1P3OD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oD00
3MGPB 4YM6A 3REHC 3AZMC 1P3LA 3WKJC 4WU9A 3NQJB 5DNNA 2L5AA 3LZ1C 4LD9D 1ID3C 5GT3D 3KWQB 1F1EA 4J8VD 1KX5B 5GSUB 1M1AB 1B67A 3AZKA 5KDMB 1TZYD 5AV6C 3WAAD 3UT9C 3AZHC 5AV9C 3UTBA 1N1JA 1P3PB 4ZUXA 1P34D 1P3BC 2AROA 1KX4B 5JRGC 3AV1C 5CPIB 1KX3C 3VH5W 5DNNC 1R4VA 3MGPD 3W97B 2IO5B 3AZJC 5B32G 3W99C 5F99A 3KWQD 2NQBD 5B0ZA 5CP6C 2YFVB 3AZNC 3A6NB 5B40A 5E5AC 3REJB 4HGAB 1WWSA 1P3MC 3LZ0A 4H9PB 5BO0B 3O62C 1P3PD 5B33A 3REIC 1JFIB 3W98C 4KUDC 3LJAA 2HIOC 4YM6B 1P3LB 1P3OA 3KXBD 3W97D 4H9NA 3C1BD 3B0BA 3REHD 3MGSB 5AVBA 3WKJD 4G92B 4XUJC 3B0DC 1ID3D 3AV2C 1HTAA 3AZKB 3AZLA 3MGRB 5AV5A 3UTAB 5B1MA 3REJD 4Z5TA 5FUGA 3AZGA 5AV6D 4H9RA 1N1JB 4KGCC 4ZUXB 2AROB 5B2JD 4CSRA 5DNMC 1M18C 4YM6D 4JJNA 5B31A 4WU9D 4J8WA 5DNND 2F8NA 5F99B 1S32A 4ZBJB 1P3GC 5B0ZB 2CV5B 3B6GC 3AFAC 3AZKD 3AZIC 5B40B 3VH6A 5B0YC 1M19A 4R8PC 3LZ0B 2BYKA 5E5AD 4H9SC 3KUYC 5AY8A 3UTBD 5B33B 1B6WA 2AROD 3AN2A 3O62D 3LJAB 3AYWC 3W98D 1BH9A 1F66C 3B0CT 2FJ7C 4H9NB 5AVCA 4XZQA 5AVBB 2PYOA 5F99D 1U35A 1AOIC 3X1VB 5B0ZD 4QLCC 4DRBA 3AZLB 5CHLB 3LELA 5AV5B 5B1MB 3VH5A 4AWLC 5FUGB 3AZGB 4H9RB 4E44A 3LZ0D 2NZDB 4WU8C 3TU4C 3AZEA 4X23B 4CSRB 1EQZC 3B6FA 1Q9CA 1P3FC 3R45B 3LJAD 3WTPE 3AZFA 4JJNB 1P3OD 5DNMD 5B31B 3X1UC 3WTPA 1S32B 5B1LA 3WA9C 5AVBD 3KXBA 3KSYA 4LD9B 3AZMA 3REHA 3B0CW 3AZLD 3LZ1A 4J8VB 4H9QA 1ID3A 3REKC 3AFAD 1M19B 2BYKB 4Z5TD 4Z66C 4YS3C 2JSSA 3AN2B 3KUYD 1P3IC 1BH9B 5C3IB 1P34B 3UT9A 3AZHA 5AV9A 5CPJC 5B31D 4J8WD 4XZQB 1P3BA 2F8ND 5AV8C 1S32D 1U35B 5JRGA 3AV1A 1KX3A 3MGQC 3AZJA 1P3AA 3LELB 5GSUC 2NQBB 3W99A 1M1AC 5GT0C 1M19D 4G91B 2HUEB 5CP6A 3AZNA 5AY8D 3AZEB 3B6FB 3AN2D 5E5AA 3TU4D 3AZFB 1P3MA 1KX4C 5CPIC 5AVCD 3O62A 3WTPB 5B1LB 3REIA 4XZQD 3W98A 4KUDA 3KXBB 2PYOD 2YFWB 1U35D 1P3AC 3C1BB 2HIOA 3REHB 3WKJB 4EO5C 3LELD 1ID3B 3A6NC 4XUJA 3REKD 3AV2A 3AZED 3B6FD 1HQ3C 5AV6B 3MVDC 1A7WA 3AZFD 5B2JB 5AV9B 4WNNA 4KGCA 5B24C 1P3BB 3WTPD 5B1LD 5CPJD 3AV1B 5DNMA 2RVQC 1M18A 1KX3B 4WU9B 5DNNB 3AZMD 4G92C 3MNNC 1P3KC 5G49A 3LZ1D 3W99B 1KU5A 1P3GA 5BT1C 4NE6A 5CP6B 3MGRC 3AZNB 3B6GA 3AFAA 3AZIA 5B32C 5E5AB 3UTBB 5B0YA 1P3MB 4R8PA 3C1CC 3O62B 3UT9D 4J8UC 5AV9D 4H9SA 4WV4B 3KUYA 3AZHD 3W98B 1P3BD 5JRGD 3AYWA 2HIOB 3AV1D 3X1SC 1KX3D 2BYMA 1F66A 5BNXA 3AZJD 2FJ7A 1P3AD 2CV5C 3W99D 4H9OA 5B31G 1AOIA 2F8NG 5CP6D 4UUZA 4QLCA 3AZND 3W96C 5GXQC 1ZLAC 3X1TA 1HQ3D 1P3MD 4WNNB 3MVDD 4KGCB 4WU8A 1ULYA 3TU4A 3REID 1EQZA 5B2IC 4J8XA 5DNMB 1P3FA 1P3OB 4KUDD 4CAYA 2HIOD 4KHAA 3X1UA 3X1VC 5G49B 3WA9A 5BNVA 1P3GB 4XUJD 3AV2D 3AFAB 3X1TC 4Z5TB 5CPKC 2NZDC 5B0YB 3REKA 4R8PB 4YS3A 4Z66A 4NFTA 3KUYB 4J8XC 4KGCD 3V9RA 3RELC 4Z2MG 5BS7C 1P3IA 1M18D 4J8WB 1F66B 2F8NB 5BNXB 5CPJA 3X1SD 4NE5A 4LD9C 5GT3C 5AV8A 3NQJA 4H9OB 4J8VC 1AOIB 1P3GD 3MGQA 4UUZB 3B6GD 5GSUA 3AZID 1TZYC 5GT0A 1M1AA 3VH6T 4M6BA 5B0YD 3WAAC 5AY8B 4R8PD 5KDMA 1ZLAD 3TU4B 4CAYB 5AVCB 3AYWD 3NQUA 3MGPC 1KX4A 1F66D 3X1UB 2PYOB 5CPIA 2FJ7D 1BH8A 3WA9B 5BNVB 3KWQC 2NQBC 1KX5C 1AOID 4QLCD 2HUEC 3REKB 3X1TD 3A6NA 4Z66B 5CPKD 3VH5T 1P3PC 3V9RB 4WU8D 1EQZD 1HQ3A 4J8XD 1P3FD 3MVDA 3RELD 3W97C 2IO5C 3C1BC 5CPJB 3X1UD 5B24A 5AV8B 3AZMB 3WA9D 3MGQB 3LZ1B 3MGSA 4H9QB 3MNNA 1P3KA 5GT0B 3REJC 4HGAC 2F8NH 3MGRA 4YS3D 4Z66D 3UTAA 5B2JC 5B32A 3UT9B 3AZHB 3NQUB 1P3ID 1TAFA 4YM6C 3C1CA 1P3LC 4WU9C 5JRGB 1BH8B 4J8UA 3MGSC 5AV8D 3AZJB 1P3AB 3X1SA 3MGQD 3AZKC 4EO5B 1KX5D 5GSUD 2CV5A 1M1AD 5GT0D 3UTAC 3UTBC 4ZUXC 3W96A 2AROC 1HQ3B 5JA4A 5GXQA 3MVDB 1ZLAA 4E45A 4NE3A 2F8NK 3REIB 1KX4D 4KUDB 5CPID 5B24B 4Z2MH 5F99C 4ZBJC 5B2IA 2LY8A 5B0ZC 4DRAA 3MNNB 1P3KB 1WWIA 3X1VA 4WZSB 4XUJB 5B40C 3B0DB 3AV2B 3A6ND 3LZ0C 5B33C 2NZDA 5CPKA 5B32B 3LJAC 1TAFB 4X23A 3C1CB 1P3OC 3R45A 4J8UB 1M18B 3RELA 5B24D 5AVBC 1P3LD 5BS7A 2RVQD 3X1SB 3MGSD 3AZLC 2CWEA 3MNND 1P3KD 4LD9A 5AV5C 5GT3A 5B1MC 4J8VA 4Z5TC 3B6GB 5BT1D 3MGRD 3AZGC 3AZIB 3UTAD 3W96B 5JA4B 4X23C 5GXQB 1TZYA 1H3OA 5B32D 1ZLAB 4ZUXD 3WAAA 3C1CD 4JJNC 5B31C 4J8WC 3AYWB 4J8UD 1P34A 1S32C 2BYMB 5B2IB 2FJ7B 3MGPA 2CV5D 4QLCB 3KWQA 1M19C 2NQBA 5B40D 1KX5A 5AY8C 3W96D 3X1TB 4AWLB 5CPKB 3AN2C 5GXQD 5B33D 4WU8B 5C3IC 1P34C 1EQZB 5AVCC 4J8XB 1P3PA 1P3FB 3RELB 4XZQC 4KHAB 2PYOC 1U35C 5B2ID 2YFWA 3W97A 3C1BA 3LELC 3X1VD 5GT3B 3WKJA 1BFMA 5AV5D 4G91C 5B1MD 2YFVA 3AZEC 3B6FC 3AZGD 1TZYB 1H3OB 4YS3B 2NZDD 3REJA 3WAAB 4X23D 3AZFC 5AV6A 4H9PA 5BO0A 1P3IB 3WTPC 5B1LC 5B2JA 4JJND 3VH6W 1JFIA 3KXBC
chains in the Genus database with same CATH superfamily
3MGPB 4YM6A 3REHC 3AZMC 1P3LA 3WKJC 4WU9A 3NQJB 5DNNA 2L5AA 3LZ1C 4LD9D 2Y2LA 5GT3D 1ID3C 3KWQB 2G5HC 1F1EA 4J8VD 1KX5B 5GSUB 1M1AB 1B67A 3AZKA 5KDMB 1TZYD 5AV6C 3WAAD 3UT9C 3AZHC 5AV9C 3UTBA 1N1JA 2DQNC 1P3PB 4ZUXA 1P34D 1P3BC 2AROA 1KX4B 5JRGC 3AV1C 5CPIB 1KX3C 3VH5W 5DNNC 1R4VA 3MGPD 3W97B 2IO5B 3AZJC 5B32G 3W99C 5F99A 3KWQD 2NQBD 5B0ZA 5CP6C 2YFVB 3AZNC 3A6NB 5B40A 5E5AC 3REJB 4HGAB 1WWSA 1P3MC 3LZ0A 4H9PB 5BO0B 3O62C 1P3PD 5B33A 3REIC 4DQYB 1JFIB 3W98C 4KUDC 3LJAA 2HIOC 4YM6B 1P3LB 1P3OA 3KXBD 3F6TA 3W97D 4H9NA 3C1BD 3B0BA 3REHD 3MGSB 5AVBA 3WKJD 4G92B 4XUJC 3B0DC 1ID3D 3AV2C 2UWXA 1HTAA 3AZKB 3AZLA 2J8PA 5AV5A 3MGRB 3UTAB 5B1MA 3REJD 4Z5TA 5FUGA 3AZGA 5AV6D 4H9RA 1N1JB 4KGCC 4ZUXB 2AROB 5B2JD 4CSRA 5DNMC 1M18C 4YM6D 4JJNA 5B31A 4WU9D 4J8WA 5DNND 2F8NA 5F99B 1S32A 4ZBJB 1P3GC 3EPLA 5B0ZB 2CV5B 3B6GC 3AFAC 3AZKD 3AZIC 5B40B 3VH6A 2W8SA 5B0YC 1M19A 4R8PC 3LZ0B 2BYKA 5E5AD 4H9SC 3KUYC 5AY8A 3UTBD 5B33B 1B6WA 2AROD 2Y2HA 3O62D 3LJAB 3AYWC 3AN2A 3W98D 1BH9A 1F66C 3B0CT 2FJ7C 4H9NB 5AVCA 2FFFB 4XZQA 5AVBB 2PYOA 5F99D 1U35A 1AOIC 3X1VB 5B0ZD 4QLCC 4DRBA 3AZLB 5CHLB 3LELA 5AV5B 5B1MB 3VH5A 4AWLC 5FUGB 3AZGB 4H9RB 4E44A 3LZ0D 2NZDB 4WU8C 3TU4C 3AZEA 4X23B 4CSRB 1EQZC 3B6FA 1Q9CA 1P3FC 3R45B 3LJAD 3WTPE 3AZFA 4JJNB 1P3OD 5DNMD 5B31B 3X1UC 3WTPA 1S32B 5B1LA 3WA9C 5AVBD 3KXBA 3KSYA 4LD9B 3AZMA 3REHA 2Y2NA 3B0CW 3AZLD 3LZ1A 4J8VB 4H9QA 1ID3A 3REKC 3AFAD 1M19B 3H0RC 2BYKB 4Z5TD 4YS3C 4Z66C 2JSSA 3AN2B 3KUYD 1P3IC 1BH9B 5C3IB 1P34B 3UT9A 3AZHA 5AV9A 5CPJC 5B31D 2Y2QA 4J8WD 4XZQB 1P3BA 2F8ND 5AV8C 1S32D 1U35B 5JRGA 3AV1A 1KX3A 3MGQC 1Z2CB 3AZJA 1P3AA 2Y2OA 3LELB 5GSUC 2NQBB 3W99A 1M1AC 5GT0C 1M19D 3A1KA 4G91B 2HUEB 5CP6A 3AZNA 5AY8D 3AZEB 3B6FB 3AN2D 5E5AA 3TU4D 3AZFB 1P3MA 1KX4C 5CPIC 5AVCD 3O62A 3WTPB 5B1LB 3REIA 4XZQD 3W98A 4KUDA 3KXBB 2PYOD 2YFWB 1U35D 1P3AC 3C1BB 2HIOA 3REHB 3WKJB 4EO5C 3LELD 1ID3B 3A6NC 4XUJA 3REKD 3AV2A 3EPHA 3FDDA 3AZED 3B6FD 1HQ3C 5AV6B 3MVDC 1A7WA 3AZFD 5B2JB 5AV9B 4WNNA 4KGCA 4UPKA 5B24C 1P3BB 3WTPD 5B1LD 5CPJD 3AV1B 5DNMA 2RVQC 1M18A 1KX3B 4WU9B 5DNNB 3AZMD 4G92C 2Y2PA 3EG5B 3MNNC 1P3KC 5G49A 3LZ1D 3W99B 1KU5A 1P3GA 5BT1C 4NE6A 5CP6B 3MGRC 3AZNB 3B6GA 3EPKA 3AFAA 3AZIA 2XD1A 5B32C 5E5AB 3UTBB 5B0YA 1P3MB 4R8PA 3C1CC 3O62B 3UT9D 4J8UC 5AV9D 4H9SA 4WV4B 3KUYA 3AZHD 3W98B 1P3BD 5JRGD 3AYWA 2HIOB 3AV1D 3X1SC 1KX3D 2RIQA 2BYMA 1F66A 5BNXA 3KFUG 3AZJD 2FJ7A 1P3AD 2CV5C 3W99D 4H9OA 5B31G 1AOIA 2F8NG 5CP6D 4UUZA 4QLCA 2JCHA 3AZND 3W96C 5GXQC 1ZLAC 3X1TA 1HQ3D 1P3MD 4WNNB 3MVDD 4KGCB 4WU8A 2ZM5A 1ULYA 3TU4A 3REID 1EQZA 5B2IC 4J8XA 5DNMB 1P3FA 1P3OB 4KUDD 4CAYA 2XD5A 2HIOD 4KHAA 2VQRA 3X1UA 3X1VC 5G49B 3H0MC 3WA9A 5BNVA 1P3GB 2G5IC 4XUJD 3AV2D 3AFAB 3X1TC 4Z5TB 5CPKC 2NZDC 2F2AC 5B0YB 3REKA 4R8PB 4YS3A 4Z66A 4NFTA 3KUYB 4J8XC 4KGCD 3V9RA 3RELC 4Z2MG 5BS7C 1P3IA 1M18D 4J8WB 1F66B 2F8NB 5BNXB 5CPJA 1PZRA 3X1SD 4NE5A 2Y2IA 4LD9C 5GT3C 5AV8A 3NQJA 4H9OB 4J8VC 1AOIB 1P3GD 3MGQA 4UUZB 3B6GD 5GSUA 3AZID 1TZYC 5GT0A 1M1AA 3AL0C 3VH6T 4M6BA 5B0YD 3WAAC 5AY8B 2ZY5A 4R8PD 5KDMA 1ZLAD 4WJ3C 3TU4B 4CAYB 5AVCB 3AYWD 3NQUA 3MGPC 1KX4A 1F66D 3X1UB 2PYOB 5CPIA 2FJ7D 1BH8A 3WA9B 5BNVB 3KWQC 2NQBC 1KX5C 1AOID 4QLCD 2HUEC 3REKB 3X1TD 3A6NA 4Z66B 5CPKD 3VH5T 3IP4C 1P3PC 3V9RB 4WU8D 1EQZD 1HQ3A 4J8XD 1P3FD 3MVDA 3RELD 3P5JB 3W97C 2IO5C 3C1BC 5CPJB 3X1UD 5B24A 5AV8B 3AZMB 3WA9D 3MGQB 3LZ1B 3MGSA 4H9QB 3MNNA 1P3KA 5GT0B 3REJC 4HGAC 2F8NH 3MGRA 4YS3D 4Z66D 3UTAA 5B2JC 5B32A 3UT9B 3AZHB 3NQUB 1P3ID 1TAFA 4YM6C 3C1CA 1P3LC 4WU9C 5JRGB 1BH8B 4J8UA 2Y2GA 3MGSC 5AV8D 3AZJB 1P3AB 3X1SA 3MGQD 3AZKC 4EO5B 1KX5D 5GSUD 2CV5A 1M1AD 5GT0D 3UTAC 3H0LC 3UTBC 4ZUXC 3W96A 2AROC 1HQ3B 5JA4A 5GXQA 3MVDB 1ZLAA 4E45A 4NE3A 2F8NK 3REIB 1KX4D 4KUDB 5CPID 5B24B 4Z2MH 5F99C 4ZBJC 5B2IA 2LY8A 5B0ZC 1T3UA 4DRAA 3MNNB 1P3KB 1WWIA 1W2EA 4WZSB 3X1VA 4XUJB 5B40C 3B0DB 3AV2B 3A6ND 3LZ0C 5B33C 2NZDA 5CPKA 5B32B 3LJAC 1TAFB 4X23A 3C1CB 1P3OC 3R45A 4J8UB 1M18B 3RELA 5B24D 5AVBC 1P3LD 2DF4C 5BS7A 2RVQD 3X1SB 3MGSD 3AZLC 2CWEA 2ZY3A 3MNND 1P3KD 4LD9A 5AV5C 5GT3A 5B1MC 4J8VA 2ZY2A 4Z5TC 3B6GB 5BT1D 3MGRD 3AZGC 3AZIB 3UTAD 2BG1A 3W96B 2JE5A 5JA4B 4X23C 5GXQB 1TZYA 1H3OA 5B32D 1ZLAB 4ZUXD 3WAAA 3C1CD 4JJNC 5B31C 4J8WC 3AYWB 4J8UD 1P34A 1S32C 2BYMB 5B2IB 2FJ7B 3MGPA 2CV5D 4QLCB 3KWQA 1M19C 2NQBA 5B40D 1KX5A 5AY8C 2Y2JA 3W96D 3X1TB 3EPJA 2Y2MA 4AWLB 3AN2C 5CPKB 5GXQD 5B33D 4WU8B 5C3IC 1P34C 1EQZB 5AVCC 4J8XB 1P3PA 1P3FB 3RELB 2Y2KA 4XZQC 4KHAB 2PYOC 1U35C 5B2ID 2ZY4A 2YFWA 3W97A 3C1BA 3LELC 3X1VD 5GT3B 3WKJA 1BFMA 5AV5D 4G91C 5B1MD 2YFVA 3AZEC 3B6FC 3AZGD 1TZYB 1H3OB 4YS3B 2NZDD 3REJA 3WAAB 4X23D 3AZFC 5AV6A 4H9PA 5BO0A 3A1IA 1P3IB 3WTPC 5B1LC 5B2JA 4JJND 3VH6W 1JFIA 3KXBC
chains in the Genus database with same CATH topology
3MGPB 4YM6A 3REHC 3AZMC 1P3LA 3WKJC 4WU9A 3NQJB 5DNNA 2L5AA 3LZ1C 4LD9D 2Y2LA 5GT3D 1ID3C 3KWQB 2G5HC 1F1EA 4J8VD 1KX5B 5GSUB 1M1AB 1B67A 3AZKA 5KDMB 1TZYD 5AV6C 3WAAD 3UT9C 3AZHC 5AV9C 3UTBA 1N1JA 2DQNC 1P3PB 4ZUXA 1P34D 1P3BC 2AROA 1KX4B 5JRGC 3AV1C 5CPIB 1KX3C 3VH5W 5DNNC 1R4VA 3MGPD 3W97B 2IO5B 3AZJC 5B32G 3W99C 5F99A 3KWQD 2NQBD 5B0ZA 5CP6C 2YFVB 3AZNC 3A6NB 5B40A 5E5AC 3REJB 4HGAB 1WWSA 1P3MC 3LZ0A 4H9PB 5BO0B 3O62C 1P3PD 5B33A 3REIC 4DQYB 1JFIB 3W98C 4KUDC 3LJAA 2HIOC 4YM6B 1P3LB 1P3OA 3KXBD 3F6TA 3W97D 4H9NA 3C1BD 3B0BA 3REHD 3MGSB 5AVBA 3WKJD 4G92B 4XUJC 3B0DC 1ID3D 3AV2C 2UWXA 1HTAA 3AZKB 3AZLA 2J8PA 5AV5A 3MGRB 3UTAB 5B1MA 3REJD 4Z5TA 5FUGA 3AZGA 5AV6D 4H9RA 1N1JB 4KGCC 4ZUXB 2AROB 5B2JD 4CSRA 5DNMC 1M18C 4YM6D 4JJNA 5B31A 4WU9D 4J8WA 5DNND 2F8NA 5F99B 1S32A 4ZBJB 1P3GC 3EPLA 5B0ZB 2CV5B 3B6GC 3AFAC 3AZKD 3AZIC 5B40B 3VH6A 2W8SA 5B0YC 1M19A 4R8PC 3LZ0B 2BYKA 5E5AD 4H9SC 3KUYC 5AY8A 3UTBD 5B33B 1B6WA 2AROD 2Y2HA 3O62D 3LJAB 3AYWC 3AN2A 3W98D 1BH9A 1F66C 3B0CT 2FJ7C 4H9NB 5AVCA 2FFFB 4XZQA 5AVBB 2PYOA 5F99D 1U35A 1AOIC 3X1VB 5B0ZD 4QLCC 4DRBA 3AZLB 5CHLB 3LELA 5AV5B 5B1MB 3VH5A 4AWLC 5FUGB 3AZGB 4H9RB 4E44A 3LZ0D 2NZDB 4WU8C 3TU4C 3AZEA 4X23B 4CSRB 1EQZC 3B6FA 1Q9CA 1P3FC 3R45B 3LJAD 3WTPE 3AZFA 4JJNB 1P3OD 5DNMD 5B31B 3X1UC 3WTPA 1S32B 5B1LA 3WA9C 5AVBD 3KXBA 3KSYA 4LD9B 3AZMA 3REHA 2Y2NA 3B0CW 3AZLD 3LZ1A 4J8VB 4H9QA 1ID3A 3REKC 3AFAD 1M19B 3H0RC 2BYKB 4Z5TD 4YS3C 4Z66C 2JSSA 3AN2B 3KUYD 1P3IC 1BH9B 5C3IB 1P34B 3UT9A 3AZHA 5AV9A 5CPJC 5B31D 2Y2QA 4J8WD 4XZQB 1P3BA 2F8ND 5AV8C 1S32D 1U35B 5JRGA 3AV1A 1KX3A 3MGQC 1Z2CB 3AZJA 1P3AA 2Y2OA 3LELB 5GSUC 2NQBB 3W99A 1M1AC 5GT0C 1M19D 3A1KA 4G91B 2HUEB 5CP6A 3AZNA 5AY8D 3AZEB 3B6FB 3AN2D 5E5AA 3TU4D 3AZFB 1P3MA 1KX4C 5CPIC 5AVCD 3O62A 3WTPB 5B1LB 3REIA 4XZQD 3W98A 4KUDA 3KXBB 2PYOD 2YFWB 1U35D 1P3AC 3C1BB 2HIOA 3REHB 3WKJB 4EO5C 3LELD 1ID3B 3A6NC 4XUJA 3REKD 3AV2A 3EPHA 3FDDA 3AZED 3B6FD 1HQ3C 5AV6B 3MVDC 1A7WA 3AZFD 5B2JB 5AV9B 4WNNA 4KGCA 4UPKA 5B24C 1P3BB 3WTPD 5B1LD 5CPJD 3AV1B 5DNMA 2RVQC 1M18A 1KX3B 4WU9B 5DNNB 3AZMD 4G92C 2Y2PA 3EG5B 3MNNC 1P3KC 5G49A 3LZ1D 3W99B 1KU5A 1P3GA 5BT1C 4NE6A 5CP6B 3MGRC 3AZNB 3B6GA 3EPKA 3AFAA 3AZIA 2XD1A 5B32C 5E5AB 3UTBB 5B0YA 1P3MB 4R8PA 3C1CC 3O62B 3UT9D 4J8UC 5AV9D 4H9SA 4WV4B 3KUYA 3AZHD 3W98B 1P3BD 5JRGD 3AYWA 2HIOB 3AV1D 3X1SC 1KX3D 2RIQA 2BYMA 1F66A 5BNXA 3KFUG 3AZJD 2FJ7A 1P3AD 2CV5C 3W99D 4H9OA 5B31G 1AOIA 2F8NG 5CP6D 4UUZA 4QLCA 2JCHA 3AZND 3W96C 5GXQC 1ZLAC 3X1TA 1HQ3D 1P3MD 4WNNB 3MVDD 4KGCB 4WU8A 2ZM5A 1ULYA 3TU4A 3REID 1EQZA 5B2IC 4J8XA 5DNMB 1P3FA 1P3OB 4KUDD 4CAYA 2XD5A 2HIOD 4KHAA 2VQRA 3X1UA 3X1VC 5G49B 3H0MC 3WA9A 5BNVA 1P3GB 2G5IC 4XUJD 3AV2D 3AFAB 3X1TC 4Z5TB 5CPKC 2NZDC 2F2AC 5B0YB 3REKA 4R8PB 4YS3A 4Z66A 4NFTA 3KUYB 4J8XC 4KGCD 3V9RA 3RELC 4Z2MG 5BS7C 1P3IA 1M18D 4J8WB 1F66B 2F8NB 5BNXB 5CPJA 1PZRA 3X1SD 4NE5A 2Y2IA 4LD9C 5GT3C 5AV8A 3NQJA 4H9OB 4J8VC 1AOIB 1P3GD 3MGQA 4UUZB 3B6GD 5GSUA 3AZID 1TZYC 5GT0A 1M1AA 3AL0C 3VH6T 4M6BA 5B0YD 3WAAC 5AY8B 2ZY5A 4R8PD 5KDMA 1ZLAD 4WJ3C 3TU4B 4CAYB 5AVCB 3AYWD 3NQUA 3MGPC 1KX4A 1F66D 3X1UB 2PYOB 5CPIA 2FJ7D 1BH8A 3WA9B 5BNVB 3KWQC 2NQBC 1KX5C 1AOID 4QLCD 2HUEC 3REKB 3X1TD 3A6NA 4Z66B 5CPKD 3VH5T 3IP4C 1P3PC 3V9RB 4WU8D 1EQZD 1HQ3A 4J8XD 1P3FD 3MVDA 3RELD 3P5JB 3W97C 2IO5C 3C1BC 5CPJB 3X1UD 5B24A 5AV8B 3AZMB 3WA9D 3MGQB 3LZ1B 3MGSA 4H9QB 3MNNA 1P3KA 5GT0B 3REJC 4HGAC 2F8NH 3MGRA 4YS3D 4Z66D 3UTAA 5B2JC 5B32A 3UT9B 3AZHB 3NQUB 1P3ID 1TAFA 4YM6C 3C1CA 1P3LC 4WU9C 5JRGB 1BH8B 4J8UA 2Y2GA 3MGSC 5AV8D 3AZJB 1P3AB 3X1SA 3MGQD 3AZKC 4EO5B 1KX5D 5GSUD 2CV5A 1M1AD 5GT0D 3UTAC 3H0LC 3UTBC 4ZUXC 3W96A 2AROC 1HQ3B 5JA4A 5GXQA 3MVDB 1ZLAA 4E45A 4NE3A 2F8NK 3REIB 1KX4D 4KUDB 5CPID 5B24B 4Z2MH 5F99C 4ZBJC 5B2IA 2LY8A 5B0ZC 1T3UA 4DRAA 3MNNB 1P3KB 1WWIA 1W2EA 4WZSB 3X1VA 4XUJB 5B40C 3B0DB 3AV2B 3A6ND 3LZ0C 5B33C 2NZDA 5CPKA 5B32B 3LJAC 1TAFB 4X23A 3C1CB 1P3OC 3R45A 4J8UB 1M18B 3RELA 5B24D 5AVBC 1P3LD 2DF4C 5BS7A 2RVQD 3X1SB 3MGSD 3AZLC 2CWEA 2ZY3A 3MNND 1P3KD 4LD9A 5AV5C 5GT3A 5B1MC 4J8VA 2ZY2A 4Z5TC 3B6GB 5BT1D 3MGRD 3AZGC 3AZIB 3UTAD 2BG1A 3W96B 2JE5A 5JA4B 4X23C 5GXQB 1TZYA 1H3OA 5B32D 1ZLAB 4ZUXD 3WAAA 3C1CD 4JJNC 5B31C 4J8WC 3AYWB 4J8UD 1P34A 1S32C 2BYMB 5B2IB 2FJ7B 3MGPA 2CV5D 4QLCB 3KWQA 1M19C 2NQBA 5B40D 1KX5A 5AY8C 2Y2JA 3W96D 3X1TB 3EPJA 2Y2MA 4AWLB 3AN2C 5CPKB 5GXQD 5B33D 4WU8B 5C3IC 1P34C 1EQZB 5AVCC 4J8XB 1P3PA 1P3FB 3RELB 2Y2KA 4XZQC 4KHAB 2PYOC 1U35C 5B2ID 2ZY4A 2YFWA 3W97A 3C1BA 3LELC 3X1VD 5GT3B 3WKJA 1BFMA 5AV5D 4G91C 5B1MD 2YFVA 3AZEC 3B6FC 3AZGD 1TZYB 1H3OB 4YS3B 2NZDD 3REJA 3WAAB 4X23D 3AZFC 5AV6A 4H9PA 5BO0A 3A1IA 1P3IB 3WTPC 5B1LC 5B2JA 4JJND 3VH6W 1JFIA 3KXBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  4YM6 A;  3REH C;  3AZM C;  1P3L A;  3WKJ C;  4WU9 A;  3NQJ B;  5DNN A;  2L5A A;  3LZ1 C;  4LD9 D;  1ID3 C;  5GT3 D;  3KWQ B;  1F1E A;  4J8V D;  1KX5 B;  5GSU B;  1M1A B;  1B67 A;  3AZK A;  5KDM B;  1TZY D;  5AV6 C;  3WAA D;  3UT9 C;  3AZH C;  5AV9 C;  3UTB A;  1N1J A;  1P3P B;  4ZUX A;  1P34 D;  1P3B C;  2ARO A;  1KX4 B;  5JRG C;  3AV1 C;  5CPI B;  1KX3 C;  3VH5 W;  5DNN C;  1R4V A;  3MGP D;  3W97 B;  2IO5 B;  3AZJ C;  5B32 G;  3W99 C;  5F99 A;  3KWQ D;  2NQB D;  5B0Z A;  5CP6 C;  2YFV B;  3AZN C;  3A6N B;  5B40 A;  5E5A C;  3REJ B;  4HGA B;  1WWS A;  1P3M C;  3LZ0 A;  4H9P B;  5BO0 B;  3O62 C;  1P3P D;  5B33 A;  3REI C;  1JFI B;  3W98 C;  4KUD C;  3LJA A;  2HIO C;  4YM6 B;  1P3L B;  1P3O A;  3KXB D;  3W97 D;  4H9N A;  3C1B D;  3B0B A;  3REH D;  3MGS B;  5AVB A;  3WKJ D;  4G92 B;  4XUJ C;  3B0D C;  1ID3 D;  3AV2 C;  1HTA A;  3AZK B;  3AZL A;  3MGR B;  5AV5 A;  3UTA B;  5B1M A;  3REJ D;  4Z5T A;  5FUG A;  3AZG A;  5AV6 D;  4H9R A;  1N1J B;  4KGC C;  4ZUX B;  2ARO B;  5B2J D;  4CSR A;  5DNM C;  1M18 C;  4YM6 D;  4JJN A;  5B31 A;  4WU9 D;  4J8W A;  5DNN D;  2F8N A;  5F99 B;  1S32 A;  4ZBJ B;  1P3G C;  5B0Z B;  2CV5 B;  3B6G C;  3AFA C;  3AZK D;  3AZI C;  5B40 B;  3VH6 A;  5B0Y C;  1M19 A;  4R8P C;  3LZ0 B;  2BYK A;  5E5A D;  4H9S C;  3KUY C;  5AY8 A;  3UTB D;  5B33 B;  1B6W A;  2ARO D;  3AN2 A;  3O62 D;  3LJA B;  3AYW C;  3W98 D;  1BH9 A;  1F66 C;  3B0C T;  2FJ7 C;  4H9N B;  5AVC A;  4XZQ A;  5AVB B;  2PYO A;  5F99 D;  1U35 A;  1AOI C;  3X1V B;  5B0Z D;  4QLC C;  4DRB A;  3AZL B;  5CHL B;  3LEL A;  5AV5 B;  5B1M B;  3VH5 A;  4AWL C;  5FUG B;  3AZG B;  4H9R B;  4E44 A;  3LZ0 D;  2NZD B;  4WU8 C;  3TU4 C;  3AZE A;  4X23 B;  4CSR B;  1EQZ C;  3B6F A;  1Q9C A;  1P3F C;  3R45 B;  3LJA D;  3WTP E;  3AZF A;  4JJN B;  1P3O D;  5DNM D;  5B31 B;  3X1U C;  3WTP A;  1S32 B;  5B1L A;  3WA9 C;  5AVB D;  3KXB A;  3KSY A;  4LD9 B;  3AZM A;  3REH A;  3B0C W;  3AZL D;  3LZ1 A;  4J8V B;  4H9Q A;  1ID3 A;  3REK C;  3AFA D;  1M19 B;  2BYK B;  4Z5T D;  4Z66 C;  4YS3 C;  2JSS A;  3AN2 B;  3KUY D;  1P3I C;  1BH9 B;  5C3I B;  1P34 B;  3UT9 A;  3AZH A;  5AV9 A;  5CPJ C;  5B31 D;  4J8W D;  4XZQ B;  1P3B A;  2F8N D;  5AV8 C;  1S32 D;  1U35 B;  5JRG A;  3AV1 A;  1KX3 A;  3MGQ C;  3AZJ A;  1P3A A;  3LEL B;  5GSU C;  2NQB B;  3W99 A;  1M1A C;  5GT0 C;  1M19 D;  4G91 B;  2HUE B;  5CP6 A;  3AZN A;  5AY8 D;  3AZE B;  3B6F B;  3AN2 D;  5E5A A;  3TU4 D;  3AZF B;  1P3M A;  1KX4 C;  5CPI C;  5AVC D;  3O62 A;  3WTP B;  5B1L B;  3REI A;  4XZQ D;  3W98 A;  4KUD A;  3KXB B;  2PYO D;  2YFW B;  1U35 D;  1P3A C;  3C1B B;  2HIO A;  3REH B;  3WKJ B;  4EO5 C;  3LEL D;  1ID3 B;  3A6N C;  4XUJ A;  3REK D;  3AV2 A;  3AZE D;  3B6F D;  1HQ3 C;  5AV6 B;  3MVD C;  1A7W A;  3AZF D;  5B2J B;  5AV9 B;  4WNN A;  4KGC A;  5B24 C;  1P3B B;  3WTP D;  5B1L D;  5CPJ D;  3AV1 B;  5DNM A;  2RVQ C;  1M18 A;  1KX3 B;  4WU9 B;  5DNN B;  3AZM D;  4G92 C;  3MNN C;  1P3K C;  5G49 A;  3LZ1 D;  3W99 B;  1KU5 A;  1P3G A;  5BT1 C;  4NE6 A;  5CP6 B;  3MGR C;  3AZN B;  3B6G A;  3AFA A;  3AZI A;  5B32 C;  5E5A B;  3UTB B;  5B0Y A;  1P3M B;  4R8P A;  3C1C C;  3O62 B;  3UT9 D;  4J8U C;  5AV9 D;  4H9S A;  4WV4 B;  3KUY A;  3AZH D;  3W98 B;  1P3B D;  5JRG D;  3AYW A;  2HIO B;  3AV1 D;  3X1S C;  1KX3 D;  2BYM A;  1F66 A;  5BNX A;  3AZJ D;  2FJ7 A;  1P3A D;  2CV5 C;  3W99 D;  4H9O A;  5B31 G;  1AOI A;  2F8N G;  5CP6 D;  4UUZ A;  4QLC A;  3AZN D;  3W96 C;  5GXQ C;  1ZLA C;  3X1T A;  1HQ3 D;  1P3M D;  4WNN B;  3MVD D;  4KGC B;  4WU8 A;  1ULY A;  3TU4 A;  3REI D;  1EQZ A;  5B2I C;  4J8X A;  5DNM B;  1P3F A;  1P3O B;  4KUD D;  4CAY A;  2HIO D;  4KHA A;  3X1U A;  3X1V C;  5G49 B;  3WA9 A;  5BNV A;  1P3G B;  4XUJ D;  3AV2 D;  3AFA B;  3X1T C;  4Z5T B;  5CPK C;  2NZD C;  5B0Y B;  3REK A;  4R8P B;  4YS3 A;  4Z66 A;  4NFT A;  3KUY B;  4J8X C;  4KGC D;  3V9R A;  3REL C;  4Z2M G;  5BS7 C;  1P3I A;  1M18 D;  4J8W B;  1F66 B;  2F8N B;  5BNX B;  5CPJ A;  3X1S D;  4NE5 A;  4LD9 C;  5GT3 C;  5AV8 A;  3NQJ A;  4H9O B;  4J8V C;  1AOI B;  1P3G D;  3MGQ A;  4UUZ B;  3B6G D;  5GSU A;  3AZI D;  1TZY C;  5GT0 A;  1M1A A;  3VH6 T;  4M6B A;  5B0Y D;  3WAA C;  5AY8 B;  4R8P D;  5KDM A;  1ZLA D;  3TU4 B;  4CAY B;  5AVC B;  3AYW D;  3NQU A;  3MGP C;  1KX4 A;  1F66 D;  3X1U B;  2PYO B;  5CPI A;  2FJ7 D;  1BH8 A;  3WA9 B;  5BNV B;  3KWQ C;  2NQB C;  1KX5 C;  1AOI D;  4QLC D;  2HUE C;  3REK B;  3X1T D;  3A6N A;  4Z66 B;  5CPK D;  3VH5 T;  1P3P C;  3V9R B;  4WU8 D;  1EQZ D;  1HQ3 A;  4J8X D;  1P3F D;  3MVD A;  3REL D;  3W97 C;  2IO5 C;  3C1B C;  5CPJ B;  3X1U D;  5B24 A;  5AV8 B;  3AZM B;  3WA9 D;  3MGQ B;  3LZ1 B;  3MGS A;  4H9Q B;  3MNN A;  1P3K A;  5GT0 B;  3REJ C;  4HGA C;  2F8N H;  3MGR A;  4YS3 D;  4Z66 D;  3UTA A;  5B2J C;  5B32 A;  3UT9 B;  3AZH B;  3NQU B;  1P3I D;  1TAF A;  4YM6 C;  3C1C A;  1P3L C;  4WU9 C;  5JRG B;  1BH8 B;  4J8U A;  3MGS C;  5AV8 D;  3AZJ B;  1P3A B;  3X1S A;  3MGQ D;  3AZK C;  4EO5 B;  1KX5 D;  5GSU D;  2CV5 A;  1M1A D;  5GT0 D;  3UTA C;  3UTB C;  4ZUX C;  3W96 A;  2ARO C;  1HQ3 B;  5JA4 A;  5GXQ A;  3MVD B;  1ZLA A;  4E45 A;  4NE3 A;  2F8N K;  3REI B;  1KX4 D;  4KUD B;  5CPI D;  5B24 B;  4Z2M H;  5F99 C;  4ZBJ C;  5B2I A;  2LY8 A;  5B0Z C;  4DRA A;  3MNN B;  1P3K B;  1WWI A;  3X1V A;  4WZS B;  4XUJ B;  5B40 C;  3B0D B;  3AV2 B;  3A6N D;  3LZ0 C;  5B33 C;  2NZD A;  5CPK A;  5B32 B;  3LJA C;  1TAF B;  4X23 A;  3C1C B;  1P3O C;  3R45 A;  4J8U B;  1M18 B;  3REL A;  5B24 D;  5AVB C;  1P3L D;  5BS7 A;  2RVQ D;  3X1S B;  3MGS D;  3AZL C;  2CWE A;  3MNN D;  1P3K D;  4LD9 A;  5AV5 C;  5GT3 A;  5B1M C;  4J8V A;  4Z5T C;  3B6G B;  5BT1 D;  3MGR D;  3AZG C;  3AZI B;  3UTA D;  3W96 B;  5JA4 B;  4X23 C;  5GXQ B;  1TZY A;  1H3O A;  5B32 D;  1ZLA B;  4ZUX D;  3WAA A;  3C1C D;  4JJN C;  5B31 C;  4J8W C;  3AYW B;  4J8U D;  1P34 A;  1S32 C;  2BYM B;  5B2I B;  2FJ7 B;  3MGP A;  2CV5 D;  4QLC B;  3KWQ A;  1M19 C;  2NQB A;  5B40 D;  1KX5 A;  5AY8 C;  3W96 D;  3X1T B;  4AWL B;  5CPK B;  3AN2 C;  5GXQ D;  5B33 D;  4WU8 B;  5C3I C;  1P34 C;  1EQZ B;  5AVC C;  4J8X B;  1P3P A;  1P3F B;  3REL B;  4XZQ C;  4KHA B;  2PYO C;  1U35 C;  5B2I D;  2YFW A;  3W97 A;  3C1B A;  3LEL C;  3X1V D;  5GT3 B;  3WKJ A;  1BFM A;  5AV5 D;  4G91 C;  5B1M D;  2YFV A;  3AZE C;  3B6F C;  3AZG D;  1TZY B;  1H3O B;  4YS3 B;  2NZD D;  3REJ A;  3WAA B;  4X23 D;  3AZF C;  5AV6 A;  4H9P A;  5BO0 A;  1P3I B;  3WTP C;  5B1L C;  5B2J A;  4JJN D;  3VH6 W;  1JFI A;  3KXB C; 
#chains in the Genus database with same CATH topology
 3MGP B;  4YM6 A;  3REH C;  3AZM C;  1P3L A;  3WKJ C;  4WU9 A;  3NQJ B;  5DNN A;  2L5A A;  3LZ1 C;  4LD9 D;  2Y2L A;  5GT3 D;  1ID3 C;  3KWQ B;  2G5H C;  1F1E A;  4J8V D;  1KX5 B;  5GSU B;  1M1A B;  1B67 A;  3AZK A;  5KDM B;  1TZY D;  5AV6 C;  3WAA D;  3UT9 C;  3AZH C;  5AV9 C;  3UTB A;  1N1J A;  2DQN C;  1P3P B;  4ZUX A;  1P34 D;  1P3B C;  2ARO A;  1KX4 B;  5JRG C;  3AV1 C;  5CPI B;  1KX3 C;  3VH5 W;  5DNN C;  1R4V A;  3MGP D;  3W97 B;  2IO5 B;  3AZJ C;  5B32 G;  3W99 C;  5F99 A;  3KWQ D;  2NQB D;  5B0Z A;  5CP6 C;  2YFV B;  3AZN C;  3A6N B;  5B40 A;  5E5A C;  3REJ B;  4HGA B;  1WWS A;  1P3M C;  3LZ0 A;  4H9P B;  5BO0 B;  3O62 C;  1P3P D;  5B33 A;  3REI C;  4DQY B;  1JFI B;  3W98 C;  4KUD C;  3LJA A;  2HIO C;  4YM6 B;  1P3L B;  1P3O A;  3KXB D;  3F6T A;  3W97 D;  4H9N A;  3C1B D;  3B0B A;  3REH D;  3MGS B;  5AVB A;  3WKJ D;  4G92 B;  4XUJ C;  3B0D C;  1ID3 D;  3AV2 C;  2UWX A;  1HTA A;  3AZK B;  3AZL A;  2J8P A;  5AV5 A;  3MGR B;  3UTA B;  5B1M A;  3REJ D;  4Z5T A;  5FUG A;  3AZG A;  5AV6 D;  4H9R A;  1N1J B;  4KGC C;  4ZUX B;  2ARO B;  5B2J D;  4CSR A;  5DNM C;  1M18 C;  4YM6 D;  4JJN A;  5B31 A;  4WU9 D;  4J8W A;  5DNN D;  2F8N A;  5F99 B;  1S32 A;  4ZBJ B;  1P3G C;  3EPL A;  5B0Z B;  2CV5 B;  3B6G C;  3AFA C;  3AZK D;  3AZI C;  5B40 B;  3VH6 A;  2W8S A;  5B0Y C;  1M19 A;  4R8P C;  3LZ0 B;  2BYK A;  5E5A D;  4H9S C;  3KUY C;  5AY8 A;  3UTB D;  5B33 B;  1B6W A;  2ARO D;  2Y2H A;  3O62 D;  3LJA B;  3AYW C;  3AN2 A;  3W98 D;  1BH9 A;  1F66 C;  3B0C T;  2FJ7 C;  4H9N B;  5AVC A;  2FFF B;  4XZQ A;  5AVB B;  2PYO A;  5F99 D;  1U35 A;  1AOI C;  3X1V B;  5B0Z D;  4QLC C;  4DRB A;  3AZL B;  5CHL B;  3LEL A;  5AV5 B;  5B1M B;  3VH5 A;  4AWL C;  5FUG B;  3AZG B;  4H9R B;  4E44 A;  3LZ0 D;  2NZD B;  4WU8 C;  3TU4 C;  3AZE A;  4X23 B;  4CSR B;  1EQZ C;  3B6F A;  1Q9C A;  1P3F C;  3R45 B;  3LJA D;  3WTP E;  3AZF A;  4JJN B;  1P3O D;  5DNM D;  5B31 B;  3X1U C;  3WTP A;  1S32 B;  5B1L A;  3WA9 C;  5AVB D;  3KXB A;  3KSY A;  4LD9 B;  3AZM A;  3REH A;  2Y2N A;  3B0C W;  3AZL D;  3LZ1 A;  4J8V B;  4H9Q A;  1ID3 A;  3REK C;  3AFA D;  1M19 B;  3H0R C;  2BYK B;  4Z5T D;  4YS3 C;  4Z66 C;  2JSS A;  3AN2 B;  3KUY D;  1P3I C;  1BH9 B;  5C3I B;  1P34 B;  3UT9 A;  3AZH A;  5AV9 A;  5CPJ C;  5B31 D;  2Y2Q A;  4J8W D;  4XZQ B;  1P3B A;  2F8N D;  5AV8 C;  1S32 D;  1U35 B;  5JRG A;  3AV1 A;  1KX3 A;  3MGQ C;  1Z2C B;  3AZJ A;  1P3A A;  2Y2O A;  3LEL B;  5GSU C;  2NQB B;  3W99 A;  1M1A C;  5GT0 C;  1M19 D;  3A1K A;  4G91 B;  2HUE B;  5CP6 A;  3AZN A;  5AY8 D;  3AZE B;  3B6F B;  3AN2 D;  5E5A A;  3TU4 D;  3AZF B;  1P3M A;  1KX4 C;  5CPI C;  5AVC D;  3O62 A;  3WTP B;  5B1L B;  3REI A;  4XZQ D;  3W98 A;  4KUD A;  3KXB B;  2PYO D;  2YFW B;  1U35 D;  1P3A C;  3C1B B;  2HIO A;  3REH B;  3WKJ B;  4EO5 C;  3LEL D;  1ID3 B;  3A6N C;  4XUJ A;  3REK D;  3AV2 A;  3EPH A;  3FDD A;  3AZE D;  3B6F D;  1HQ3 C;  5AV6 B;  3MVD C;  1A7W A;  3AZF D;  5B2J B;  5AV9 B;  4WNN A;  4KGC A;  4UPK A;  5B24 C;  1P3B B;  3WTP D;  5B1L D;  5CPJ D;  3AV1 B;  5DNM A;  2RVQ C;  1M18 A;  1KX3 B;  4WU9 B;  5DNN B;  3AZM D;  4G92 C;  2Y2P A;  3EG5 B;  3MNN C;  1P3K C;  5G49 A;  3LZ1 D;  3W99 B;  1KU5 A;  1P3G A;  5BT1 C;  4NE6 A;  5CP6 B;  3MGR C;  3AZN B;  3B6G A;  3EPK A;  3AFA A;  3AZI A;  2XD1 A;  5B32 C;  5E5A B;  3UTB B;  5B0Y A;  1P3M B;  4R8P A;  3C1C C;  3O62 B;  3UT9 D;  4J8U C;  5AV9 D;  4H9S A;  4WV4 B;  3KUY A;  3AZH D;  3W98 B;  1P3B D;  5JRG D;  3AYW A;  2HIO B;  3AV1 D;  3X1S C;  1KX3 D;  2RIQ A;  2BYM A;  1F66 A;  5BNX A;  3KFU G;  3AZJ D;  2FJ7 A;  1P3A D;  2CV5 C;  3W99 D;  4H9O A;  5B31 G;  1AOI A;  2F8N G;  5CP6 D;  4UUZ A;  4QLC A;  2JCH A;  3AZN D;  3W96 C;  5GXQ C;  1ZLA C;  3X1T A;  1HQ3 D;  1P3M D;  4WNN B;  3MVD D;  4KGC B;  4WU8 A;  2ZM5 A;  1ULY A;  3TU4 A;  3REI D;  1EQZ A;  5B2I C;  4J8X A;  5DNM B;  1P3F A;  1P3O B;  4KUD D;  4CAY A;  2XD5 A;  2HIO D;  4KHA A;  2VQR A;  3X1U A;  3X1V C;  5G49 B;  3H0M C;  3WA9 A;  5BNV A;  1P3G B;  2G5I C;  4XUJ D;  3AV2 D;  3AFA B;  3X1T C;  4Z5T B;  5CPK C;  2NZD C;  2F2A C;  5B0Y B;  3REK A;  4R8P B;  4YS3 A;  4Z66 A;  4NFT A;  3KUY B;  4J8X C;  4KGC D;  3V9R A;  3REL C;  4Z2M G;  5BS7 C;  1P3I A;  1M18 D;  4J8W B;  1F66 B;  2F8N B;  5BNX B;  5CPJ A;  1PZR A;  3X1S D;  4NE5 A;  2Y2I A;  4LD9 C;  5GT3 C;  5AV8 A;  3NQJ A;  4H9O B;  4J8V C;  1AOI B;  1P3G D;  3MGQ A;  4UUZ B;  3B6G D;  5GSU A;  3AZI D;  1TZY C;  5GT0 A;  1M1A A;  3AL0 C;  3VH6 T;  4M6B A;  5B0Y D;  3WAA C;  5AY8 B;  2ZY5 A;  4R8P D;  5KDM A;  1ZLA D;  4WJ3 C;  3TU4 B;  4CAY B;  5AVC B;  3AYW D;  3NQU A;  3MGP C;  1KX4 A;  1F66 D;  3X1U B;  2PYO B;  5CPI A;  2FJ7 D;  1BH8 A;  3WA9 B;  5BNV B;  3KWQ C;  2NQB C;  1KX5 C;  1AOI D;  4QLC D;  2HUE C;  3REK B;  3X1T D;  3A6N A;  4Z66 B;  5CPK D;  3VH5 T;  3IP4 C;  1P3P C;  3V9R B;  4WU8 D;  1EQZ D;  1HQ3 A;  4J8X D;  1P3F D;  3MVD A;  3REL D;  3P5J B;  3W97 C;  2IO5 C;  3C1B C;  5CPJ B;  3X1U D;  5B24 A;  5AV8 B;  3AZM B;  3WA9 D;  3MGQ B;  3LZ1 B;  3MGS A;  4H9Q B;  3MNN A;  1P3K A;  5GT0 B;  3REJ C;  4HGA C;  2F8N H;  3MGR A;  4YS3 D;  4Z66 D;  3UTA A;  5B2J C;  5B32 A;  3UT9 B;  3AZH B;  3NQU B;  1P3I D;  1TAF A;  4YM6 C;  3C1C A;  1P3L C;  4WU9 C;  5JRG B;  1BH8 B;  4J8U A;  2Y2G A;  3MGS C;  5AV8 D;  3AZJ B;  1P3A B;  3X1S A;  3MGQ D;  3AZK C;  4EO5 B;  1KX5 D;  5GSU D;  2CV5 A;  1M1A D;  5GT0 D;  3UTA C;  3H0L C;  3UTB C;  4ZUX C;  3W96 A;  2ARO C;  1HQ3 B;  5JA4 A;  5GXQ A;  3MVD B;  1ZLA A;  4E45 A;  4NE3 A;  2F8N K;  3REI B;  1KX4 D;  4KUD B;  5CPI D;  5B24 B;  4Z2M H;  5F99 C;  4ZBJ C;  5B2I A;  2LY8 A;  5B0Z C;  1T3U A;  4DRA A;  3MNN B;  1P3K B;  1WWI A;  1W2E A;  4WZS B;  3X1V A;  4XUJ B;  5B40 C;  3B0D B;  3AV2 B;  3A6N D;  3LZ0 C;  5B33 C;  2NZD A;  5CPK A;  5B32 B;  3LJA C;  1TAF B;  4X23 A;  3C1C B;  1P3O C;  3R45 A;  4J8U B;  1M18 B;  3REL A;  5B24 D;  5AVB C;  1P3L D;  2DF4 C;  5BS7 A;  2RVQ D;  3X1S B;  3MGS D;  3AZL C;  2CWE A;  2ZY3 A;  3MNN D;  1P3K D;  4LD9 A;  5AV5 C;  5GT3 A;  5B1M C;  4J8V A;  2ZY2 A;  4Z5T C;  3B6G B;  5BT1 D;  3MGR D;  3AZG C;  3AZI B;  3UTA D;  2BG1 A;  3W96 B;  2JE5 A;  5JA4 B;  4X23 C;  5GXQ B;  1TZY A;  1H3O A;  5B32 D;  1ZLA B;  4ZUX D;  3WAA A;  3C1C D;  4JJN C;  5B31 C;  4J8W C;  3AYW B;  4J8U D;  1P34 A;  1S32 C;  2BYM B;  5B2I B;  2FJ7 B;  3MGP A;  2CV5 D;  4QLC B;  3KWQ A;  1M19 C;  2NQB A;  5B40 D;  1KX5 A;  5AY8 C;  2Y2J A;  3W96 D;  3X1T B;  3EPJ A;  2Y2M A;  4AWL B;  3AN2 C;  5CPK B;  5GXQ D;  5B33 D;  4WU8 B;  5C3I C;  1P34 C;  1EQZ B;  5AVC C;  4J8X B;  1P3P A;  1P3F B;  3REL B;  2Y2K A;  4XZQ C;  4KHA B;  2PYO C;  1U35 C;  5B2I D;  2ZY4 A;  2YFW A;  3W97 A;  3C1B A;  3LEL C;  3X1V D;  5GT3 B;  3WKJ A;  1BFM A;  5AV5 D;  4G91 C;  5B1M D;  2YFV A;  3AZE C;  3B6F C;  3AZG D;  1TZY B;  1H3O B;  4YS3 B;  2NZD D;  3REJ A;  3WAA B;  4X23 D;  3AZF C;  5AV6 A;  4H9P A;  5BO0 A;  3A1I A;  1P3I B;  3WTP C;  5B1L C;  5B2J A;  4JJN D;  3VH6 W;  1JFI A;  3KXB C; 
#chains in the Genus database with same CATH homology
 3MGP B;  4YM6 A;  3REH C;  3AZM C;  1P3L A;  3WKJ C;  4WU9 A;  3NQJ B;  5DNN A;  2L5A A;  3LZ1 C;  4LD9 D;  2Y2L A;  5GT3 D;  1ID3 C;  3KWQ B;  2G5H C;  1F1E A;  4J8V D;  1KX5 B;  5GSU B;  1M1A B;  1B67 A;  3AZK A;  5KDM B;  1TZY D;  5AV6 C;  3WAA D;  3UT9 C;  3AZH C;  5AV9 C;  3UTB A;  1N1J A;  2DQN C;  1P3P B;  4ZUX A;  1P34 D;  1P3B C;  2ARO A;  1KX4 B;  5JRG C;  3AV1 C;  5CPI B;  1KX3 C;  3VH5 W;  5DNN C;  1R4V A;  3MGP D;  3W97 B;  2IO5 B;  3AZJ C;  5B32 G;  3W99 C;  5F99 A;  3KWQ D;  2NQB D;  5B0Z A;  5CP6 C;  2YFV B;  3AZN C;  3A6N B;  5B40 A;  5E5A C;  3REJ B;  4HGA B;  1WWS A;  1P3M C;  3LZ0 A;  4H9P B;  5BO0 B;  3O62 C;  1P3P D;  5B33 A;  3REI C;  4DQY B;  1JFI B;  3W98 C;  4KUD C;  3LJA A;  2HIO C;  4YM6 B;  1P3L B;  1P3O A;  3KXB D;  3F6T A;  3W97 D;  4H9N A;  3C1B D;  3B0B A;  3REH D;  3MGS B;  5AVB A;  3WKJ D;  4G92 B;  4XUJ C;  3B0D C;  1ID3 D;  3AV2 C;  2UWX A;  1HTA A;  3AZK B;  3AZL A;  2J8P A;  5AV5 A;  3MGR B;  3UTA B;  5B1M A;  3REJ D;  4Z5T A;  5FUG A;  3AZG A;  5AV6 D;  4H9R A;  1N1J B;  4KGC C;  4ZUX B;  2ARO B;  5B2J D;  4CSR A;  5DNM C;  1M18 C;  4YM6 D;  4JJN A;  5B31 A;  4WU9 D;  4J8W A;  5DNN D;  2F8N A;  5F99 B;  1S32 A;  4ZBJ B;  1P3G C;  3EPL A;  5B0Z B;  2CV5 B;  3B6G C;  3AFA C;  3AZK D;  3AZI C;  5B40 B;  3VH6 A;  2W8S A;  5B0Y C;  1M19 A;  4R8P C;  3LZ0 B;  2BYK A;  5E5A D;  4H9S C;  3KUY C;  5AY8 A;  3UTB D;  5B33 B;  1B6W A;  2ARO D;  2Y2H A;  3O62 D;  3LJA B;  3AYW C;  3AN2 A;  3W98 D;  1BH9 A;  1F66 C;  3B0C T;  2FJ7 C;  4H9N B;  5AVC A;  2FFF B;  4XZQ A;  5AVB B;  2PYO A;  5F99 D;  1U35 A;  1AOI C;  3X1V B;  5B0Z D;  4QLC C;  4DRB A;  3AZL B;  5CHL B;  3LEL A;  5AV5 B;  5B1M B;  3VH5 A;  4AWL C;  5FUG B;  3AZG B;  4H9R B;  4E44 A;  3LZ0 D;  2NZD B;  4WU8 C;  3TU4 C;  3AZE A;  4X23 B;  4CSR B;  1EQZ C;  3B6F A;  1Q9C A;  1P3F C;  3R45 B;  3LJA D;  3WTP E;  3AZF A;  4JJN B;  1P3O D;  5DNM D;  5B31 B;  3X1U C;  3WTP A;  1S32 B;  5B1L A;  3WA9 C;  5AVB D;  3KXB A;  3KSY A;  4LD9 B;  3AZM A;  3REH A;  2Y2N A;  3B0C W;  3AZL D;  3LZ1 A;  4J8V B;  4H9Q A;  1ID3 A;  3REK C;  3AFA D;  1M19 B;  3H0R C;  2BYK B;  4Z5T D;  4YS3 C;  4Z66 C;  2JSS A;  3AN2 B;  3KUY D;  1P3I C;  1BH9 B;  5C3I B;  1P34 B;  3UT9 A;  3AZH A;  5AV9 A;  5CPJ C;  5B31 D;  2Y2Q A;  4J8W D;  4XZQ B;  1P3B A;  2F8N D;  5AV8 C;  1S32 D;  1U35 B;  5JRG A;  3AV1 A;  1KX3 A;  3MGQ C;  1Z2C B;  3AZJ A;  1P3A A;  2Y2O A;  3LEL B;  5GSU C;  2NQB B;  3W99 A;  1M1A C;  5GT0 C;  1M19 D;  3A1K A;  4G91 B;  2HUE B;  5CP6 A;  3AZN A;  5AY8 D;  3AZE B;  3B6F B;  3AN2 D;  5E5A A;  3TU4 D;  3AZF B;  1P3M A;  1KX4 C;  5CPI C;  5AVC D;  3O62 A;  3WTP B;  5B1L B;  3REI A;  4XZQ D;  3W98 A;  4KUD A;  3KXB B;  2PYO D;  2YFW B;  1U35 D;  1P3A C;  3C1B B;  2HIO A;  3REH B;  3WKJ B;  4EO5 C;  3LEL D;  1ID3 B;  3A6N C;  4XUJ A;  3REK D;  3AV2 A;  3EPH A;  3FDD A;  3AZE D;  3B6F D;  1HQ3 C;  5AV6 B;  3MVD C;  1A7W A;  3AZF D;  5B2J B;  5AV9 B;  4WNN A;  4KGC A;  4UPK A;  5B24 C;  1P3B B;  3WTP D;  5B1L D;  5CPJ D;  3AV1 B;  5DNM A;  2RVQ C;  1M18 A;  1KX3 B;  4WU9 B;  5DNN B;  3AZM D;  4G92 C;  2Y2P A;  3EG5 B;  3MNN C;  1P3K C;  5G49 A;  3LZ1 D;  3W99 B;  1KU5 A;  1P3G A;  5BT1 C;  4NE6 A;  5CP6 B;  3MGR C;  3AZN B;  3B6G A;  3EPK A;  3AFA A;  3AZI A;  2XD1 A;  5B32 C;  5E5A B;  3UTB B;  5B0Y A;  1P3M B;  4R8P A;  3C1C C;  3O62 B;  3UT9 D;  4J8U C;  5AV9 D;  4H9S A;  4WV4 B;  3KUY A;  3AZH D;  3W98 B;  1P3B D;  5JRG D;  3AYW A;  2HIO B;  3AV1 D;  3X1S C;  1KX3 D;  2RIQ A;  2BYM A;  1F66 A;  5BNX A;  3KFU G;  3AZJ D;  2FJ7 A;  1P3A D;  2CV5 C;  3W99 D;  4H9O A;  5B31 G;  1AOI A;  2F8N G;  5CP6 D;  4UUZ A;  4QLC A;  2JCH A;  3AZN D;  3W96 C;  5GXQ C;  1ZLA C;  3X1T A;  1HQ3 D;  1P3M D;  4WNN B;  3MVD D;  4KGC B;  4WU8 A;  2ZM5 A;  1ULY A;  3TU4 A;  3REI D;  1EQZ A;  5B2I C;  4J8X A;  5DNM B;  1P3F A;  1P3O B;  4KUD D;  4CAY A;  2XD5 A;  2HIO D;  4KHA A;  2VQR A;  3X1U A;  3X1V C;  5G49 B;  3H0M C;  3WA9 A;  5BNV A;  1P3G B;  2G5I C;  4XUJ D;  3AV2 D;  3AFA B;  3X1T C;  4Z5T B;  5CPK C;  2NZD C;  2F2A C;  5B0Y B;  3REK A;  4R8P B;  4YS3 A;  4Z66 A;  4NFT A;  3KUY B;  4J8X C;  4KGC D;  3V9R A;  3REL C;  4Z2M G;  5BS7 C;  1P3I A;  1M18 D;  4J8W B;  1F66 B;  2F8N B;  5BNX B;  5CPJ A;  1PZR A;  3X1S D;  4NE5 A;  2Y2I A;  4LD9 C;  5GT3 C;  5AV8 A;  3NQJ A;  4H9O B;  4J8V C;  1AOI B;  1P3G D;  3MGQ A;  4UUZ B;  3B6G D;  5GSU A;  3AZI D;  1TZY C;  5GT0 A;  1M1A A;  3AL0 C;  3VH6 T;  4M6B A;  5B0Y D;  3WAA C;  5AY8 B;  2ZY5 A;  4R8P D;  5KDM A;  1ZLA D;  4WJ3 C;  3TU4 B;  4CAY B;  5AVC B;  3AYW D;  3NQU A;  3MGP C;  1KX4 A;  1F66 D;  3X1U B;  2PYO B;  5CPI A;  2FJ7 D;  1BH8 A;  3WA9 B;  5BNV B;  3KWQ C;  2NQB C;  1KX5 C;  1AOI D;  4QLC D;  2HUE C;  3REK B;  3X1T D;  3A6N A;  4Z66 B;  5CPK D;  3VH5 T;  3IP4 C;  1P3P C;  3V9R B;  4WU8 D;  1EQZ D;  1HQ3 A;  4J8X D;  1P3F D;  3MVD A;  3REL D;  3P5J B;  3W97 C;  2IO5 C;  3C1B C;  5CPJ B;  3X1U D;  5B24 A;  5AV8 B;  3AZM B;  3WA9 D;  3MGQ B;  3LZ1 B;  3MGS A;  4H9Q B;  3MNN A;  1P3K A;  5GT0 B;  3REJ C;  4HGA C;  2F8N H;  3MGR A;  4YS3 D;  4Z66 D;  3UTA A;  5B2J C;  5B32 A;  3UT9 B;  3AZH B;  3NQU B;  1P3I D;  1TAF A;  4YM6 C;  3C1C A;  1P3L C;  4WU9 C;  5JRG B;  1BH8 B;  4J8U A;  2Y2G A;  3MGS C;  5AV8 D;  3AZJ B;  1P3A B;  3X1S A;  3MGQ D;  3AZK C;  4EO5 B;  1KX5 D;  5GSU D;  2CV5 A;  1M1A D;  5GT0 D;  3UTA C;  3H0L C;  3UTB C;  4ZUX C;  3W96 A;  2ARO C;  1HQ3 B;  5JA4 A;  5GXQ A;  3MVD B;  1ZLA A;  4E45 A;  4NE3 A;  2F8N K;  3REI B;  1KX4 D;  4KUD B;  5CPI D;  5B24 B;  4Z2M H;  5F99 C;  4ZBJ C;  5B2I A;  2LY8 A;  5B0Z C;  1T3U A;  4DRA A;  3MNN B;  1P3K B;  1WWI A;  1W2E A;  4WZS B;  3X1V A;  4XUJ B;  5B40 C;  3B0D B;  3AV2 B;  3A6N D;  3LZ0 C;  5B33 C;  2NZD A;  5CPK A;  5B32 B;  3LJA C;  1TAF B;  4X23 A;  3C1C B;  1P3O C;  3R45 A;  4J8U B;  1M18 B;  3REL A;  5B24 D;  5AVB C;  1P3L D;  2DF4 C;  5BS7 A;  2RVQ D;  3X1S B;  3MGS D;  3AZL C;  2CWE A;  2ZY3 A;  3MNN D;  1P3K D;  4LD9 A;  5AV5 C;  5GT3 A;  5B1M C;  4J8V A;  2ZY2 A;  4Z5T C;  3B6G B;  5BT1 D;  3MGR D;  3AZG C;  3AZI B;  3UTA D;  2BG1 A;  3W96 B;  2JE5 A;  5JA4 B;  4X23 C;  5GXQ B;  1TZY A;  1H3O A;  5B32 D;  1ZLA B;  4ZUX D;  3WAA A;  3C1C D;  4JJN C;  5B31 C;  4J8W C;  3AYW B;  4J8U D;  1P34 A;  1S32 C;  2BYM B;  5B2I B;  2FJ7 B;  3MGP A;  2CV5 D;  4QLC B;  3KWQ A;  1M19 C;  2NQB A;  5B40 D;  1KX5 A;  5AY8 C;  2Y2J A;  3W96 D;  3X1T B;  3EPJ A;  2Y2M A;  4AWL B;  3AN2 C;  5CPK B;  5GXQ D;  5B33 D;  4WU8 B;  5C3I C;  1P34 C;  1EQZ B;  5AVC C;  4J8X B;  1P3P A;  1P3F B;  3REL B;  2Y2K A;  4XZQ C;  4KHA B;  2PYO C;  1U35 C;  5B2I D;  2ZY4 A;  2YFW A;  3W97 A;  3C1B A;  3LEL C;  3X1V D;  5GT3 B;  3WKJ A;  1BFM A;  5AV5 D;  4G91 C;  5B1M D;  2YFV A;  3AZE C;  3B6F C;  3AZG D;  1TZY B;  1H3O B;  4YS3 B;  2NZD D;  3REJ A;  3WAA B;  4X23 D;  3AZF C;  5AV6 A;  4H9P A;  5BO0 A;  3A1I A;  1P3I B;  3WTP C;  5B1L C;  5B2J A;  4JJN D;  3VH6 W;  1JFI A;  3KXB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...