AZI A;  5B24 A;  1TZY C;  4ZUX B;  5F99 C;  4JJN A;  4DRB A;  1S32 B;  1M18 A;  1F66 A;  3MVD D;  1P3A D;  4R8P C;  3LJA D;  1P3O C;  3AZH D;  4NE6 A;  5CPK B;  1ID3 A;  5GT3 A;  2NQB C;  3V9R B;  4X23 B;  1BH8 A;  3W98 D;  5B31 D;  5B31 G;  4YS3 A;  5B0Z D;  1TZY D;  1P3M B;  1JFI B;  5CHL B;  3AV1 D;  5B31 C;  3MGQ D;  3KSY A;  1TZY B;  1KX5 A;  3MGP D;  3WAA B;  5JRG D;  5AVB D;  4J8U C;  2CV5 D;  3AZJ A;  2NQB B;  5CP6 C;  3MGS A;  1P3P A;  3MNN C;  5CPK C;  5CPJ A;  1P3L A;  4WU9 C;  3WTP D;  5AV8 D;  3AZG D;  4XUJ A;  3AZM A;  1AOI D;  5B2I B;  3LZ1 B;  4E44 A;  2PYO D;  5G49 B;  5AV5 A;  5AVB C;  5BNX B;  4J8U D;  4QLC A;  3MGP B;  4WU8 D;  5GT0 B;  2CV5 C;  4WNN B;  5B2I D;  1ZLA A;  4E45 A;  3W96 A;  3LEL C;  5AY8 B;  2FJ7 B;  5BO0 A;  1P3M D;  4WV4 B;  1KX4 A;  2F8N A;  4KUD C;  3B0D B;  5E5A D;  4LD9 A;  3X1S A;  3X1U A;  3REL B;  5E5A C;  4ZUX A;  4H9N B;  3AFA B;  2BYM B;  3AV2 D;  3O62 A;  3LZ1 C;  3KUY D;  4H9S A;  2IO5 C;  3X1V D;  3VH6 A;  4UUZ B;  5AVB B;  2CV5 B;  4R8P A;  4R8P D;  3AZL C;  1P3O D;  1P3O A;  3LJA B;  4Z5T D;  4M6B A;  4DRA A;  3B6F C;  3AV2 A;  4KUD D;  2FJ7 C;  2HIO A;  4J8W D;  3X1T B;  3AZK B;  4Z66 B;  3AZE C;  4XZQ D;  1M19 A;  3REK A;  3WAA D;  5GXQ B;  4ZBJ C;  5JA4 A;  1P34 C;  4CAY B;  5CPJ C;  3MGQ B;  5AV9 A;  3WKJ C;  2FJ7 A;  1P3B C;  3A6N B;  2YFW A;  5DNM A;  4WU8 A;  1U35 C;  4J8U A;  2FJ7 D;  4X23 D;  2PYO A;  4CAY A;  3B6G A;  1P3L C;  1H3O B;  4XUJ D;  4XZQ B;  2HIO C;  4ZBJ B;  3B0C T;  3X1U C;  3WA9 A;  2HIO D;  4H9R A;  4J8W A;  3AZJ D;  4KUD A;  5E5A B;  5CPI B;  1KX5 D;  3O62 C;  4H9S C;  3VH5 W;  3AZM B;  3W98 C;  3AZN A;  3WA9 C;  3AV2 C;  4EO5 C;  3X1V B;  1M1A C;  3KWQ C;  3LJA C;  1TZY A;  5B0Z A;  5GXQ D;  4LD9 C;  3X1U D;  3B6F B;  1F1E A;  3AZF D;  5GT3 D;  1P3F B;  3W99 D;  1P3B D;  1EQZ D;  3LJA A;  3AN2 D;  5GT3 B;  1F66 D;  3W99 C;  1P3K A;  1KX3 B;  3REI A;  4QLC D;  4H9O A;  5B1L B;  3AZI C;  3TU4 A;  2ARO B;  3AZM C;  3C1C A;  5B33 A;  4EO5 B;  3X1V C;  1M1A B;  1P3I A;  3UT9 C;  3REH A;  2RVQ C;  3WTP A;  3WTP E;  3AYW B;  3UTA A;  3REI C;  4Z5T C;  1P3F C;  4H9Q A;  3MGS D;  1P3P D;  3REJ C;  5C3I B;  5JRG B;  5CP6 B;  1N1J B;  5B1M A;  2BYK A;  3UTB D;  1KX3 C;  2JSS A;  1TAF A;  5AVC B;  4CSR B;  4JJN C;  4KHA B;  5B2J B;  3KWQ A;  3W98 A;  3WA9 B;  4YM6 D;  3AYW C;  1ID3 C;  5B0Y B;  5F99 B;  1S32 C;  3A6N D;  4H9P B;  2NQB D;  1M18 B;  4KGC C;  5FUG A;  3AZH A;  1F66 C;  4YS3 C;  1BH9 B;  5AY8 C;  1AOI C;  1M18 D;  1ULY A;  3AZN C;  2F8N H;  5GT3 C;  2NQB A;  1HQ3 C;  4J8V A;  2CWE A;  3AYW D;  5B2J C;  5GT0 A;  5JA4 B;  3W97 D;  5DNM C;  5CPK D;  5B32 A;  1H3O A;  1KX4 C;  3REH C;  3REI B;  1F66 B;  3REL D;  3LZ1 D;  3KUY C;  2PYO B;  3MGR B;  3AZK D;  5B40 D;  4AWL C;  3MGS B;  5CPK A;  3W97 A;  5DNN B;  3WTP B;  3WKJ A;  5AVC C;  1KU5 A; 
#chains in the Genus database with same CATH topology
 3MGR A;  3C1C D;  5BS7 C;  5GT0 C;  1KX5 C;  5BT1 C;  4QLC B;  4Z66 A;  3R45 A;  1P3K D;  3C1B B;  4Z2M G;  4CSR A;  5AVC A;  5B32 G;  1P3B A;  3VH6 T;  4AWL B;  4G92 B;  2NZD D;  3AZL A;  3AFA C;  4YM6 A;  2YFW B;  4WU8 B;  3KXB C;  3B0C W;  1S32 A;  5BT1 D;  3KWQ D;  3B0B A;  3AZN D;  3FDD A;  3O62 B;  4QLC C;  1P3K C;  4KGC D;  1HTA A;  5CPI D;  1KX5 B;  1M1A A;  3C1B C;  3P5J B;  5AY8 A;  5B40 B;  5DNM B;  5B1M D;  3VH6 W;  5GSU D;  3UTB A;  4LD9 B;  5AV6 A;  4Z66 C;  3AZE B;  3UTA B;  3KXB A;  4G92 C;  5C3I C;  1HQ3 A;  4H9P A;  1R4V A;  1Q9C A;  3UTA D;  3REH D;  1P3F A;  1M19 B;  5AV5 C;  2Y2P A;  3REL C;  1P3B B;  2Y2L A;  3KXB B;  3W97 C;  1P3K B;  3V9R A;  4X23 A;  5B31 B;  3TU4 D;  3MVD C;  1P3A C;  1ZLA C;  5B0Z B;  3REI D;  2HUE C;  1P3G A;  1P3L B;  3AN2 A;  5AV9 D;  1EQZ A;  4WZS B;  3UT9 D;  2NZD C;  5DNN A;  3W99 A;  3UTA C;  1B67 A;  3NQU B;  3NQJ B;  3MNN B;  3AZF A;  3REK D;  3WAA A;  1U35 D;  4J8W B;  5BNX A;  1M19 C;  3REK C;  5GXQ A;  5B1L A;  3TU4 C;  3A1I A;  3AZG C;  3LZ0 D;  5CPI C;  4WU8 C;  1ZLA B;  4Z5T A;  2Y2K A;  5AV9 C;  2HUE B;  3A6N C;  2F2A C;  4R8P B;  1P3O B;  4J8V B;  1ID3 B;  1P3P B;  3LEL B;  2NZD B;  4ZUX D;  5AV8 C;  3WA9 D;  3AFA A;  3UTB C;  1KX3 D;  1T3U A;  3B0D C;  5B0Y D;  1N1J A;  4J8W C;  2F8N D;  1KX4 D;  1P3M C;  5B24 C;  2W8S A;  3B6G D;  3W96 C;  3LEL A;  1ZLA D;  5B1L C;  3AZI B;  5AV9 B;  2ZY2 A;  3AZL B;  4G91 C;  3B6G C;  2Y2H A;  4WNN A;  4NE5 A;  5DNM D;  4J8X A;  5AV5 D;  2YFV A;  4ZUX C;  3REJ A;  5B0Z C;  1P3P C;  1AOI A;  3KWQ B;  3R45 B;  4Z5T B;  3AZK C;  3C1B D;  5AV8 A;  1BH8 B;  4XZQ A;  1M19 D;  1P3L D;  5CPJ D;  2XD1 A;  1P34 B;  4WU9 A;  3LZ0 C;  3AZF C;  3KUY B;  3F6T A;  4H9Q B;  2PYO C;  5CPJ B;  5AVB A;  5JRG A;  3AZH B;  2CV5 A;  1P34 D;  3MGP C;  3AZG B;  2F8N K;  3AN2 C;  3W99 B;  1P34 A;  3MGQ A;  3X1V A;  1P3I C;  5KDM A;  3LZ0 A;  3O62 D;  3KUY A;  3AV1 C;  5BO0 B;  3WAA C;  4YS3 D;  4WU9 D;  5B31 A;  2HIO B;  1U35 A;  1M18 C;  3X1S D;  2Y2J A;  5E5A A;  4LD9 D;  3C1B A;  1WWI A;  4YS3 B;  1P3M A;  2YFV B;  1JFI A;  3W96 D;  4XUJ B;  3X1S C;  1AOI B;  5KDM B;  3LZ0 B;  5DNN D;  3AZH C;  4UUZ A;  5G49 A;  5AV5 B;  3REJ D;  4KHA A;  5B2I A;  5AV6 B;  4J8X D;  3C1C C;  4YM6 C;  3VH5 T;  4H9N A;  4G91 B;  3B6G B;  3LEL D;  2ZY5 A;  5B24 D;  4JJN B;  3AZI D;  1P3I B;  3X1T C;  5B33 B;  3AZM D;  3AZG A;  1BH9 A;  3EPL A;  3EPH A;  1KX4 B;  1EQZ B;  4NFT A;  5B0Y A;  5BNV B;  5B1M C;  3AFA D;  1KX3 A;  4KUD B;  1HQ3 D;  5B32 B;  3KXB D;  2VQR A;  5AV6 D;  3C1C B;  4J8X B;  3REK B;  3MGP A;  1U35 B;  5AY8 D;  1M1A D;  3WTP C;  2Y2O A;  3AV1 A;  2BG1 A;  3UT9 B;  5B1L D;  4XZQ C;  4J8U B;  3MVD B;  5GSU B;  1P3A B;  3MNN D;  3AZJ C;  1EQZ C;  4NE3 A;  2NZD A;  1ID3 D;  5JRG C;  2F8N G;  4J8X C;  3UT9 A;  3REH B;  5AVC D;  4XUJ C;  3X1S B;  3MVD A;  1P3A A;  1P3G D;  1B6W A;  5B24 B;  4JJN D;  3MGQ C;  2ARO A;  3AV2 B;  4YM6 B;  3TU4 B;  5DNN C;  5F99 D;  3X1T A;  5GSU C;  2FFF B;  1P3F D;  5B2J D;  5B33 C;  5B0Y C;  3AL0 C;  3VH5 A;  4KGC B;  3AZJ B;  5B40 A;  4Z2M H;  4J8V C;  3AZE A;  3X1U B;  3REL A;  5B1M B;  3UTB B;  1P3G B;  5GSU A;  2BYM A;  3AZE D;  4WU9 B;  2JCH A;  5FUG B;  5CPI A;  3AZN B;  3EG5 B;  4KGC A;  2ZM5 A;  2JE5 A;  2Y2N A;  3W96 B;  1S32 D;  3W98 B;  3B6F D;  2Y2I A;  5F99 A;  4J8V D;  5CP6 D;  1PZR A;  3AZL D;  2ARO D;  4H9R B;  1P3G C;  5GXQ C;  5B40 C;  2BYK B;  2Y2Q A;  4Z66 D;  3MGR C;  5BS7 A;  3A6N A;  5CP6 A;  3MGS C;  3NQJ A;  3MNN A;  3AZF B;  3MGR D;  4HGA C;  1BFM A;  2IO5 B;  3B6F A;  2RVQ D;  2ARO C;  3WKJ D;  1Z2C B;  3IP4 C;  3AN2 B;  3W97 B;  2G5H C;  2Y2M A;  2F8N B;  1A7W A;  3AZK A;  3AV1 B;  3LZ1 A;  1WWS A;  5AV8 B;  5B32 C;  3REJ B;  4H9O B;  1TAF B;  1HQ3 B;  5B32 D;  5B2J A;  3NQU A;  2L5A A;  4X23 C;  5B2I C;  4HGA B;  5GT0 D;  1P3I D;  3WKJ B;  5BNV A;  2LY8 A;  5AV6 C;  5B33 D;  3X1T D;  3AYW A;  3AZI A;  5B24 A;  4UPK A;  1TZY C;  3H0M C;  4ZUX B;  5F99 C;  4JJN A;  4DRB A;  1S32 B;  1M18 A;  1F66 A;  3MVD D;  1P3A D;  4R8P C;  3LJA D;  1P3O C;  3AZH D;  4NE6 A;  5CPK B;  1ID3 A;  5GT3 A;  2NQB C;  2G5I C;  3V9R B;  4X23 B;  1BH8 A;  3W98 D;  5B31 D;  5B31 G;  4YS3 A;  5B0Z D;  1TZY D;  1P3M B;  1JFI B;  5CHL B;  2XD5 A;  3AV1 D;  5B31 C;  3MGQ D;  3KSY A;  1TZY B;  1KX5 A;  2ZY3 A;  3MGP D;  3WAA B;  5JRG D;  5AVB D;  4J8U C;  2CV5 D;  3AZJ A;  2NQB B;  5CP6 C;  3MGS A;  1P3P A;  3MNN C;  5CPK C;  5CPJ A;  1P3L A;  4WU9 C;  3WTP D;  5AV8 D;  3AZG D;  4XUJ A;  3AZM A;  1AOI D;  5B2I B;  3LZ1 B;  4E44 A;  2PYO D;  5G49 B;  5AV5 A;  5AVB C;  5BNX B;  4J8U D;  4QLC A;  3MGP B;  4WU8 D;  5GT0 B;  2CV5 C;  3H0L C;  4WNN B;  5B2I D;  1ZLA A;  4E45 A;  3W96 A;  3LEL C;  5AY8 B;  2FJ7 B;  2RIQ A;  5BO0 A;  4WV4 B;  1P3M D;  1KX4 A;  2F8N A;  3B0D B;  5E5A D;  4KUD C;  4LD9 A;  3X1S A;  4WJ3 C;  3X1U A;  3REL B;  5E5A C;  4ZUX A;  4H9N B;  3AFA B;  2BYM B;  3AV2 D;  3O62 A;  3LZ1 C;  3KUY D;  4H9S A;  2IO5 C;  3X1V D;  3VH6 A;  4UUZ B;  5AVB B;  2CV5 B;  4R8P A;  4R8P D;  3AZL C;  1P3O D;  1P3O A;  3EPJ A;  3LJA B;  4Z5T D;  4M6B A;  4DRA A;  3B6F C;  3AV2 A;  4KUD D;  2FJ7 C;  2HIO A;  4J8W D;  3X1T B;  3AZK B;  4Z66 B;  3AZE C;  4XZQ D;  1M19 A;  3REK A;  3WAA D;  5GXQ B;  4ZBJ C;  5JA4 A;  1P34 C;  4CAY B;  5CPJ C;  3MGQ B;  5AV9 A;  3WKJ C;  2FJ7 A;  1P3B C;  3A6N B;  4DQY B;  2YFW A;  5DNM A;  4WU8 A;  1U35 C;  4J8U A;  2FJ7 D;  4X23 D;  2PYO A;  3H0R C;  4CAY A;  3B6G A;  1P3L C;  1H3O B;  4XUJ D;  4XZQ B;  1W2E A;  2HIO C;  4ZBJ B;  3B0C T;  3X1U C;  3WA9 A;  2HIO D;  4H9R A;  4J8W A;  3AZJ D;  4KUD A;  5E5A B;  5CPI B;  1KX5 D;  3O62 C;  4H9S C;  3VH5 W;  3AZM B;  2UWX A;  3W98 C;  3AZN A;  3WA9 C;  3AV2 C;  4EO5 C;  3X1V B;  1M1A C;  3KWQ C;  3LJA C;  1TZY A;  5B0Z A;  5GXQ D;  4LD9 C;  3X1U D;  3B6F B;  1F1E A;  3AZF D;  5GT3 D;  1P3F B;  3W99 D;  1P3B D;  1EQZ D;  3LJA A;  3AN2 D;  5GT3 B;  1F66 D;  3W99 C;  1P3K A;  1KX3 B;  3REI A;  4QLC D;  2Y2G A;  2DF4 C;  3A1K A;  4H9O A;  5B1L B;  3AZI C;  3TU4 A;  2ARO B;  3AZM C;  3C1C A;  5B33 A;  4EO5 B;  3X1V C;  1M1A B;  2ZY4 A;  3UT9 C;  1P3I A;  3REH A;  2RVQ C;  3WTP A;  3WTP E;  3AYW B;  3UTA A;  3REI C;  4Z5T C;  1P3F C;  4H9Q A;  3MGS D;  1P3P D;  3REJ C;  5C3I B;  5JRG B;  5CP6 B;  1N1J B;  5B1M A;  2BYK A;  3UTB D;  1KX3 C;  2JSS A;  1TAF A;  2J8P A;  5AVC B;  4CSR B;  4JJN C;  4KHA B;  5B2J B;  3KWQ A;  3KFU G;  3W98 A;  3WA9 B;  4YM6 D;  3AYW C;  1ID3 C;  5B0Y B;  5F99 B;  1S32 C;  3A6N D;  4H9P B;  2NQB D;  1M18 B;  3EPK A;  4KGC C;  5FUG A;  3AZH A;  1F66 C;  4YS3 C;  1BH9 B;  5AY8 C;  1AOI C;  1M18 D;  1ULY A;  3AZN C;  2F8N H;  5GT3 C;  2NQB A;  1HQ3 C;  4J8V A;  2CWE A;  3AYW D;  5B2J C;  5GT0 A;  5JA4 B;  3W97 D;  5DNM C;  5CPK D;  5B32 A;  1H3O A;  1KX4 C;  3REH C;  3REI B;  1F66 B;  3REL D;  3LZ1 D;  3KUY C;  2PYO B;  3MGR B;  3AZK D;  5B40 D;  4AWL C;  3MGS B;  5CPK A;  3W97 A;  5DNN B;  3WTP B;  3WKJ A;  5AVC C;  2DQN C;  1KU5 A; 
#chains in the Genus database with same CATH homology
 3MGR A;  3C1C D;  5BS7 C;  5GT0 C;  1KX5 C;  5BT1 C;  4QLC B;  4Z66 A;  3R45 A;  1P3K D;  3C1B B;  4Z2M G;  4CSR A;  5AVC A;  5B32 G;  1P3B A;  3VH6 T;  4AWL B;  4G92 B;  2NZD D;  3AZL A;  3AFA C;  4YM6 A;  2YFW B;  4WU8 B;  3KXB C;  3B0C W;  1S32 A;  5BT1 D;  3KWQ D;  3B0B A;  3AZN D;  3FDD A;  3O62 B;  4QLC C;  1P3K C;  4KGC D;  1HTA A;  5CPI D;  1KX5 B;  1M1A A;  3C1B C;  3P5J B;  5AY8 A;  5B40 B;  5DNM B;  5B1M D;  3VH6 W;  5GSU D;  3UTB A;  4LD9 B;  5AV6 A;  4Z66 C;  3AZE B;  3UTA B;  3KXB A;  4G92 C;  5C3I C;  1HQ3 A;  4H9P A;  1R4V A;  1Q9C A;  3UTA D;  3REH D;  1P3F A;  1M19 B;  5AV5 C;  2Y2P A;  3REL C;  1P3B B;  2Y2L A;  3KXB B;  3W97 C;  1P3K B;  3V9R A;  4X23 A;  5B31 B;  3TU4 D;  3MVD C;  1P3A C;  1ZLA C;  5B0Z B;  3REI D;  2HUE C;  1P3G A;  1P3L B;  3AN2 A;  5AV9 D;  1EQZ A;  4WZS B;  3UT9 D;  2NZD C;  5DNN A;  3W99 A;  3UTA C;  1B67 A;  3NQU B;  3NQJ B;  3MNN B;  3AZF A;  3REK D;  3WAA A;  1U35 D;  4J8W B;  5BNX A;  1M19 C;  3REK C;  5GXQ A;  5B1L A;  3TU4 C;  3A1I A;  3AZG C;  3LZ0 D;  5CPI C;  4WU8 C;  1ZLA B;  4Z5T A;  2Y2K A;  5AV9 C;  2HUE B;  3A6N C;  2F2A C;  4R8P B;  1P3O B;  4J8V B;  1ID3 B;  1P3P B;  3LEL B;  2NZD B;  4ZUX D;  5AV8 C;  3WA9 D;  3AFA A;  3UTB C;  1KX3 D;  1T3U A;  3B0D C;  5B0Y D;  1N1J A;  4J8W C;  2F8N D;  1KX4 D;  1P3M C;  5B24 C;  2W8S A;  3B6G D;  3W96 C;  3LEL A;  1ZLA D;  5B1L C;  3AZI B;  5AV9 B;  2ZY2 A;  3AZL B;  4G91 C;  3B6G C;  2Y2H A;  4WNN A;  4NE5 A;  5DNM D;  4J8X A;  5AV5 D;  2YFV A;  4ZUX C;  3REJ A;  5B0Z C;  1P3P C;  1AOI A;  3KWQ B;  3R45 B;  4Z5T B;  3AZK C;  3C1B D;  5AV8 A;  1BH8 B;  4XZQ A;  1M19 D;  1P3L D;  5CPJ D;  2XD1 A;  1P34 B;  4WU9 A;  3LZ0 C;  3AZF C;  3KUY B;  3F6T A;  4H9Q B;  2PYO C;  5CPJ B;  5AVB A;  5JRG A;  3AZH B;  2CV5 A;  1P34 D;  3MGP C;  3AZG B;  2F8N K;  3AN2 C;  3W99 B;  1P34 A;  3MGQ A;  3X1V A;  1P3I C;  5KDM A;  3LZ0 A;  3O62 D;  3KUY A;  3AV1 C;  5BO0 B;  3WAA C;  4YS3 D;  4WU9 D;  5B31 A;  2HIO B;  1U35 A;  1M18 C;  3X1S D;  2Y2J A;  5E5A A;  4LD9 D;  3C1B A;  1WWI A;  4YS3 B;  1P3M A;  2YFV B;  1JFI A;  3W96 D;  4XUJ B;  3X1S C;  1AOI B;  5KDM B;  3LZ0 B;  5DNN D;  3AZH C;  4UUZ A;  5G49 A;  5AV5 B;  3REJ D;  4KHA A;  5B2I A;  5AV6 B;  4J8X D;  3C1C C;  4YM6 C;  3VH5 T;  4H9N A;  4G91 B;  3B6G B;  3LEL D;  2ZY5 A;  5B24 D;  4JJN B;  3AZI D;  1P3I B;  3X1T C;  5B33 B;  3AZM D;  3AZG A;  1BH9 A;  3EPL A;  3EPH A;  1KX4 B;  1EQZ B;  4NFT A;  5B0Y A;  5BNV B;  5B1M C;  3AFA D;  1KX3 A;  4KUD B;  1HQ3 D;  5B32 B;  3KXB D;  2VQR A;  5AV6 D;  3C1C B;  4J8X B;  3REK B;  3MGP A;  1U35 B;  5AY8 D;  1M1A D;  3WTP C;  2Y2O A;  3AV1 A;  2BG1 A;  3UT9 B;  5B1L D;  4XZQ C;  4J8U B;  3MVD B;  5GSU B;  1P3A B;  3MNN D;  3AZJ C;  1EQZ C;  4NE3 A;  2NZD A;  1ID3 D;  5JRG C;  2F8N G;  4J8X C;  3UT9 A;  3REH B;  5AVC D;  4XUJ C;  3X1S B;  3MVD A;  1P3A A;  1P3G D;  1B6W A;  5B24 B;  4JJN D;  3MGQ C;  2ARO A;  3AV2 B;  4YM6 B;  3TU4 B;  5DNN C;  5F99 D;  3X1T A;  5GSU C;  2FFF B;  1P3F D;  5B2J D;  5B33 C;  5B0Y C;  3AL0 C;  3VH5 A;  4KGC B;  3AZJ B;  5B40 A;  4Z2M H;  4J8V C;  3AZE A;  3X1U B;  3REL A;  5B1M B;  3UTB B;  1P3G B;  5GSU A;  2BYM A;  3AZE D;  4WU9 B;  2JCH A;  5FUG B;  5CPI A;  3AZN B;  3EG5 B;  4KGC A;  2ZM5 A;  2JE5 A;  2Y2N A;  3W96 B;  1S32 D;  3W98 B;  3B6F D;  2Y2I A;  5F99 A;  4J8V D;  5CP6 D;  1PZR A;  3AZL D;  2ARO D;  4H9R B;  1P3G C;  5GXQ C;  5B40 C;  2BYK B;  2Y2Q A;  4Z66 D;  3MGR C;  5BS7 A;  3A6N A;  5CP6 A;  3MGS C;  3NQJ A;  3MNN A;  3AZF B;  3MGR D;  4HGA C;  1BFM A;  2IO5 B;  3B6F A;  2RVQ D;  2ARO C;  3WKJ D;  1Z2C B;  3IP4 C;  3AN2 B;  3W97 B;  2G5H C;  2Y2M A;  2F8N B;  1A7W A;  3AZK A;  3AV1 B;  3LZ1 A;  1WWS A;  5AV8 B;  5B32 C;  3REJ B;  4H9O B;  1TAF B;  1HQ3 B;  5B32 D;  5B2J A;  3NQU A;  2L5A A;  4X23 C;  5B2I C;  4HGA B;  5GT0 D;  1P3I D;  3WKJ B;  5BNV A;  2LY8 A;  5AV6 C;  5B33 D;  3X1T D;  3AYW A;  3AZI A;  5B24 A;  4UPK A;  1TZY C;  3H0M C;  4ZUX B;  5F99 C;  4JJN A;  4DRB A;  1S32 B;  1M18 A;  1F66 A;  3MVD D;  1P3A D;  4R8P C;  3LJA D;  1P3O C;  3AZH D;  4NE6 A;  5CPK B;  1ID3 A;  5GT3 A;  2NQB C;  2G5I C;  3V9R B;  4X23 B;  1BH8 A;  3W98 D;  5B31 D;  5B31 G;  4YS3 A;  5B0Z D;  1TZY D;  1P3M B;  1JFI B;  5CHL B;  2XD5 A;  3AV1 D;  5B31 C;  3MGQ D;  3KSY A;  1TZY B;  1KX5 A;  2ZY3 A;  3MGP D;  3WAA B;  5JRG D;  5AVB D;  4J8U C;  2CV5 D;  3AZJ A;  2NQB B;  5CP6 C;  3MGS A;  1P3P A;  3MNN C;  5CPK C;  5CPJ A;  1P3L A;  4WU9 C;  3WTP D;  5AV8 D;  3AZG D;  4XUJ A;  3AZM A;  1AOI D;  5B2I B;  3LZ1 B;  4E44 A;  2PYO D;  5G49 B;  5AV5 A;  5AVB C;  5BNX B;  4J8U D;  4QLC A;  3MGP B;  4WU8 D;  5GT0 B;  2CV5 C;  3H0L C;  4WNN B;  5B2I D;  1ZLA A;  4E45 A;  3W96 A;  3LEL C;  5AY8 B;  2FJ7 B;  2RIQ A;  5BO0 A;  4WV4 B;  1P3M D;  1KX4 A;  2F8N A;  3B0D B;  5E5A D;  4KUD C;  4LD9 A;  3X1S A;  4WJ3 C;  3X1U A;  3REL B;  5E5A C;  4ZUX A;  4H9N B;  3AFA B;  2BYM B;  3AV2 D;  3O62 A;  3LZ1 C;  3KUY D;  4H9S A;  2IO5 C;  3X1V D;  3VH6 A;  4UUZ B;  5AVB B;  2CV5 B;  4R8P A;  4R8P D;  3AZL C;  1P3O D;  1P3O A;  3EPJ A;  3LJA B;  4Z5T D;  4M6B A;  4DRA A;  3B6F C;  3AV2 A;  4KUD D;  2FJ7 C;  2HIO A;  4J8W D;  3X1T B;  3AZK B;  4Z66 B;  3AZE C;  4XZQ D;  1M19 A;  3REK A;  3WAA D;  5GXQ B;  4ZBJ C;  5JA4 A;  1P34 C;  4CAY B;  5CPJ C;  3MGQ B;  5AV9 A;  3WKJ C;  2FJ7 A;  1P3B C;  3A6N B;  4DQY B;  2YFW A;  5DNM A;  4WU8 A;  1U35 C;  4J8U A;  2FJ7 D;  4X23 D;  2PYO A;  3H0R C;  4CAY A;  3B6G A;  1P3L C;  1H3O B;  4XUJ D;  4XZQ B;  1W2E A;  2HIO C;  4ZBJ B;  3B0C T;  3X1U C;  3WA9 A;  2HIO D;  4H9R A;  4J8W A;  3AZJ D;  4KUD A;  5E5A B;  5CPI B;  1KX5 D;  3O62 C;  4H9S C;  3VH5 W;  3AZM B;  2UWX A;  3W98 C;  3AZN A;  3WA9 C;  3AV2 C;  4EO5 C;  3X1V B;  1M1A C;  3KWQ C;  3LJA C;  1TZY A;  5B0Z A;  5GXQ D;  4LD9 C;  3X1U D;  3B6F B;  1F1E A;  3AZF D;  5GT3 D;  1P3F B;  3W99 D;  1P3B D;  1EQZ D;  3LJA A;  3AN2 D;  5GT3 B;  1F66 D;  3W99 C;  1P3K A;  1KX3 B;  3REI A;  4QLC D;  2Y2G A;  2DF4 C;  3A1K A;  4H9O A;  5B1L B;  3AZI C;  3TU4 A;  2ARO B;  3AZM C;  3C1C A;  5B33 A;  4EO5 B;  3X1V C;  1M1A B;  2ZY4 A;  3UT9 C;  1P3I A;  3REH A;  2RVQ C;  3WTP A;  3WTP E;  3AYW B;  3UTA A;  3REI C;  4Z5T C;  1P3F C;  4H9Q A;  3MGS D;  1P3P D;  3REJ C;  5C3I B;  5JRG B;  5CP6 B;  1N1J B;  5B1M A;  2BYK A;  3UTB D;  1KX3 C;  2JSS A;  1TAF A;  2J8P A;  5AVC B;  4CSR B;  4JJN C;  4KHA B;  5B2J B;  3KWQ A;  3KFU G;  3W98 A;  3WA9 B;  4YM6 D;  3AYW C;  1ID3 C;  5B0Y B;  5F99 B;  1S32 C;  3A6N D;  4H9P B;  2NQB D;  1M18 B;  3EPK A;  4KGC C;  5FUG A;  3AZH A;  1F66 C;  4YS3 C;  1BH9 B;  5AY8 C;  1AOI C;  1M18 D;  1ULY A;  3AZN C;  2F8N H;  5GT3 C;  2NQB A;  1HQ3 C;  4J8V A;  2CWE A;  3AYW D;  5B2J C;  5GT0 A;  5JA4 B;  3W97 D;  5DNM C;  5CPK D;  5B32 A;  1H3O A;  1KX4 C;  3REH C;  3REI B;  1F66 B;  3REL D;  3LZ1 D;  3KUY C;  2PYO B;  3MGR B;  3AZK D;  5B40 D;  4AWL C;  3MGS B;  5CPK A;  3W97 A;  5DNN B;  3WTP B;  3WKJ A;  5AVC C;  2DQN C;  1KU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...