1P3OD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
b'KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oD00
5B32A 3MGSB 1P3PC 3MGQD 3KXBD 1BH9B 3AZLD 1P3OC 3W98A 3X1SD 5BS7C 3AN2A 3RELC 4ZUXD 5AV6C 1EQZA 2LY8A 3WAAB 4WU8A 1ZLAA 3C1CD 3X1VB 1ID3C 4KUDB 3AZNA 3B6FA 4J8XA 5BNVB 5AVCB 4QLCD 4WNNA 1P34C 1TZYD 1M18D 5B0ZA 2AROB 3AN2D 1ULYA 5CPJA 5B40C 4Z5TD 3A6NB 1R4VA 3KWQD 2CV5B 3REJC 4YM6B 3WTPC 3NQUA 3WKJB 3AZKC 3R45A 4KGCB 4XUJC 1WWSA 3LZ0B 5CPJD 4KUDA 5CPIA 3REIC 3MGSD 3AZGB 4ZBJC 5B31C 2NZDA 5GSUB 2CWEA 4YS3B 3MGQC 3KXBC 3AZLC 3X1SC 2NQBB 4ZUXC 2IO5C 3X1VD 1M1AA 4KUDD 4J8WB 1BH8A 3MVDB 5B2IB 3AZMB 4HGAB 5AV8B 4JJNB 5B32G 5AVCD 1HTAA 3C1CC 1P3FB 3B6GA 4KGCA 3AFAA 2AROD 3LZ0A 4QLCC 1TZYC 1M18C 5BT1D 3A6ND 3AZJA 3AN2C 2CV5D 3AZGA 1N1JA 4YM6D 3WA9A 2YFVA 1F66A 1P3KB 3MGRB 4Z5TC 4YS3A 3KWQC 2HIOA 2IO5B 4KGCD 3LZ0D 1M19A 2PYOB 3MVDA 4LD9B 3C1BA 1P3LB 3AZJD 3AZGD 5CPJC 1P3IA 2YFWB 5C3IC 5GSUD 4H9QB 4J8UB 4CAYA 3MGPA 3MGSC 4YS3D 2HIOD 3B0CT 4J8WD 5FUGA 3MVDD 5B2ID 1P3KA 3AZFA 1HQ3A 4JJND 3X1VC 1P3FD 1P3ID 2HUEB 4KUDC 5B40B 5CP6B 1JFIA 5AVCC 3REJB 2F8NA 1P3BA 2AROC 1AOIB 4H9QA 1TAFA 1P3KD 5BT1C 4XUJB 3A6NC 3REKB 1HQ3D 2CV5C 5CPKA 4YM6C 1KX3A 4H9NA 1A7WA 2PYOD 4H9OB 3AZHB 1KX4A 4KGCC 1P3LD 4LD9D 3LZ0C 5F99A 3UTAB 4M6BA 4J8UD 4ZUXB 5AY8B 3AZJC 5G49B 3AZGC 1H3OB 4WV4B 5GSUC 1KX3D 5GT3A 1U35B 1P3AB 4Z66A 4YS3C 3W99A 2HIOC 5B32B 3TU4B 4J8WC 3MVDC 3W98B 5B2IC 4HGAC 5CP6D 4JJNC 1P3FC 1P3IC 1EQZB 4H9OA 3AZHA 4WU8B 3W99D 1AOID 1ZLAB 3AZNB 3B6FB 4J8XB 3REKD 4WNNB 5B0ZB 1P3KC 1P3AA 5E5AA 1HQ3C 3X1UA 5C3IB 5B24A 3AZHD 2F8NG 3UTAD 3TU4A 5AVBB 2PYOC 3NQUB 4LD9C 1P3LC 5AY8D 4X23A 3R45B 4J8UC 1KX5A 1U35D 1P3AD 4NE6A 1KX3C 5CPIB 5B32D 3AZIB 2NZDB 3TU4D 3AYWA 3W98D 2HUEC 1EQZD 4WU8D 1ZLAD 3VH6W 5CP6C 1M1AB 5AVBA 1BH8B 3AZND 4NFTA 4E45A 4J8XD 3W97A 1KU5A 3W99C 1AOIC 3B6FD 3B6GB 3AFAB 5B0ZD 3REKC 5B1LA 3AZIA 5AV5A 3AZJB 3LZ1A 5B2JA 3X1TA 1N1JB 3WA9B 5AVBD 2YFVB 3AZHC 1F66B 4EO5B 2HIOB 3UTAC 4H9RA 5DNNB 4G92B 5AY8C 1M19B 1B67A 5GXQB 3C1BB 5BO0A 4J8VB 3B0BA 3AZID 5CPID 3VH5A 3LZ1D 1U35C 1P3AC 2BYKB 2NZDD 1P3IB 1P3GA 4G91B 4CAYB 4CSRB 5B32C 3MGPB 3REHA 5DNMA 3TU4C 4NE5A 5KDMA 5B31G 3W98C 1M1AD 5FUGB 1EQZC 2F8NH 3AZFB 4WU8C 1HQ3B 1ZLAC 5AV9A 3B6GD 3AFAD 4H9SA 5DNNA 3AZNC 1JFIB 4J8XC 3AV1A 3B6FC 3REHD 2F8NB 3KUYA 5GXQA 4J8VA 5B0ZC 1P3BB 5CPJB 2BYKA 3WA9D 4H9PA 1TAFB 4R8PA 1F66D 4CSRA 4XZQA 5AV9D 5CPKB 2BYMB 4NE3A 5AVBC 1KX3B 5DNND 4H9NB 1M19D 3LJAA 1KX4B 5GXQD 3C1BD 4J8VD 5F99B 3AV2A 5CPIC 4XZQD 3MGPD 3AZIC 3LZ1C 2NZDC 5GT3B 3LELA 3W99B 4Z66B 3AZEA 4E44A 3AZFD 1S32A 2BYMA 1M1AC 2RVQD 2F8ND 3B6GC 3O62A 3AFAC 3LELD 1P3BD 3MNNA 4AWLB 3REHC 5CPKD 3WA9C 1P3PA 3B0DB 1F66C 4EO5C 5GT0A 5E5AB 5BS7A 3X1UB 5AV9C 5B24B 1KX4D 5DNNC 4WZSB 3UTBA 3MNND 5F99D 4G92C 1ID3A 1M19C 5GXQC 3C1BC 4J8VC 5BNXA 4X23B 1P34A 4G91C 5GT3D 1KX5B 4XZQC 4Z66D 3MGPC 4KHAA 2FJ7B 3UTBD 3AYWB 3WTPA 3AZFC 2RVQC 3VH6T 5CHLB 4WU9A 3LELC 1P3BC 3NQJA 3REIA 5B1MB 3W97B 5B31A 5JRGA 1P3MA 5B33A 5E5AD 3X1UD 5CPKC 2FJ7A 5B1LB 5B24D 3MGQA 3AZLA 5AV5B 3X1SA 3LZ1B 4WU9D 5B2JB 3X1TB 3KSYA 1KX4C 3MNNC 5F99C 4X23D 3C1CA 5JRGD 4H9RB 1KX5D 1P3MD 5B33D 2FJ7D 4QLCA 3UT9A 5GT3C 5BO0B 1TZYA 1M18A 5GT0C 4Z66C 5B1MA 4Z2MG 3AYWD 1P3GB 4UUZA 4Z5TA 2L5AA 3UTBC 3REHB 3KWQA 5DNMB 5KDMB 1Q9CA 3V9RA 3UT9D 2F8NK 3W97D 5B1MD 5AV9B 4AWLC 5B0YC 3AV1B 3MGSA 3W96B 5B1LD 5JA4B 3KUYB 1BH9A 3B0DC 5AV5D 5E5AC 3X1UC 3X1TD 5B2JD 5B24C 4H9PB 4R8PB 4XZQB 3WAAA 4WU9C 3X1VA 1F1EA 5BNVA 5AVCA 4X23C 3LJAB 4DRAA 5JRGC 1KX5C 1P3MC 5B33C 2AROA 2FJ7C 1P3GD 3AV2B 3A6NA 3W96A 3WAAD 2CV5A 5DNMD 5JA4A 4YM6A 3AYWC 3LELB 3WKJA 3AZEB 1B6WA 1S32B 3VH6A 3UT9C 3AV1D 3W97C 5B1MC 3W96D 3O62B 3KUYD 5GSUA 3WKJD 3MNNB 5B1LC 5B0YB 4R8PD 5AV5C 4Z2MH 2NQBA 5B2JC 3X1TC 1P3PB 4J8WA 1P3OB 5B2IA 5GT0B 3AZMA 5AV8A 3RELB 4JJNA 3LJAD 1P3FA 5AV6B 3UTBB 1ID3B 3AV2D 5BNXB 2NQBD 1WWIA 1P34B 1P3GC 3MGRA 3AZMD 3WAAC 4KHAB 5AV8D 5DNMC 5B0YA 3AZED 1S32D 3WTPB 2PYOA 1P3OA 1BFMA 4LD9A 1P3LA 3WTPE 3RELA 3AZKB 5AV6A 3O62D 2YFWA 4H9SC 4J8UA 3MGRD 3AV1C 4WU9B 3W96C 4DRBA 5B0YD 3KUYC 3NQJB 2JSSA 3REIB 3WKJC 4ZBJB 5B31B 1P3PD 3B0CW 5JRGB 1P3OD 4R8PC 5GT0D 5B33B 1P3MB 3RELD 5AV6D 3MGQB 3KXBB 3AZLB 5B40A 3X1SB 5CP6A 1ID3D 3LJAC 3REJA 3VH5T 1AOIA 3AZKA 3C1CB 1P34D 3AV2C 4XUJA 2NQBC 3REKA 4QLCB 3UT9B 1TZYB 5B40D 1M18B 3AZMC 3AN2B 5AV8C 3REJD 3AZEC 3WTPD 4UUZB 1S32C 4Z5TB 3KWQB 3AZKD 3UTAA 3KXBA 4XUJD 4ZUXA 5AY8A 3V9RB 5G49A 3O62C 1H3OA 3VH5W 3MGRC 3REID 1U35A 5B31D
chains in the Genus database with same CATH superfamily
5B32A 3MGSB 1P3PC 3MGQD 3KXBD 1BH9B 3AZLD 1P3OC 3W98A 3X1SD 5BS7C 3AN2A 3RELC 4ZUXD 2G5HC 5AV6C 1EQZA 2LY8A 3WAAB 4WU8A 1ZLAA 3C1CD 3X1VB 1ID3C 4KUDB 3AZNA 3B6FA 4J8XA 5BNVB 5AVCB 4QLCD 4WNNA 1P34C 1TZYD 1M18D 5B0ZA 2AROB 3AN2D 1ULYA 5CPJA 5B40C 4Z5TD 3A6NB 1R4VA 3KWQD 2CV5B 3REJC 4YM6B 3WTPC 3NQUA 3WKJB 3AZKC 3P5JB 3R45A 4KGCB 4XUJC 1WWSA 3LZ0B 5CPJD 4KUDA 5CPIA 3REIC 3MGSD 3AZGB 4ZBJC 5B31C 2NZDA 5GSUB 3EPJA 2CWEA 4YS3B 3MGQC 3KXBC 3AZLC 3X1SC 2NQBB 4ZUXC 2IO5C 3X1VD 1M1AA 4KUDD 4J8WB 1BH8A 3MVDB 5B2IB 3AZMB 4HGAB 1PZRA 5AV8B 4JJNB 5B32G 5AVCD 1HTAA 3C1CC 1P3FB 3B6GA 4KGCA 3AFAA 2AROD 3LZ0A 4QLCC 1TZYC 1M18C 5BT1D 3A6ND 3AZJA 3AN2C 2CV5D 3AZGA 1N1JA 4YM6D 3WA9A 2YFVA 1F66A 1P3KB 3MGRB 4Z5TC 4YS3A 3KWQC 2HIOA 2IO5B 4KGCD 3LZ0D 1M19A 2PYOB 3MVDA 4LD9B 3C1BA 1P3LB 2JE5A 3H0MC 3AZJD 3AZGD 5CPJC 1P3IA 2YFWB 5C3IC 5GSUD 4H9QB 4J8UB 4CAYA 3MGPA 3MGSC 4YS3D 2HIOD 3B0CT 4J8WD 3KFUG 5FUGA 3MVDD 5B2ID 1P3KA 3AZFA 1HQ3A 4JJND 3X1VC 1P3FD 1P3ID 2HUEB 4KUDC 5B40B 5CP6B 1JFIA 5AVCC 3REJB 2F8NA 1P3BA 2AROC 1AOIB 4H9QA 1TAFA 1P3KD 5BT1C 4XUJB 3A6NC 3REKB 1HQ3D 2CV5C 5CPKA 4YM6C 1KX3A 4H9NA 1A7WA 2XD1A 2PYOD 4H9OB 3AZHB 1KX4A 4KGCC 1P3LD 4LD9D 3LZ0C 5F99A 3UTAB 4M6BA 4J8UD 4ZUXB 5AY8B 3AZJC 5G49B 3AZGC 1H3OB 4WV4B 5GSUC 1KX3D 1T3UA 5GT3A 2Y2IA 1U35B 1P3AB 4Z66A 4YS3C 3W99A 2HIOC 5B32B 2ZY2A 3TU4B 4J8WC 3MVDC 3W98B 5B2IC 4HGAC 5CP6D 4JJNC 1P3FC 1P3IC 1EQZB 4H9OA 3AZHA 2Y2HA 4WU8B 3W99D 1AOID 1ZLAB 3AZNB 3B6FB 4J8XB 3REKD 4WNNB 5B0ZB 1P3KC 1P3AA 5E5AA 1HQ3C 3X1UA 5C3IB 5B24A 3AZHD 2F8NG 4UPKA 3UTAD 3TU4A 5AVBB 2PYOC 3NQUB 4LD9C 1P3LC 5AY8D 4X23A 3R45B 4J8UC 1KX5A 1U35D 1P3AD 4NE6A 1KX3C 5CPIB 5B32D 3AZIB 2NZDB 3TU4D 3AYWA 3W98D 2HUEC 1EQZD 4WU8D 1ZLAD 3VH6W 5CP6C 1M1AB 5AVBA 1BH8B 3AZND 4NFTA 4E45A 4J8XD 3W97A 1KU5A 3W99C 1AOIC 3F6TA 3B6GB 3B6FD 3AFAB 5B0ZD 3REKC 5B1LA 1Z2CB 3AZIA 5AV5A 3AZJB 3LZ1A 5B2JA 3X1TA 1N1JB 3WA9B 5AVBD 2YFVB 3AZHC 1F66B 4EO5B 2HIOB 3UTAC 4H9RA 5DNNB 4G92B 5AY8C 1M19B 1B67A 5GXQB 3C1BB 5BO0A 4J8VB 3B0BA 3AZID 5CPID 3VH5A 3LZ1D 1U35C 1P3AC 2BYKB 2NZDD 1P3IB 1P3GA 4G91B 4CAYB 4CSRB 5B32C 3MGPB 3REHA 5DNMA 3TU4C 2F2AC 2VQRA 4NE5A 5KDMA 5B31G 3W98C 1M1AD 5FUGB 1EQZC 2F8NH 3AZFB 4WU8C 1HQ3B 1ZLAC 5AV9A 3B6GD 3A1KA 3AFAD 2Y2KA 2DQNC 4H9SA 5DNNA 3AZNC 4J8XC 3AV1A 1JFIB 3REHD 3B6FC 2F8NB 3KUYA 5GXQA 4J8VA 5B0ZC 1P3BB 5CPJB 2BYKA 3WA9D 4H9PA 1TAFB 4R8PA 1F66D 4CSRA 4XZQA 5AV9D 5CPKB 2BYMB 4NE3A 5AVBC 1KX3B 2Y2QA 5DNND 4H9NB 2ZM5A 1M19D 3LJAA 1KX4B 5GXQD 3C1BD 4J8VD 5F99B 2Y2LA 2Y2NA 3AV2A 5CPIC 4XZQD 3MGPD 3AZIC 3LZ1C 2NZDC 5GT3B 3LELA 3W99B 4Z66B 3AZEA 3H0LC 4E44A 3AZFD 4WJ3C 2ZY4A 1S32A 2BYMA 1M1AC 2RVQD 2F8ND 3B6GC 3O62A 3AFAC 3LELD 1P3BD 3MNNA 4AWLB 3REHC 4DQYB 2ZY3A 5CPKD 3WA9C 1P3PA 3B0DB 1F66C 4EO5C 5GT0A 5E5AB 5BS7A 3X1UB 5AV9C 5B24B 1KX4D 5DNNC 4WZSB 3UTBA 3MNND 5F99D 4G92C 1ID3A 1M19C 5GXQC 3C1BC 4J8VC 5BNXA 4X23B 2Y2OA 1P34A 4G91C 5GT3D 1KX5B 4XZQC 4Z66D 3MGPC 4KHAA 2FJ7B 2DF4C 3UTBD 3H0RC 3AYWB 3WTPA 3AZFC 2Y2PA 2RVQC 3VH6T 5CHLB 4WU9A 3LELC 1P3BC 3NQJA 3REIA 5B1MB 3W97B 5B31A 5JRGA 1P3MA 5B33A 5E5AD 3X1UD 5CPKC 2FJ7A 5B1LB 5B24D 3MGQA 3AZLA 5AV5B 3X1SA 3LZ1B 4WU9D 5B2JB 3X1TB 3KSYA 1KX4C 3MNNC 5F99C 4X23D 3C1CA 5JRGD 3AL0C 4H9RB 1KX5D 1P3MD 2BG1A 5B33D 2FJ7D 4QLCA 3UT9A 5GT3C 5BO0B 1TZYA 1M18A 5GT0C 4Z66C 5B1MA 4Z2MG 3AYWD 1P3GB 4UUZA 4Z5TA 2L5AA 3UTBC 3REHB 3KWQA 5DNMB 2FFFB 5KDMB 2RIQA 1Q9CA 3V9RA 3UT9D 2F8NK 3W97D 5B1MD 5AV9B 2UWXA 4AWLC 5B0YC 1W2EA 3AV1B 3IP4C 3MGSA 2XD5A 3W96B 5B1LD 5JA4B 3KUYB 1BH9A 3B0DC 5AV5D 5E5AC 5B2JD 3X1UC 3X1TD 5B24C 4H9PB 4R8PB 2ZY5A 4XZQB 3WAAA 4WU9C 3X1VA 1F1EA 5BNVA 5AVCA 4X23C 3LJAB 4DRAA 5JRGC 1KX5C 2Y2MA 1P3MC 5B33C 2AROA 2FJ7C 1P3GD 3AV2B 3A6NA 3W96A 3WAAD 2CV5A 5DNMD 5JA4A 4YM6A 3AYWC 3LELB 3WKJA 3FDDA 3AZEB 1B6WA 1S32B 3VH6A 3UT9C 3AV1D 3W97C 5B1MC 3W96D 3A1IA 3O62B 3KUYD 5GSUA 3EPKA 3WKJD 3MNNB 2G5IC 5B1LC 5B0YB 4R8PD 5AV5C 4Z2MH 2NQBA 2Y2GA 5B2JC 3X1TC 1P3PB 4J8WA 1P3OB 5B2IA 5GT0B 3AZMA 5AV8A 3RELB 4JJNA 3LJAD 1P3FA 5AV6B 3UTBB 1ID3B 3AV2D 5BNXB 2NQBD 1WWIA 1P34B 1P3GC 3MGRA 3AZMD 3WAAC 4KHAB 5AV8D 5DNMC 5B0YA 3AZED 1S32D 3WTPB 2PYOA 1P3OA 2J8PA 1BFMA 4LD9A 1P3LA 3WTPE 3RELA 3AZKB 5AV6A 3O62D 2YFWA 4H9SC 4J8UA 3MGRD 3AV1C 4WU9B 3W96C 4DRBA 5B0YD 3KUYC 2W8SA 3NQJB 2JSSA 3REIB 3WKJC 4ZBJB 5B31B 1P3PD 3B0CW 5JRGB 1P3OD 4R8PC 5GT0D 5B33B 1P3MB 3EPLA 3RELD 2Y2JA 5AV6D 3MGQB 3KXBB 3AZLB 5B40A 3X1SB 5CP6A 1ID3D 3LJAC 3REJA 3VH5T 1AOIA 3AZKA 3C1CB 1P34D 3AV2C 4XUJA 2NQBC 3REKA 4QLCB 3UT9B 1TZYB 5B40D 1M18B 3AZMC 3EG5B 5AV8C 3AN2B 3REJD 3AZEC 3WTPD 4UUZB 1S32C 4Z5TB 3KWQB 3AZKD 3UTAA 3KXBA 3EPHA 4XUJD 4ZUXA 5AY8A 3V9RB 5G49A 3O62C 1H3OA 3VH5W 3MGRC 3REID 1U35A 5B31D 2JCHA
chains in the Genus database with same CATH topology
5B32A 3MGSB 1P3PC 3MGQD 3KXBD 1BH9B 3AZLD 1P3OC 3W98A 3X1SD 5BS7C 3AN2A 3RELC 4ZUXD 2G5HC 5AV6C 1EQZA 2LY8A 3WAAB 4WU8A 1ZLAA 3C1CD 3X1VB 1ID3C 4KUDB 3AZNA 3B6FA 4J8XA 5BNVB 5AVCB 4QLCD 4WNNA 1P34C 1TZYD 1M18D 5B0ZA 2AROB 3AN2D 1ULYA 5CPJA 5B40C 4Z5TD 3A6NB 1R4VA 3KWQD 2CV5B 3REJC 4YM6B 3WTPC 3NQUA 3WKJB 3AZKC 3P5JB 3R45A 4KGCB 4XUJC 1WWSA 3LZ0B 5CPJD 4KUDA 5CPIA 3REIC 3MGSD 3AZGB 4ZBJC 5B31C 2NZDA 5GSUB 3EPJA 2CWEA 4YS3B 3MGQC 3KXBC 3AZLC 3X1SC 2NQBB 4ZUXC 2IO5C 3X1VD 1M1AA 4KUDD 4J8WB 1BH8A 3MVDB 5B2IB 3AZMB 4HGAB 1PZRA 5AV8B 4JJNB 5B32G 5AVCD 1HTAA 3C1CC 1P3FB 3B6GA 4KGCA 3AFAA 2AROD 3LZ0A 4QLCC 1TZYC 1M18C 5BT1D 3A6ND 3AZJA 3AN2C 2CV5D 3AZGA 1N1JA 4YM6D 3WA9A 2YFVA 1F66A 1P3KB 3MGRB 4Z5TC 4YS3A 3KWQC 2HIOA 2IO5B 4KGCD 3LZ0D 1M19A 2PYOB 3MVDA 4LD9B 3C1BA 1P3LB 2JE5A 3H0MC 3AZJD 3AZGD 5CPJC 1P3IA 2YFWB 5C3IC 5GSUD 4H9QB 4J8UB 4CAYA 3MGPA 3MGSC 4YS3D 2HIOD 3B0CT 4J8WD 3KFUG 5FUGA 3MVDD 5B2ID 1P3KA 3AZFA 1HQ3A 4JJND 3X1VC 1P3FD 1P3ID 2HUEB 4KUDC 5B40B 5CP6B 1JFIA 5AVCC 3REJB 2F8NA 1P3BA 2AROC 1AOIB 4H9QA 1TAFA 1P3KD 5BT1C 4XUJB 3A6NC 3REKB 1HQ3D 2CV5C 5CPKA 4YM6C 1KX3A 4H9NA 1A7WA 2XD1A 2PYOD 4H9OB 3AZHB 1KX4A 4KGCC 1P3LD 4LD9D 3LZ0C 5F99A 3UTAB 4M6BA 4J8UD 4ZUXB 5AY8B 3AZJC 5G49B 3AZGC 1H3OB 4WV4B 5GSUC 1KX3D 1T3UA 5GT3A 2Y2IA 1U35B 1P3AB 4Z66A 4YS3C 3W99A 2HIOC 5B32B 2ZY2A 3TU4B 4J8WC 3MVDC 3W98B 5B2IC 4HGAC 5CP6D 4JJNC 1P3FC 1P3IC 1EQZB 4H9OA 3AZHA 2Y2HA 4WU8B 3W99D 1AOID 1ZLAB 3AZNB 3B6FB 4J8XB 3REKD 4WNNB 5B0ZB 1P3KC 1P3AA 5E5AA 1HQ3C 3X1UA 5C3IB 5B24A 3AZHD 2F8NG 4UPKA 3UTAD 3TU4A 5AVBB 2PYOC 3NQUB 4LD9C 1P3LC 5AY8D 4X23A 3R45B 4J8UC 1KX5A 1U35D 1P3AD 4NE6A 1KX3C 5CPIB 5B32D 3AZIB 2NZDB 3TU4D 3AYWA 3W98D 2HUEC 1EQZD 4WU8D 1ZLAD 3VH6W 5CP6C 1M1AB 5AVBA 1BH8B 3AZND 4NFTA 4E45A 4J8XD 3W97A 1KU5A 3W99C 1AOIC 3F6TA 3B6GB 3B6FD 3AFAB 5B0ZD 3REKC 5B1LA 1Z2CB 3AZIA 5AV5A 3AZJB 3LZ1A 5B2JA 3X1TA 1N1JB 3WA9B 5AVBD 2YFVB 3AZHC 1F66B 4EO5B 2HIOB 3UTAC 4H9RA 5DNNB 4G92B 5AY8C 1M19B 1B67A 5GXQB 3C1BB 5BO0A 4J8VB 3B0BA 3AZID 5CPID 3VH5A 3LZ1D 1U35C 1P3AC 2BYKB 2NZDD 1P3IB 1P3GA 4G91B 4CAYB 4CSRB 5B32C 3MGPB 3REHA 5DNMA 3TU4C 2F2AC 2VQRA 4NE5A 5KDMA 5B31G 3W98C 1M1AD 5FUGB 1EQZC 2F8NH 3AZFB 4WU8C 1HQ3B 1ZLAC 5AV9A 3B6GD 3A1KA 3AFAD 2Y2KA 2DQNC 4H9SA 5DNNA 3AZNC 4J8XC 3AV1A 1JFIB 3REHD 3B6FC 2F8NB 3KUYA 5GXQA 4J8VA 5B0ZC 1P3BB 5CPJB 2BYKA 3WA9D 4H9PA 1TAFB 4R8PA 1F66D 4CSRA 4XZQA 5AV9D 5CPKB 2BYMB 4NE3A 5AVBC 1KX3B 2Y2QA 5DNND 4H9NB 2ZM5A 1M19D 3LJAA 1KX4B 5GXQD 3C1BD 4J8VD 5F99B 2Y2LA 2Y2NA 3AV2A 5CPIC 4XZQD 3MGPD 3AZIC 3LZ1C 2NZDC 5GT3B 3LELA 3W99B 4Z66B 3AZEA 3H0LC 4E44A 3AZFD 4WJ3C 2ZY4A 1S32A 2BYMA 1M1AC 2RVQD 2F8ND 3B6GC 3O62A 3AFAC 3LELD 1P3BD 3MNNA 4AWLB 3REHC 4DQYB 2ZY3A 5CPKD 3WA9C 1P3PA 3B0DB 1F66C 4EO5C 5GT0A 5E5AB 5BS7A 3X1UB 5AV9C 5B24B 1KX4D 5DNNC 4WZSB 3UTBA 3MNND 5F99D 4G92C 1ID3A 1M19C 5GXQC 3C1BC 4J8VC 5BNXA 4X23B 2Y2OA 1P34A 4G91C 5GT3D 1KX5B 4XZQC 4Z66D 3MGPC 4KHAA 2FJ7B 2DF4C 3UTBD 3H0RC 3AYWB 3WTPA 3AZFC 2Y2PA 2RVQC 3VH6T 5CHLB 4WU9A 3LELC 1P3BC 3NQJA 3REIA 5B1MB 3W97B 5B31A 5JRGA 1P3MA 5B33A 5E5AD 3X1UD 5CPKC 2FJ7A 5B1LB 5B24D 3MGQA 3AZLA 5AV5B 3X1SA 3LZ1B 4WU9D 5B2JB 3X1TB 3KSYA 1KX4C 3MNNC 5F99C 4X23D 3C1CA 5JRGD 3AL0C 4H9RB 1KX5D 1P3MD 2BG1A 5B33D 2FJ7D 4QLCA 3UT9A 5GT3C 5BO0B 1TZYA 1M18A 5GT0C 4Z66C 5B1MA 4Z2MG 3AYWD 1P3GB 4UUZA 4Z5TA 2L5AA 3UTBC 3REHB 3KWQA 5DNMB 2FFFB 5KDMB 2RIQA 1Q9CA 3V9RA 3UT9D 2F8NK 3W97D 5B1MD 5AV9B 2UWXA 4AWLC 5B0YC 1W2EA 3AV1B 3IP4C 3MGSA 2XD5A 3W96B 5B1LD 5JA4B 3KUYB 1BH9A 3B0DC 5AV5D 5E5AC 5B2JD 3X1UC 3X1TD 5B24C 4H9PB 4R8PB 2ZY5A 4XZQB 3WAAA 4WU9C 3X1VA 1F1EA 5BNVA 5AVCA 4X23C 3LJAB 4DRAA 5JRGC 1KX5C 2Y2MA 1P3MC 5B33C 2AROA 2FJ7C 1P3GD 3AV2B 3A6NA 3W96A 3WAAD 2CV5A 5DNMD 5JA4A 4YM6A 3AYWC 3LELB 3WKJA 3FDDA 3AZEB 1B6WA 1S32B 3VH6A 3UT9C 3AV1D 3W97C 5B1MC 3W96D 3A1IA 3O62B 3KUYD 5GSUA 3EPKA 3WKJD 3MNNB 2G5IC 5B1LC 5B0YB 4R8PD 5AV5C 4Z2MH 2NQBA 2Y2GA 5B2JC 3X1TC 1P3PB 4J8WA 1P3OB 5B2IA 5GT0B 3AZMA 5AV8A 3RELB 4JJNA 3LJAD 1P3FA 5AV6B 3UTBB 1ID3B 3AV2D 5BNXB 2NQBD 1WWIA 1P34B 1P3GC 3MGRA 3AZMD 3WAAC 4KHAB 5AV8D 5DNMC 5B0YA 3AZED 1S32D 3WTPB 2PYOA 1P3OA 2J8PA 1BFMA 4LD9A 1P3LA 3WTPE 3RELA 3AZKB 5AV6A 3O62D 2YFWA 4H9SC 4J8UA 3MGRD 3AV1C 4WU9B 3W96C 4DRBA 5B0YD 3KUYC 2W8SA 3NQJB 2JSSA 3REIB 3WKJC 4ZBJB 5B31B 1P3PD 3B0CW 5JRGB 1P3OD 4R8PC 5GT0D 5B33B 1P3MB 3EPLA 3RELD 2Y2JA 5AV6D 3MGQB 3KXBB 3AZLB 5B40A 3X1SB 5CP6A 1ID3D 3LJAC 3REJA 3VH5T 1AOIA 3AZKA 3C1CB 1P34D 3AV2C 4XUJA 2NQBC 3REKA 4QLCB 3UT9B 1TZYB 5B40D 1M18B 3AZMC 3EG5B 5AV8C 3AN2B 3REJD 3AZEC 3WTPD 4UUZB 1S32C 4Z5TB 3KWQB 3AZKD 3UTAA 3KXBA 3EPHA 4XUJD 4ZUXA 5AY8A 3V9RB 5G49A 3O62C 1H3OA 3VH5W 3MGRC 3REID 1U35A 5B31D 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 A;  3MGS B;  1P3P C;  3MGQ D;  3KXB D;  1BH9 B;  3AZL D;  1P3O C;  3W98 A;  3X1S D;  5BS7 C;  3AN2 A;  3REL C;  4ZUX D;  5AV6 C;  1EQZ A;  2LY8 A;  3WAA B;  4WU8 A;  1ZLA A;  3C1C D;  3X1V B;  1ID3 C;  4KUD B;  3AZN A;  3B6F A;  4J8X A;  5BNV B;  5AVC B;  4QLC D;  4WNN A;  1P34 C;  1TZY D;  1M18 D;  5B0Z A;  2ARO B;  3AN2 D;  1ULY A;  5CPJ A;  5B40 C;  4Z5T D;  3A6N B;  1R4V A;  3KWQ D;  2CV5 B;  3REJ C;  4YM6 B;  3WTP C;  3NQU A;  3WKJ B;  3AZK C;  3R45 A;  4KGC B;  4XUJ C;  1WWS A;  3LZ0 B;  5CPJ D;  4KUD A;  5CPI A;  3REI C;  3MGS D;  3AZG B;  4ZBJ C;  5B31 C;  2NZD A;  5GSU B;  2CWE A;  4YS3 B;  3MGQ C;  3KXB C;  3AZL C;  3X1S C;  2NQB B;  4ZUX C;  2IO5 C;  3X1V D;  1M1A A;  4KUD D;  4J8W B;  1BH8 A;  3MVD B;  5B2I B;  3AZM B;  4HGA B;  5AV8 B;  4JJN B;  5B32 G;  5AVC D;  1HTA A;  3C1C C;  1P3F B;  3B6G A;  4KGC A;  3AFA A;  2ARO D;  3LZ0 A;  4QLC C;  1TZY C;  1M18 C;  5BT1 D;  3A6N D;  3AZJ A;  3AN2 C;  2CV5 D;  3AZG A;  1N1J A;  4YM6 D;  3WA9 A;  2YFV A;  1F66 A;  1P3K B;  3MGR B;  4Z5T C;  4YS3 A;  3KWQ C;  2HIO A;  2IO5 B;  4KGC D;  3LZ0 D;  1M19 A;  2PYO B;  3MVD A;  4LD9 B;  3C1B A;  1P3L B;  3AZJ D;  3AZG D;  5CPJ C;  1P3I A;  2YFW B;  5C3I C;  5GSU D;  4H9Q B;  4J8U B;  4CAY A;  3MGP A;  3MGS C;  4YS3 D;  2HIO D;  3B0C T;  4J8W D;  5FUG A;  3MVD D;  5B2I D;  1P3K A;  3AZF A;  1HQ3 A;  4JJN D;  3X1V C;  1P3F D;  1P3I D;  2HUE B;  4KUD C;  5B40 B;  5CP6 B;  1JFI A;  5AVC C;  3REJ B;  2F8N A;  1P3B A;  2ARO C;  1AOI B;  4H9Q A;  1TAF A;  1P3K D;  5BT1 C;  4XUJ B;  3A6N C;  3REK B;  1HQ3 D;  2CV5 C;  5CPK A;  4YM6 C;  1KX3 A;  4H9N A;  1A7W A;  2PYO D;  4H9O B;  3AZH B;  1KX4 A;  4KGC C;  1P3L D;  4LD9 D;  3LZ0 C;  5F99 A;  3UTA B;  4M6B A;  4J8U D;  4ZUX B;  5AY8 B;  3AZJ C;  5G49 B;  3AZG C;  1H3O B;  4WV4 B;  5GSU C;  1KX3 D;  5GT3 A;  1U35 B;  1P3A B;  4Z66 A;  4YS3 C;  3W99 A;  2HIO C;  5B32 B;  3TU4 B;  4J8W C;  3MVD C;  3W98 B;  5B2I C;  4HGA C;  5CP6 D;  4JJN C;  1P3F C;  1P3I C;  1EQZ B;  4H9O A;  3AZH A;  4WU8 B;  3W99 D;  1AOI D;  1ZLA B;  3AZN B;  3B6F B;  4J8X B;  3REK D;  4WNN B;  5B0Z B;  1P3K C;  1P3A A;  5E5A A;  1HQ3 C;  3X1U A;  5C3I B;  5B24 A;  3AZH D;  2F8N G;  3UTA D;  3TU4 A;  5AVB B;  2PYO C;  3NQU B;  4LD9 C;  1P3L C;  5AY8 D;  4X23 A;  3R45 B;  4J8U C;  1KX5 A;  1U35 D;  1P3A D;  4NE6 A;  1KX3 C;  5CPI B;  5B32 D;  3AZI B;  2NZD B;  3TU4 D;  3AYW A;  3W98 D;  2HUE C;  1EQZ D;  4WU8 D;  1ZLA D;  3VH6 W;  5CP6 C;  1M1A B;  5AVB A;  1BH8 B;  3AZN D;  4NFT A;  4E45 A;  4J8X D;  3W97 A;  1KU5 A;  3W99 C;  1AOI C;  3B6F D;  3B6G B;  3AFA B;  5B0Z D;  3REK C;  5B1L A;  3AZI A;  5AV5 A;  3AZJ B;  3LZ1 A;  5B2J A;  3X1T A;  1N1J B;  3WA9 B;  5AVB D;  2YFV B;  3AZH C;  1F66 B;  4EO5 B;  2HIO B;  3UTA C;  4H9R A;  5DNN B;  4G92 B;  5AY8 C;  1M19 B;  1B67 A;  5GXQ B;  3C1B B;  5BO0 A;  4J8V B;  3B0B A;  3AZI D;  5CPI D;  3VH5 A;  3LZ1 D;  1U35 C;  1P3A C;  2BYK B;  2NZD D;  1P3I B;  1P3G A;  4G91 B;  4CAY B;  4CSR B;  5B32 C;  3MGP B;  3REH A;  5DNM A;  3TU4 C;  4NE5 A;  5KDM A;  5B31 G;  3W98 C;  1M1A D;  5FUG B;  1EQZ C;  2F8N H;  3AZF B;  4WU8 C;  1HQ3 B;  1ZLA C;  5AV9 A;  3B6G D;  3AFA D;  4H9S A;  5DNN A;  3AZN C;  1JFI B;  4J8X C;  3AV1 A;  3B6F C;  3REH D;  2F8N B;  3KUY A;  5GXQ A;  4J8V A;  5B0Z C;  1P3B B;  5CPJ B;  2BYK A;  3WA9 D;  4H9P A;  1TAF B;  4R8P A;  1F66 D;  4CSR A;  4XZQ A;  5AV9 D;  5CPK B;  2BYM B;  4NE3 A;  5AVB C;  1KX3 B;  5DNN D;  4H9N B;  1M19 D;  3LJA A;  1KX4 B;  5GXQ D;  3C1B D;  4J8V D;  5F99 B;  3AV2 A;  5CPI C;  4XZQ D;  3MGP D;  3AZI C;  3LZ1 C;  2NZD C;  5GT3 B;  3LEL A;  3W99 B;  4Z66 B;  3AZE A;  4E44 A;  3AZF D;  1S32 A;  2BYM A;  1M1A C;  2RVQ D;  2F8N D;  3B6G C;  3O62 A;  3AFA C;  3LEL D;  1P3B D;  3MNN A;  4AWL B;  3REH C;  5CPK D;  3WA9 C;  1P3P A;  3B0D B;  1F66 C;  4EO5 C;  5GT0 A;  5E5A B;  5BS7 A;  3X1U B;  5AV9 C;  5B24 B;  1KX4 D;  5DNN C;  4WZS B;  3UTB A;  3MNN D;  5F99 D;  4G92 C;  1ID3 A;  1M19 C;  5GXQ C;  3C1B C;  4J8V C;  5BNX A;  4X23 B;  1P34 A;  4G91 C;  5GT3 D;  1KX5 B;  4XZQ C;  4Z66 D;  3MGP C;  4KHA A;  2FJ7 B;  3UTB D;  3AYW B;  3WTP A;  3AZF C;  2RVQ C;  3VH6 T;  5CHL B;  4WU9 A;  3LEL C;  1P3B C;  3NQJ A;  3REI A;  5B1M B;  3W97 B;  5B31 A;  5JRG A;  1P3M A;  5B33 A;  5E5A D;  3X1U D;  5CPK C;  2FJ7 A;  5B1L B;  5B24 D;  3MGQ A;  3AZL A;  5AV5 B;  3X1S A;  3LZ1 B;  4WU9 D;  5B2J B;  3X1T B;  3KSY A;  1KX4 C;  3MNN C;  5F99 C;  4X23 D;  3C1C A;  5JRG D;  4H9R B;  1KX5 D;  1P3M D;  5B33 D;  2FJ7 D;  4QLC A;  3UT9 A;  5GT3 C;  5BO0 B;  1TZY A;  1M18 A;  5GT0 C;  4Z66 C;  5B1M A;  4Z2M G;  3AYW D;  1P3G B;  4UUZ A;  4Z5T A;  2L5A A;  3UTB C;  3REH B;  3KWQ A;  5DNM B;  5KDM B;  1Q9C A;  3V9R A;  3UT9 D;  2F8N K;  3W97 D;  5B1M D;  5AV9 B;  4AWL C;  5B0Y C;  3AV1 B;  3MGS A;  3W96 B;  5B1L D;  5JA4 B;  3KUY B;  1BH9 A;  3B0D C;  5AV5 D;  5E5A C;  3X1U C;  3X1T D;  5B2J D;  5B24 C;  4H9P B;  4R8P B;  4XZQ B;  3WAA A;  4WU9 C;  3X1V A;  1F1E A;  5BNV A;  5AVC A;  4X23 C;  3LJA B;  4DRA A;  5JRG C;  1KX5 C;  1P3M C;  5B33 C;  2ARO A;  2FJ7 C;  1P3G D;  3AV2 B;  3A6N A;  3W96 A;  3WAA D;  2CV5 A;  5DNM D;  5JA4 A;  4YM6 A;  3AYW C;  3LEL B;  3WKJ A;  3AZE B;  1B6W A;  1S32 B;  3VH6 A;  3UT9 C;  3AV1 D;  3W97 C;  5B1M C;  3W96 D;  3O62 B;  3KUY D;  5GSU A;  3WKJ D;  3MNN B;  5B1L C;  5B0Y B;  4R8P D;  5AV5 C;  4Z2M H;  2NQB A;  5B2J C;  3X1T C;  1P3P B;  4J8W A;  1P3O B;  5B2I A;  5GT0 B;  3AZM A;  5AV8 A;  3REL B;  4JJN A;  3LJA D;  1P3F A;  5AV6 B;  3UTB B;  1ID3 B;  3AV2 D;  5BNX B;  2NQB D;  1WWI A;  1P34 B;  1P3G C;  3MGR A;  3AZM D;  3WAA C;  4KHA B;  5AV8 D;  5DNM C;  5B0Y A;  3AZE D;  1S32 D;  3WTP B;  2PYO A;  1P3O A;  1BFM A;  4LD9 A;  1P3L A;  3WTP E;  3REL A;  3AZK B;  5AV6 A;  3O62 D;  2YFW A;  4H9S C;  4J8U A;  3MGR D;  3AV1 C;  4WU9 B;  3W96 C;  4DRB A;  5B0Y D;  3KUY C;  3NQJ B;  2JSS A;  3REI B;  3WKJ C;  4ZBJ B;  5B31 B;  1P3P D;  3B0C W;  5JRG B;  1P3O D;  4R8P C;  5GT0 D;  5B33 B;  1P3M B;  3REL D;  5AV6 D;  3MGQ B;  3KXB B;  3AZL B;  5B40 A;  3X1S B;  5CP6 A;  1ID3 D;  3LJA C;  3REJ A;  3VH5 T;  1AOI A;  3AZK A;  3C1C B;  1P34 D;  3AV2 C;  4XUJ A;  2NQB C;  3REK A;  4QLC B;  3UT9 B;  1TZY B;  5B40 D;  1M18 B;  3AZM C;  3AN2 B;  5AV8 C;  3REJ D;  3AZE C;  3WTP D;  4UUZ B;  1S32 C;  4Z5T B;  3KWQ B;  3AZK D;  3UTA A;  3KXB A;  4XUJ D;  4ZUX A;  5AY8 A;  3V9R B;  5G49 A;  3O62 C;  1H3O A;  3VH5 W;  3MGR C;  3REI D;  1U35 A;  5B31 D; 
#chains in the Genus database with same CATH topology
 5B32 A;  3MGS B;  1P3P C;  3MGQ D;  3KXB D;  1BH9 B;  3AZL D;  1P3O C;  3W98 A;  3X1S D;  5BS7 C;  3AN2 A;  3REL C;  4ZUX D;  2G5H C;  5AV6 C;  1EQZ A;  2LY8 A;  3WAA B;  4WU8 A;  1ZLA A;  3C1C D;  3X1V B;  1ID3 C;  4KUD B;  3AZN A;  3B6F A;  4J8X A;  5BNV B;  5AVC B;  4QLC D;  4WNN A;  1P34 C;  1TZY D;  1M18 D;  5B0Z A;  2ARO B;  3AN2 D;  1ULY A;  5CPJ A;  5B40 C;  4Z5T D;  3A6N B;  1R4V A;  3KWQ D;  2CV5 B;  3REJ C;  4YM6 B;  3WTP C;  3NQU A;  3WKJ B;  3AZK C;  3P5J B;  3R45 A;  4KGC B;  4XUJ C;  1WWS A;  3LZ0 B;  5CPJ D;  4KUD A;  5CPI A;  3REI C;  3MGS D;  3AZG B;  4ZBJ C;  5B31 C;  2NZD A;  5GSU B;  3EPJ A;  2CWE A;  4YS3 B;  3MGQ C;  3KXB C;  3AZL C;  3X1S C;  2NQB B;  4ZUX C;  2IO5 C;  3X1V D;  1M1A A;  4KUD D;  4J8W B;  1BH8 A;  3MVD B;  5B2I B;  3AZM B;  4HGA B;  1PZR A;  5AV8 B;  4JJN B;  5B32 G;  5AVC D;  1HTA A;  3C1C C;  1P3F B;  3B6G A;  4KGC A;  3AFA A;  2ARO D;  3LZ0 A;  4QLC C;  1TZY C;  1M18 C;  5BT1 D;  3A6N D;  3AZJ A;  3AN2 C;  2CV5 D;  3AZG A;  1N1J A;  4YM6 D;  3WA9 A;  2YFV A;  1F66 A;  1P3K B;  3MGR B;  4Z5T C;  4YS3 A;  3KWQ C;  2HIO A;  2IO5 B;  4KGC D;  3LZ0 D;  1M19 A;  2PYO B;  3MVD A;  4LD9 B;  3C1B A;  1P3L B;  2JE5 A;  3H0M C;  3AZJ D;  3AZG D;  5CPJ C;  1P3I A;  2YFW B;  5C3I C;  5GSU D;  4H9Q B;  4J8U B;  4CAY A;  3MGP A;  3MGS C;  4YS3 D;  2HIO D;  3B0C T;  4J8W D;  3KFU G;  5FUG A;  3MVD D;  5B2I D;  1P3K A;  3AZF A;  1HQ3 A;  4JJN D;  3X1V C;  1P3F D;  1P3I D;  2HUE B;  4KUD C;  5B40 B;  5CP6 B;  1JFI A;  5AVC C;  3REJ B;  2F8N A;  1P3B A;  2ARO C;  1AOI B;  4H9Q A;  1TAF A;  1P3K D;  5BT1 C;  4XUJ B;  3A6N C;  3REK B;  1HQ3 D;  2CV5 C;  5CPK A;  4YM6 C;  1KX3 A;  4H9N A;  1A7W A;  2XD1 A;  2PYO D;  4H9O B;  3AZH B;  1KX4 A;  4KGC C;  1P3L D;  4LD9 D;  3LZ0 C;  5F99 A;  3UTA B;  4M6B A;  4J8U D;  4ZUX B;  5AY8 B;  3AZJ C;  5G49 B;  3AZG C;  1H3O B;  4WV4 B;  5GSU C;  1KX3 D;  1T3U A;  5GT3 A;  2Y2I A;  1U35 B;  1P3A B;  4Z66 A;  4YS3 C;  3W99 A;  2HIO C;  5B32 B;  2ZY2 A;  3TU4 B;  4J8W C;  3MVD C;  3W98 B;  5B2I C;  4HGA C;  5CP6 D;  4JJN C;  1P3F C;  1P3I C;  1EQZ B;  4H9O A;  3AZH A;  2Y2H A;  4WU8 B;  3W99 D;  1AOI D;  1ZLA B;  3AZN B;  3B6F B;  4J8X B;  3REK D;  4WNN B;  5B0Z B;  1P3K C;  1P3A A;  5E5A A;  1HQ3 C;  3X1U A;  5C3I B;  5B24 A;  3AZH D;  2F8N G;  4UPK A;  3UTA D;  3TU4 A;  5AVB B;  2PYO C;  3NQU B;  4LD9 C;  1P3L C;  5AY8 D;  4X23 A;  3R45 B;  4J8U C;  1KX5 A;  1U35 D;  1P3A D;  4NE6 A;  1KX3 C;  5CPI B;  5B32 D;  3AZI B;  2NZD B;  3TU4 D;  3AYW A;  3W98 D;  2HUE C;  1EQZ D;  4WU8 D;  1ZLA D;  3VH6 W;  5CP6 C;  1M1A B;  5AVB A;  1BH8 B;  3AZN D;  4NFT A;  4E45 A;  4J8X D;  3W97 A;  1KU5 A;  3W99 C;  1AOI C;  3F6T A;  3B6G B;  3B6F D;  3AFA B;  5B0Z D;  3REK C;  5B1L A;  1Z2C B;  3AZI A;  5AV5 A;  3AZJ B;  3LZ1 A;  5B2J A;  3X1T A;  1N1J B;  3WA9 B;  5AVB D;  2YFV B;  3AZH C;  1F66 B;  4EO5 B;  2HIO B;  3UTA C;  4H9R A;  5DNN B;  4G92 B;  5AY8 C;  1M19 B;  1B67 A;  5GXQ B;  3C1B B;  5BO0 A;  4J8V B;  3B0B A;  3AZI D;  5CPI D;  3VH5 A;  3LZ1 D;  1U35 C;  1P3A C;  2BYK B;  2NZD D;  1P3I B;  1P3G A;  4G91 B;  4CAY B;  4CSR B;  5B32 C;  3MGP B;  3REH A;  5DNM A;  3TU4 C;  2F2A C;  2VQR A;  4NE5 A;  5KDM A;  5B31 G;  3W98 C;  1M1A D;  5FUG B;  1EQZ C;  2F8N H;  3AZF B;  4WU8 C;  1HQ3 B;  1ZLA C;  5AV9 A;  3B6G D;  3A1K A;  3AFA D;  2Y2K A;  2DQN C;  4H9S A;  5DNN A;  3AZN C;  4J8X C;  3AV1 A;  1JFI B;  3REH D;  3B6F C;  2F8N B;  3KUY A;  5GXQ A;  4J8V A;  5B0Z C;  1P3B B;  5CPJ B;  2BYK A;  3WA9 D;  4H9P A;  1TAF B;  4R8P A;  1F66 D;  4CSR A;  4XZQ A;  5AV9 D;  5CPK B;  2BYM B;  4NE3 A;  5AVB C;  1KX3 B;  2Y2Q A;  5DNN D;  4H9N B;  2ZM5 A;  1M19 D;  3LJA A;  1KX4 B;  5GXQ D;  3C1B D;  4J8V D;  5F99 B;  2Y2L A;  2Y2N A;  3AV2 A;  5CPI C;  4XZQ D;  3MGP D;  3AZI C;  3LZ1 C;  2NZD C;  5GT3 B;  3LEL A;  3W99 B;  4Z66 B;  3AZE A;  3H0L C;  4E44 A;  3AZF D;  4WJ3 C;  2ZY4 A;  1S32 A;  2BYM A;  1M1A C;  2RVQ D;  2F8N D;  3B6G C;  3O62 A;  3AFA C;  3LEL D;  1P3B D;  3MNN A;  4AWL B;  3REH C;  4DQY B;  2ZY3 A;  5CPK D;  3WA9 C;  1P3P A;  3B0D B;  1F66 C;  4EO5 C;  5GT0 A;  5E5A B;  5BS7 A;  3X1U B;  5AV9 C;  5B24 B;  1KX4 D;  5DNN C;  4WZS B;  3UTB A;  3MNN D;  5F99 D;  4G92 C;  1ID3 A;  1M19 C;  5GXQ C;  3C1B C;  4J8V C;  5BNX A;  4X23 B;  2Y2O A;  1P34 A;  4G91 C;  5GT3 D;  1KX5 B;  4XZQ C;  4Z66 D;  3MGP C;  4KHA A;  2FJ7 B;  2DF4 C;  3UTB D;  3H0R C;  3AYW B;  3WTP A;  3AZF C;  2Y2P A;  2RVQ C;  3VH6 T;  5CHL B;  4WU9 A;  3LEL C;  1P3B C;  3NQJ A;  3REI A;  5B1M B;  3W97 B;  5B31 A;  5JRG A;  1P3M A;  5B33 A;  5E5A D;  3X1U D;  5CPK C;  2FJ7 A;  5B1L B;  5B24 D;  3MGQ A;  3AZL A;  5AV5 B;  3X1S A;  3LZ1 B;  4WU9 D;  5B2J B;  3X1T B;  3KSY A;  1KX4 C;  3MNN C;  5F99 C;  4X23 D;  3C1C A;  5JRG D;  3AL0 C;  4H9R B;  1KX5 D;  1P3M D;  2BG1 A;  5B33 D;  2FJ7 D;  4QLC A;  3UT9 A;  5GT3 C;  5BO0 B;  1TZY A;  1M18 A;  5GT0 C;  4Z66 C;  5B1M A;  4Z2M G;  3AYW D;  1P3G B;  4UUZ A;  4Z5T A;  2L5A A;  3UTB C;  3REH B;  3KWQ A;  5DNM B;  2FFF B;  5KDM B;  2RIQ A;  1Q9C A;  3V9R A;  3UT9 D;  2F8N K;  3W97 D;  5B1M D;  5AV9 B;  2UWX A;  4AWL C;  5B0Y C;  1W2E A;  3AV1 B;  3IP4 C;  3MGS A;  2XD5 A;  3W96 B;  5B1L D;  5JA4 B;  3KUY B;  1BH9 A;  3B0D C;  5AV5 D;  5E5A C;  5B2J D;  3X1U C;  3X1T D;  5B24 C;  4H9P B;  4R8P B;  2ZY5 A;  4XZQ B;  3WAA A;  4WU9 C;  3X1V A;  1F1E A;  5BNV A;  5AVC A;  4X23 C;  3LJA B;  4DRA A;  5JRG C;  1KX5 C;  2Y2M A;  1P3M C;  5B33 C;  2ARO A;  2FJ7 C;  1P3G D;  3AV2 B;  3A6N A;  3W96 A;  3WAA D;  2CV5 A;  5DNM D;  5JA4 A;  4YM6 A;  3AYW C;  3LEL B;  3WKJ A;  3FDD A;  3AZE B;  1B6W A;  1S32 B;  3VH6 A;  3UT9 C;  3AV1 D;  3W97 C;  5B1M C;  3W96 D;  3A1I A;  3O62 B;  3KUY D;  5GSU A;  3EPK A;  3WKJ D;  3MNN B;  2G5I C;  5B1L C;  5B0Y B;  4R8P D;  5AV5 C;  4Z2M H;  2NQB A;  2Y2G A;  5B2J C;  3X1T C;  1P3P B;  4J8W A;  1P3O B;  5B2I A;  5GT0 B;  3AZM A;  5AV8 A;  3REL B;  4JJN A;  3LJA D;  1P3F A;  5AV6 B;  3UTB B;  1ID3 B;  3AV2 D;  5BNX B;  2NQB D;  1WWI A;  1P34 B;  1P3G C;  3MGR A;  3AZM D;  3WAA C;  4KHA B;  5AV8 D;  5DNM C;  5B0Y A;  3AZE D;  1S32 D;  3WTP B;  2PYO A;  1P3O A;  2J8P A;  1BFM A;  4LD9 A;  1P3L A;  3WTP E;  3REL A;  3AZK B;  5AV6 A;  3O62 D;  2YFW A;  4H9S C;  4J8U A;  3MGR D;  3AV1 C;  4WU9 B;  3W96 C;  4DRB A;  5B0Y D;  3KUY C;  2W8S A;  3NQJ B;  2JSS A;  3REI B;  3WKJ C;  4ZBJ B;  5B31 B;  1P3P D;  3B0C W;  5JRG B;  1P3O D;  4R8P C;  5GT0 D;  5B33 B;  1P3M B;  3EPL A;  3REL D;  2Y2J A;  5AV6 D;  3MGQ B;  3KXB B;  3AZL B;  5B40 A;  3X1S B;  5CP6 A;  1ID3 D;  3LJA C;  3REJ A;  3VH5 T;  1AOI A;  3AZK A;  3C1C B;  1P34 D;  3AV2 C;  4XUJ A;  2NQB C;  3REK A;  4QLC B;  3UT9 B;  1TZY B;  5B40 D;  1M18 B;  3AZM C;  3EG5 B;  5AV8 C;  3AN2 B;  3REJ D;  3AZE C;  3WTP D;  4UUZ B;  1S32 C;  4Z5T B;  3KWQ B;  3AZK D;  3UTA A;  3KXB A;  3EPH A;  4XUJ D;  4ZUX A;  5AY8 A;  3V9R B;  5G49 A;  3O62 C;  1H3O A;  3VH5 W;  3MGR C;  3REI D;  1U35 A;  5B31 D;  2JCH A; 
#chains in the Genus database with same CATH homology
 5B32 A;  3MGS B;  1P3P C;  3MGQ D;  3KXB D;  1BH9 B;  3AZL D;  1P3O C;  3W98 A;  3X1S D;  5BS7 C;  3AN2 A;  3REL C;  4ZUX D;  2G5H C;  5AV6 C;  1EQZ A;  2LY8 A;  3WAA B;  4WU8 A;  1ZLA A;  3C1C D;  3X1V B;  1ID3 C;  4KUD B;  3AZN A;  3B6F A;  4J8X A;  5BNV B;  5AVC B;  4QLC D;  4WNN A;  1P34 C;  1TZY D;  1M18 D;  5B0Z A;  2ARO B;  3AN2 D;  1ULY A;  5CPJ A;  5B40 C;  4Z5T D;  3A6N B;  1R4V A;  3KWQ D;  2CV5 B;  3REJ C;  4YM6 B;  3WTP C;  3NQU A;  3WKJ B;  3AZK C;  3P5J B;  3R45 A;  4KGC B;  4XUJ C;  1WWS A;  3LZ0 B;  5CPJ D;  4KUD A;  5CPI A;  3REI C;  3MGS D;  3AZG B;  4ZBJ C;  5B31 C;  2NZD A;  5GSU B;  3EPJ A;  2CWE A;  4YS3 B;  3MGQ C;  3KXB C;  3AZL C;  3X1S C;  2NQB B;  4ZUX C;  2IO5 C;  3X1V D;  1M1A A;  4KUD D;  4J8W B;  1BH8 A;  3MVD B;  5B2I B;  3AZM B;  4HGA B;  1PZR A;  5AV8 B;  4JJN B;  5B32 G;  5AVC D;  1HTA A;  3C1C C;  1P3F B;  3B6G A;  4KGC A;  3AFA A;  2ARO D;  3LZ0 A;  4QLC C;  1TZY C;  1M18 C;  5BT1 D;  3A6N D;  3AZJ A;  3AN2 C;  2CV5 D;  3AZG A;  1N1J A;  4YM6 D;  3WA9 A;  2YFV A;  1F66 A;  1P3K B;  3MGR B;  4Z5T C;  4YS3 A;  3KWQ C;  2HIO A;  2IO5 B;  4KGC D;  3LZ0 D;  1M19 A;  2PYO B;  3MVD A;  4LD9 B;  3C1B A;  1P3L B;  2JE5 A;  3H0M C;  3AZJ D;  3AZG D;  5CPJ C;  1P3I A;  2YFW B;  5C3I C;  5GSU D;  4H9Q B;  4J8U B;  4CAY A;  3MGP A;  3MGS C;  4YS3 D;  2HIO D;  3B0C T;  4J8W D;  3KFU G;  5FUG A;  3MVD D;  5B2I D;  1P3K A;  3AZF A;  1HQ3 A;  4JJN D;  3X1V C;  1P3F D;  1P3I D;  2HUE B;  4KUD C;  5B40 B;  5CP6 B;  1JFI A;  5AVC C;  3REJ B;  2F8N A;  1P3B A;  2ARO C;  1AOI B;  4H9Q A;  1TAF A;  1P3K D;  5BT1 C;  4XUJ B;  3A6N C;  3REK B;  1HQ3 D;  2CV5 C;  5CPK A;  4YM6 C;  1KX3 A;  4H9N A;  1A7W A;  2XD1 A;  2PYO D;  4H9O B;  3AZH B;  1KX4 A;  4KGC C;  1P3L D;  4LD9 D;  3LZ0 C;  5F99 A;  3UTA B;  4M6B A;  4J8U D;  4ZUX B;  5AY8 B;  3AZJ C;  5G49 B;  3AZG C;  1H3O B;  4WV4 B;  5GSU C;  1KX3 D;  1T3U A;  5GT3 A;  2Y2I A;  1U35 B;  1P3A B;  4Z66 A;  4YS3 C;  3W99 A;  2HIO C;  5B32 B;  2ZY2 A;  3TU4 B;  4J8W C;  3MVD C;  3W98 B;  5B2I C;  4HGA C;  5CP6 D;  4JJN C;  1P3F C;  1P3I C;  1EQZ B;  4H9O A;  3AZH A;  2Y2H A;  4WU8 B;  3W99 D;  1AOI D;  1ZLA B;  3AZN B;  3B6F B;  4J8X B;  3REK D;  4WNN B;  5B0Z B;  1P3K C;  1P3A A;  5E5A A;  1HQ3 C;  3X1U A;  5C3I B;  5B24 A;  3AZH D;  2F8N G;  4UPK A;  3UTA D;  3TU4 A;  5AVB B;  2PYO C;  3NQU B;  4LD9 C;  1P3L C;  5AY8 D;  4X23 A;  3R45 B;  4J8U C;  1KX5 A;  1U35 D;  1P3A D;  4NE6 A;  1KX3 C;  5CPI B;  5B32 D;  3AZI B;  2NZD B;  3TU4 D;  3AYW A;  3W98 D;  2HUE C;  1EQZ D;  4WU8 D;  1ZLA D;  3VH6 W;  5CP6 C;  1M1A B;  5AVB A;  1BH8 B;  3AZN D;  4NFT A;  4E45 A;  4J8X D;  3W97 A;  1KU5 A;  3W99 C;  1AOI C;  3F6T A;  3B6G B;  3B6F D;  3AFA B;  5B0Z D;  3REK C;  5B1L A;  1Z2C B;  3AZI A;  5AV5 A;  3AZJ B;  3LZ1 A;  5B2J A;  3X1T A;  1N1J B;  3WA9 B;  5AVB D;  2YFV B;  3AZH C;  1F66 B;  4EO5 B;  2HIO B;  3UTA C;  4H9R A;  5DNN B;  4G92 B;  5AY8 C;  1M19 B;  1B67 A;  5GXQ B;  3C1B B;  5BO0 A;  4J8V B;  3B0B A;  3AZI D;  5CPI D;  3VH5 A;  3LZ1 D;  1U35 C;  1P3A C;  2BYK B;  2NZD D;  1P3I B;  1P3G A;  4G91 B;  4CAY B;  4CSR B;  5B32 C;  3MGP B;  3REH A;  5DNM A;  3TU4 C;  2F2A C;  2VQR A;  4NE5 A;  5KDM A;  5B31 G;  3W98 C;  1M1A D;  5FUG B;  1EQZ C;  2F8N H;  3AZF B;  4WU8 C;  1HQ3 B;  1ZLA C;  5AV9 A;  3B6G D;  3A1K A;  3AFA D;  2Y2K A;  2DQN C;  4H9S A;  5DNN A;  3AZN C;  4J8X C;  3AV1 A;  1JFI B;  3REH D;  3B6F C;  2F8N B;  3KUY A;  5GXQ A;  4J8V A;  5B0Z C;  1P3B B;  5CPJ B;  2BYK A;  3WA9 D;  4H9P A;  1TAF B;  4R8P A;  1F66 D;  4CSR A;  4XZQ A;  5AV9 D;  5CPK B;  2BYM B;  4NE3 A;  5AVB C;  1KX3 B;  2Y2Q A;  5DNN D;  4H9N B;  2ZM5 A;  1M19 D;  3LJA A;  1KX4 B;  5GXQ D;  3C1B D;  4J8V D;  5F99 B;  2Y2L A;  2Y2N A;  3AV2 A;  5CPI C;  4XZQ D;  3MGP D;  3AZI C;  3LZ1 C;  2NZD C;  5GT3 B;  3LEL A;  3W99 B;  4Z66 B;  3AZE A;  3H0L C;  4E44 A;  3AZF D;  4WJ3 C;  2ZY4 A;  1S32 A;  2BYM A;  1M1A C;  2RVQ D;  2F8N D;  3B6G C;  3O62 A;  3AFA C;  3LEL D;  1P3B D;  3MNN A;  4AWL B;  3REH C;  4DQY B;  2ZY3 A;  5CPK D;  3WA9 C;  1P3P A;  3B0D B;  1F66 C;  4EO5 C;  5GT0 A;  5E5A B;  5BS7 A;  3X1U B;  5AV9 C;  5B24 B;  1KX4 D;  5DNN C;  4WZS B;  3UTB A;  3MNN D;  5F99 D;  4G92 C;  1ID3 A;  1M19 C;  5GXQ C;  3C1B C;  4J8V C;  5BNX A;  4X23 B;  2Y2O A;  1P34 A;  4G91 C;  5GT3 D;  1KX5 B;  4XZQ C;  4Z66 D;  3MGP C;  4KHA A;  2FJ7 B;  2DF4 C;  3UTB D;  3H0R C;  3AYW B;  3WTP A;  3AZF C;  2Y2P A;  2RVQ C;  3VH6 T;  5CHL B;  4WU9 A;  3LEL C;  1P3B C;  3NQJ A;  3REI A;  5B1M B;  3W97 B;  5B31 A;  5JRG A;  1P3M A;  5B33 A;  5E5A D;  3X1U D;  5CPK C;  2FJ7 A;  5B1L B;  5B24 D;  3MGQ A;  3AZL A;  5AV5 B;  3X1S A;  3LZ1 B;  4WU9 D;  5B2J B;  3X1T B;  3KSY A;  1KX4 C;  3MNN C;  5F99 C;  4X23 D;  3C1C A;  5JRG D;  3AL0 C;  4H9R B;  1KX5 D;  1P3M D;  2BG1 A;  5B33 D;  2FJ7 D;  4QLC A;  3UT9 A;  5GT3 C;  5BO0 B;  1TZY A;  1M18 A;  5GT0 C;  4Z66 C;  5B1M A;  4Z2M G;  3AYW D;  1P3G B;  4UUZ A;  4Z5T A;  2L5A A;  3UTB C;  3REH B;  3KWQ A;  5DNM B;  2FFF B;  5KDM B;  2RIQ A;  1Q9C A;  3V9R A;  3UT9 D;  2F8N K;  3W97 D;  5B1M D;  5AV9 B;  2UWX A;  4AWL C;  5B0Y C;  1W2E A;  3AV1 B;  3IP4 C;  3MGS A;  2XD5 A;  3W96 B;  5B1L D;  5JA4 B;  3KUY B;  1BH9 A;  3B0D C;  5AV5 D;  5E5A C;  5B2J D;  3X1U C;  3X1T D;  5B24 C;  4H9P B;  4R8P B;  2ZY5 A;  4XZQ B;  3WAA A;  4WU9 C;  3X1V A;  1F1E A;  5BNV A;  5AVC A;  4X23 C;  3LJA B;  4DRA A;  5JRG C;  1KX5 C;  2Y2M A;  1P3M C;  5B33 C;  2ARO A;  2FJ7 C;  1P3G D;  3AV2 B;  3A6N A;  3W96 A;  3WAA D;  2CV5 A;  5DNM D;  5JA4 A;  4YM6 A;  3AYW C;  3LEL B;  3WKJ A;  3FDD A;  3AZE B;  1B6W A;  1S32 B;  3VH6 A;  3UT9 C;  3AV1 D;  3W97 C;  5B1M C;  3W96 D;  3A1I A;  3O62 B;  3KUY D;  5GSU A;  3EPK A;  3WKJ D;  3MNN B;  2G5I C;  5B1L C;  5B0Y B;  4R8P D;  5AV5 C;  4Z2M H;  2NQB A;  2Y2G A;  5B2J C;  3X1T C;  1P3P B;  4J8W A;  1P3O B;  5B2I A;  5GT0 B;  3AZM A;  5AV8 A;  3REL B;  4JJN A;  3LJA D;  1P3F A;  5AV6 B;  3UTB B;  1ID3 B;  3AV2 D;  5BNX B;  2NQB D;  1WWI A;  1P34 B;  1P3G C;  3MGR A;  3AZM D;  3WAA C;  4KHA B;  5AV8 D;  5DNM C;  5B0Y A;  3AZE D;  1S32 D;  3WTP B;  2PYO A;  1P3O A;  2J8P A;  1BFM A;  4LD9 A;  1P3L A;  3WTP E;  3REL A;  3AZK B;  5AV6 A;  3O62 D;  2YFW A;  4H9S C;  4J8U A;  3MGR D;  3AV1 C;  4WU9 B;  3W96 C;  4DRB A;  5B0Y D;  3KUY C;  2W8S A;  3NQJ B;  2JSS A;  3REI B;  3WKJ C;  4ZBJ B;  5B31 B;  1P3P D;  3B0C W;  5JRG B;  1P3O D;  4R8P C;  5GT0 D;  5B33 B;  1P3M B;  3EPL A;  3REL D;  2Y2J A;  5AV6 D;  3MGQ B;  3KXB B;  3AZL B;  5B40 A;  3X1S B;  5CP6 A;  1ID3 D;  3LJA C;  3REJ A;  3VH5 T;  1AOI A;  3AZK A;  3C1C B;  1P34 D;  3AV2 C;  4XUJ A;  2NQB C;  3REK A;  4QLC B;  3UT9 B;  1TZY B;  5B40 D;  1M18 B;  3AZM C;  3EG5 B;  5AV8 C;  3AN2 B;  3REJ D;  3AZE C;  3WTP D;  4UUZ B;  1S32 C;  4Z5T B;  3KWQ B;  3AZK D;  3UTA A;  3KXB A;  3EPH A;  4XUJ D;  4ZUX A;  5AY8 A;  3V9R B;  5G49 A;  3O62 C;  1H3O A;  3VH5 W;  3MGR C;  3REI D;  1U35 A;  5B31 D;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...