1P3OD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oD00
3MGPD 3C1CB 4Z66C 5JA4A 2NZDA 3WAAA 5BNXB 4J8XC 1KX5C 4XZQC 5CPIB 3X1SC 3LJAB 1M19D 4R8PC 4CAYB 3MGSC 3UTAB 5GSUD 5AV5C 3AZKB 3W99A 4H9QA 4NE3A 3AYWB 1P3OB 3VH6A 5B31C 5FUGA 2CV5A 5B32D 1KU5A 4WU9A 3B6GD 3KXBD 5B40D 1S32D 4H9PB 4JJNC 4QLCC 1BH8A 3AZLB 1H3OA 3X1UD 5B1MD 3AZHD 1P34A 1P3LB 3KUYA 1M18A 5B24B 5GT3A 5DNND 3RELC 3MGRC 2F8ND 5DNMC 1HQ3B 4WU8C 5KDMA 3MNNC 5B1LD 1TZYC 5F99A 5C3IC 3X1TD 4J8VC 3NQUA 4J8UD 5GT0B 5E5AB 4NE6A 1BH9B 3O62A 1ZLAA 5GXQA 4J8WD 4H9SA 3AZNC 4WZSB 4WV4B 3W97D 3AZIA 3MVDC 1P3FD 5B33D 1M1AD 2YFVA 4LD9D 3C1CD 4YM6C 3AZGA 4M6BA 4H9OB 3AZEC 3AV2A 3X1VC 5B2JB 3TU4B 1KX5A 4J8XA 5CPID 4XZQA 5CPJC 2HIOB 3X1SA 3LJAD 3W98C 3LELB 5AY8B 3UTAD 2BYKA 3AZKD 4R8PA 3MGSA 2LY8A 5AV5A 3REHB 3AYWD 1P3OD 4WNNA 3LZ0C 3AV1B 5B31A 5BO0B 3B6FA 3AN2C 1WWSA 3REJB 1Q9CA 3MGPB 4YS3C 2IO5C 3WAAC 2NZDC 1P3BB 3B0CW 3AFAC 1JFIA 5BT1D 4JJNA 3AZLD 4G91C 4QLCA 1P3PC 5AV8B 3AZMC 1P3LD 1U35C 3WA9B 3REIC 5B24D 1AOIB 1KX4B 3RELA 3MGRA 2YFWB 1HQ3D 5DNMA 5JA4B 4WU8A 3W96C 4X23C 3MGQC 3MNNA 1TZYA 4J8VA 4CSRA 5GT0D 2PYOB 5E5AD 3KWQC 3B0DC 1BFMA 5B40C 4KGCC 1S32C 3LZ1C 3W99B 4H9QB 3AZNA 1P3KC 5FUGB 2CV5B 3X1UC 3MVDA 4XUJC 4ZUXB 3UTBC 3WTPB 4YM6A 1BH8B 2HUEB 4HGAC 3AZEA 5B2JD 3TU4D 3X1VA 1EQZC 1H3OB 2AROB 1P34B 3KUYB 2HIOD 4NE5A 4J8UC 3LELD 5AY8D 5CPJA 2NQBC 3W98A 1F1EA 3VH5W 5B0YB 3REHD 3C1BC 5KDMB 3AZJC 3AV1D 5F99B 3LZ0A 4H9NA 3REJD 5JRGB 3AN2A 5CPKA 3AV2C 4YS3A 1KX3C 1P3BD 3O62B 1ZLAB 3AZFC 3AFAA 3C1CC 4H9RB 5AV8D 1P3PA 3WA9D 3AZMA 3AZIB 1U35A 1AOID 3REIA 1KX4D 3B6FC 5BNVB 3AZGB 1M19A 4Z66B 3VH6T 5GSUA 3W96A 4X23A 3MGQA 1KX5B 2PYOD 3X1SB 4KUDB 3KWQA 4Z5TC 3KXBA 2BYKB 5B2IC 4R8PB 5B40A 3W99D 3MGSB 1S32A 5AV5B 4KGCA 3LZ1A 2CV5D 5B31B 1P3KA 3X1UA 5B24C 4XUJA 4ZUXD 1JFIB 3WTPD 3UTBA 4JJNB 2F8NA 3WKJC 1A7WA 4EO5C 4QLCB 1P3GC 4G92C 5G49B 2FJ7C 2AROD 1P34D 3KUYD 1P3MC 1M18D 1EQZA 1P3IC 4J8UA 2NQBA 3RELB 3MGRB 5B0YD 5DNMB 5AVCB 4WU8B 3REKC 5AVBC 3C1BA 5F99D 3MNNB 3AZJA 1TZYB 5C3IB 5AV9C 1ULYA 5JRGD 5B0ZB 5B32G 3O62D 5B33A 1KX3A 1ZLAD 1N1JA 4ZBJC 1M1AA 3AZFA 4LD9B 3C1CA 4LD9A 3A6NC 2RVQD 5CP6C 3AZID 1P3AC 3UT9C 3MVDB 2HIOC 1F66C 1ID3C 1WWIA 3LJAA 3AZGD 4Z66D 4YM6B 4CAYA 3UTAA 5CPKC 5AV6C 2F8NG 1P3OA 1KX5D 4XZQD 3X1SD 3MGPC 4KUDD 5CPJB 3W98B 4R8PD 4Z5TA 3MGSD 5AV5D 4UUZA 3R45B 5B2IA 3AZLA 5B31D 5CHLB 3LZ0B 1M19C 3AN2B 2BYMA 5GSUC 2IO5B 4YS3B 3WAAB 2NZDB 5B24A 1KX4C 3AFAB 4JJND 4QLCD 5B32C 3WKJA 3B6GC 1P3GA 1P3PB 3KXBC 2FJ7A 1U35B 1P3MA 2PYOC 3REIB 1P3IA 2F8NH 3RELD 3MGRD 5DNMD 5AVCD 4WU8D 4Z2MH 3MNND 5B1MC 3REKA 3MGQB 4X23B 5AVBA 1TZYD 3AZHC 4WU9B 3W96B 5DNNC 5AV9A 5B0ZD 3KWQB 3B0DB 5B1LC 4ZUXC 3X1TC 4KGCB 1M18B 3LZ1B 5GT3B 3A6NA 1P3KB 5CP6A 2AROC 3MVDD 1P3AA 3UT9A 2HIOA 4J8WC 4XUJB 4AWLC 1F66A 5AY8A 1ID3A 4YM6D 3UTBB 3NQUB 3W97C 4DRBA 5AV6A 1P3FC 5B33C 1EQZB 1M1AC 4LD9C 3B0CT 5GXQB 5CPJD 3MGPA 3W98D 2NQBB 3WTPE 3C1BB 5CPIC 3AZJB 4DRAA 3LZ0D 3LJAC 2YFVB 3AN2D 3UTAC 4YS3D 2NZDD 3WAAD 3AZKC 3AV2B 3AYWC 1KX3B 1P3OC 1N1JB 3AFAD 1KX4A 2YFWA 4J8XB 3AZFB 4XZQB 5B32A 1P3PD 3B6GA 3AZMD 1U35D 3REID 2PYOA 5BT1C 4KUDC 3AZLC 4WNNB 4E45A 3B6FB 4KHAA 4WU9D 1P3LC 3MGQD 4X23D 3W96D 5BS7C 3AZHA 5B1MA 3NQJA 5DNNA 1TAFA 1HQ3C 3KWQD 4KGCD 4Z5TB 5B1LA 4UUZB 5B2IB 4ZUXA 3X1TA 3LZ1D 2CWEA 3WTPA 5GT0C 5GT3D 5E5AC 1P3KD 3VH5A 2AROA 2BYMB 3VH5T 4XUJD 4J8WA 3V9RA 3UTBD 4J8VB 4CSRB 5B0YA 5AVCC 3WKJB 3W97A 4EO5B 1P3GB 4G92B 1P3FA 1EQZD 5GXQD 2FJ7B 1P3MB 5JRGA 1P3IB 2NQBD 5B0ZC 3AZNB 5B2JC 3TU4C 5BNXA 3C1BD 3KSYA 3REKB 3AZJD 5AVBB 5CPIA 3LELC 4H9RA 5AY8C 3B0BA 5AV9B 1M1AB 3AV2D 3REHC 1KX3D 3AZKA 3AZEB 3AYWA 3AZFD 4J8XD 3AV1C 4ZBJB 3X1VB 5BNVA 2L5AA 4Z66A 3REJC 4Z2MG 3A6NB 5CP6B 1P3BC 4H9PA 1P3AB 3UT9B 2JSSA 4KUDA 1F66B 1ID3B 3B6FD 5AV8C 1B6WA 4H9NB 3WA9C 1P3LA 5CPKB 1AOIC 5AV6B 5BS7A 1HQ3A 4G91B 4Z5TD 5B2ID 3AZMB 5GT0A 5E5AA 5G49A 1BH9A 1M19B 3W99C 1R4VA 5GSUB 4J8VD 2CV5C 3VH6W 3WKJD 4WU9C 1P3GD 5B32B 5AVCA 3B6GB 1HTAA 2FJ7D 3KXBB 1P3MD 5B40B 1P3ID 3WTPC 1S32B 3AZND 2HUEC 4H9OA 5B0ZA 4KHAB 5B2JA 3TU4A 3REKD 1P34C 1M18C 5AVBD 3KUYC 3AZHB 3X1UB 5B1MB 5GT3C 2F8NK 3NQJB 5AV9D 3LELA 5DNNB 1TAFB 5B31G 5B0YC 2F8NB 3AZED 3REHA 3X1VD 5F99C 4E44A 4HGAB 5B1LB 3AV1A 3X1TB 5BO0A 5JRGC 1B67A 3A6ND 3REJA 4J8UB 5CP6D 3O62C 1P3AD 1ZLAC 3UT9D 1P3BA 5GXQC 4H9SC 1F66D 1ID3D 4AWLB 4J8WB 3V9RB 4NFTA 2RVQC 5AV8A 3R45A 3AZIC 5AV6D 5CPKD 3W97B 3WA9A 1AOIA 1P3FB 5B33B 3AZGC
chains in the Genus database with same CATH superfamily
3MGPD 3C1CB 4Z66C 5JA4A 2NZDA 3WAAA 4WJ3C 5BNXB 4J8XC 1KX5C 4XZQC 3IP4C 5CPIB 3X1SC 3LJAB 1M19D 4R8PC 4CAYB 3MGSC 3UTAB 5GSUD 5AV5C 3AZKB 3W99A 4H9QA 4NE3A 3AYWB 1P3OB 3VH6A 5B31C 5FUGA 2CV5A 5B32D 1KU5A 4WU9A 3B6GD 3KXBD 5B40D 1T3UA 4H9PB 1S32D 4JJNC 4QLCC 1BH8A 3AZLB 1H3OA 3X1UD 5B1MD 3AZHD 1P34A 1P3LB 3KUYA 1M18A 5B24B 5GT3A 5DNND 3RELC 3MGRC 2F8ND 5DNMC 1HQ3B 4WU8C 5KDMA 3MNNC 2Y2MA 5B1LD 1TZYC 5F99A 5C3IC 3X1TD 4J8VC 3NQUA 4J8UD 5GT0B 5E5AB 4NE6A 1BH9B 3O62A 1ZLAA 5GXQA 4J8WD 4H9SA 3AZNC 4WZSB 4WV4B 3W97D 3AZIA 3MVDC 1P3FD 5B33D 1M1AD 2YFVA 4LD9D 3C1CD 4YM6C 3AZGA 3AL0C 4M6BA 4H9OB 3AZEC 3AV2A 3X1VC 5B2JB 3TU4B 2DF4C 4J8XA 1KX5A 5CPID 4XZQA 2FFFB 5CPJC 2HIOB 3X1SA 3LJAD 3W98C 3LELB 5AY8B 3UTAD 2BYKA 3AZKD 2Y2OA 4R8PA 3MGSA 2LY8A 5AV5A 3REHB 3AYWD 1P3OD 4WNNA 3LZ0C 3AV1B 5B31A 5BO0B 3B6FA 3AN2C 1WWSA 4UPKA 1Q9CA 3MGPB 4YS3C 2IO5C 3WAAC 3REJB 2NZDC 1P3BB 3B0CW 3AFAC 1JFIA 5BT1D 4JJNA 3AZLD 4G91C 4QLCA 1P3PC 2ZY4A 5AV8B 3AZMC 1P3LD 1U35C 3WA9B 3REIC 5B24D 1AOIB 1KX4B 3RELA 3MGRA 2YFWB 1HQ3D 5DNMA 5JA4B 4WU8A 2Y2KA 2Y2GA 3W96C 4X23C 3MGQC 3MNNA 1TZYA 4J8VA 3EPKA 4CSRA 5GT0D 2PYOB 5E5AD 3KWQC 3EPLA 3B0DC 1BFMA 5B40C 4KGCC 1S32C 3LZ1C 3W99B 4H9QB 2Y2QA 3AZNA 1P3KC 2F2AC 5FUGB 2CV5B 3X1UC 3MVDA 4XUJC 2G5IC 4ZUXB 3UTBC 3WTPB 4YM6A 1BH8B 2HUEB 4HGAC 3AZEA 3EPHA 5B2JD 3TU4D 3X1VA 1EQZC 1H3OB 2AROB 1P34B 3KUYB 2HIOD 4NE5A 4J8UC 3LELD 5AY8D 2BG1A 5CPJA 2NQBC 3W98A 1F1EA 2VQRA 3VH5W 5B0YB 3REHD 3C1BC 5KDMB 3H0LC 3AZJC 3AV1D 5F99B 3KFUG 3LZ0A 4H9NA 3REJD 5JRGB 3AN2A 5CPKA 3AV2C 4YS3A 1KX3C 1P3BD 3O62B 1ZLAB 3AZFC 3AFAA 3C1CC 2Y2LA 4H9RB 5AV8D 1P3PA 3WA9D 3AZMA 3AZIB 1U35A 1AOID 3REIA 1KX4D 3B6FC 5BNVB 3AZGB 1M19A 4Z66B 3VH6T 5GSUA 1W2EA 3W96A 4X23A 3MGQA 1KX5B 2PYOD 3X1SB 3H0MC 4KUDB 3KWQA 4Z5TC 3KXBA 2BYKB 5B2IC 5B40A 4R8PB 3W99D 3MGSB 2ZM5A 5AV5B 1S32A 4KGCA 3A1KA 3LZ1A 2CV5D 5B31B 1P3KA 3X1UA 2UWXA 5B24C 4XUJA 4ZUXD 1JFIB 3WTPD 3UTBA 4JJNB 2F8NA 2Y2HA 3WKJC 1A7WA 4EO5C 4QLCB 1P3GC 4G92C 5G49B 2FJ7C 2AROD 1P34D 3KUYD 1P3MC 1M18D 1EQZA 1P3IC 4J8UA 2NQBA 3RELB 3MGRB 5B0YD 5DNMB 1Z2CB 5AVCB 4WU8B 3REKC 5AVBC 3C1BA 5F99D 3MNNB 3AZJA 1TZYB 5C3IB 5AV9C 1ULYA 5JRGD 5B0ZB 2ZY3A 5B32G 5B33A 3O62D 1KX3A 1N1JA 1ZLAD 4ZBJC 1M1AA 3AZFA 4LD9B 3C1CA 4LD9A 3A6NC 2RVQD 5CP6C 3AZID 1P3AC 3UT9C 3MVDB 2HIOC 2DQNC 1F66C 1ID3C 1WWIA 3LJAA 3AZGD 4Z66D 4YM6B 4CAYA 3UTAA 3EPJA 5CPKC 5AV6C 2F8NG 1P3OA 1KX5D 4XZQD 1PZRA 3X1SD 3MGPC 4KUDD 5CPJB 3W98B 4R8PD 4Z5TA 3MGSD 5AV5D 4UUZA 3R45B 5B2IA 3AZLA 5B31D 4DQYB 5CHLB 3LZ0B 1M19C 3AN2B 2BYMA 5GSUC 2IO5B 4YS3B 3WAAB 2NZDB 5B24A 1KX4C 3AFAB 4JJND 4QLCD 5B32C 3WKJA 3B6GC 1P3GA 1P3PB 3KXBC 2FJ7A 1U35B 1P3MA 2PYOC 3REIB 1P3IA 2F8NH 3RELD 3MGRD 5DNMD 5AVCD 4WU8D 4Z2MH 3MNND 5B1MC 3REKA 3MGQB 4X23B 5AVBA 1TZYD 3AZHC 4WU9B 3W96B 2W8SA 5DNNC 5AV9A 3F6TA 5B0ZD 3KWQB 3B0DB 5B1LC 4ZUXC 3X1TC 4KGCB 1M18B 3LZ1B 2Y2IA 5GT3B 3A6NA 1P3KB 5CP6A 2AROC 3MVDD 1P3AA 3UT9A 2HIOA 4J8WC 4XUJB 4AWLC 1F66A 5AY8A 1ID3A 4YM6D 3UTBB 2Y2JA 3NQUB 3W97C 4DRBA 5AV6A 1P3FC 5B33C 1EQZB 2RIQA 1M1AC 4LD9C 2XD5A 3B0CT 5GXQB 5CPJD 3MGPA 3W98D 2NQBB 3WTPE 3C1BB 5CPIC 3AZJB 4DRAA 3LZ0D 3LJAC 2YFVB 3AN2D 3UTAC 4YS3D 2NZDD 3WAAD 3AZKC 3AV2B 3EG5B 3AYWC 1KX3B 1P3OC 1N1JB 3AFAD 1KX4A 2YFWA 4J8XB 3AZFB 4XZQB 5B32A 1P3PD 3B6GA 3AZMD 1U35D 3REID 2PYOA 5BT1C 4KUDC 3AZLC 4WNNB 4E45A 3B6FB 4KHAA 4WU9D 1P3LC 3MGQD 4X23D 3W96D 5BS7C 3AZHA 2Y2PA 5B1MA 3NQJA 5DNNA 1TAFA 1HQ3C 2J8PA 3KWQD 4KGCD 4Z5TB 5B1LA 4UUZB 5B2IB 4ZUXA 3X1TA 3LZ1D 2CWEA 3WTPA 5GT0C 5GT3D 5E5AC 1P3KD 3VH5A 2AROA 2BYMB 3VH5T 4XUJD 2XD1A 4J8WA 3V9RA 3UTBD 4J8VB 4CSRB 5B0YA 5AVCC 3WKJB 3W97A 2G5HC 4EO5B 1P3GB 4G92B 1P3FA 1EQZD 5GXQD 2FJ7B 1P3MB 5JRGA 1P3IB 2NQBD 5B0ZC 3AZNB 5B2JC 3TU4C 5BNXA 3C1BD 3KSYA 3REKB 3AZJD 5AVBB 5CPIA 3LELC 4H9RA 5AY8C 3B0BA 5AV9B 1M1AB 3AV2D 3REHC 1KX3D 3AZKA 2JCHA 3AZEB 3AYWA 3AZFD 4J8XD 3AV1C 4ZBJB 3X1VB 5BNVA 2L5AA 4Z66A 3REJC 4Z2MG 3A6NB 5CP6B 1P3BC 4H9PA 1P3AB 3UT9B 2Y2NA 2JSSA 4KUDA 1F66B 1ID3B 3B6FD 5AV8C 1B6WA 4H9NB 3P5JB 3WA9C 1P3LA 3A1IA 5CPKB 1AOIC 5AV6B 5BS7A 2ZY2A 1HQ3A 4G91B 4Z5TD 5B2ID 3AZMB 5GT0A 5E5AA 5G49A 1BH9A 1M19B 3W99C 1R4VA 5GSUB 4J8VD 2CV5C 3VH6W 2ZY5A 3WKJD 4WU9C 1P3GD 5B32B 5AVCA 3B6GB 1HTAA 2FJ7D 3KXBB 1P3MD 5B40B 1P3ID 3WTPC 1S32B 3AZND 2HUEC 4H9OA 5B0ZA 4KHAB 5B2JA 3TU4A 3REKD 1P34C 1M18C 5AVBD 3KUYC 3AZHB 3X1UB 5B1MB 5GT3C 2F8NK 3NQJB 5AV9D 3LELA 5DNNB 1TAFB 3H0RC 5B31G 5B0YC 2F8NB 3AZED 3REHA 3X1VD 5F99C 4E44A 4HGAB 5B1LB 3AV1A 3X1TB 5BO0A 5JRGC 1B67A 2JE5A 3A6ND 3REJA 4J8UB 5CP6D 3O62C 1P3AD 1ZLAC 3UT9D 1P3BA 5GXQC 3FDDA 4H9SC 1F66D 1ID3D 4AWLB 4J8WB 3V9RB 4NFTA 2RVQC 5AV8A 3R45A 3AZIC 5AV6D 5CPKD 3W97B 3WA9A 1AOIA 1P3FB 5B33B 3AZGC
chains in the Genus database with same CATH topology
3MGPD 3C1CB 4Z66C 5JA4A 2NZDA 3WAAA 4WJ3C 5BNXB 4J8XC 1KX5C 4XZQC 3IP4C 5CPIB 3X1SC 3LJAB 1M19D 4R8PC 4CAYB 3MGSC 3UTAB 5GSUD 5AV5C 3AZKB 3W99A 4H9QA 4NE3A 3AYWB 1P3OB 3VH6A 5B31C 5FUGA 2CV5A 5B32D 1KU5A 4WU9A 3B6GD 3KXBD 5B40D 1T3UA 4H9PB 1S32D 4JJNC 4QLCC 1BH8A 3AZLB 1H3OA 3X1UD 5B1MD 3AZHD 1P34A 1P3LB 3KUYA 1M18A 5B24B 5GT3A 5DNND 3RELC 3MGRC 2F8ND 5DNMC 1HQ3B 4WU8C 5KDMA 3MNNC 2Y2MA 5B1LD 1TZYC 5F99A 5C3IC 3X1TD 4J8VC 3NQUA 4J8UD 5GT0B 5E5AB 4NE6A 1BH9B 3O62A 1ZLAA 5GXQA 4J8WD 4H9SA 3AZNC 4WZSB 4WV4B 3W97D 3AZIA 3MVDC 1P3FD 5B33D 1M1AD 2YFVA 4LD9D 3C1CD 4YM6C 3AZGA 3AL0C 4M6BA 4H9OB 3AZEC 3AV2A 3X1VC 5B2JB 3TU4B 2DF4C 4J8XA 1KX5A 5CPID 4XZQA 2FFFB 5CPJC 2HIOB 3X1SA 3LJAD 3W98C 3LELB 5AY8B 3UTAD 2BYKA 3AZKD 2Y2OA 4R8PA 3MGSA 2LY8A 5AV5A 3REHB 3AYWD 1P3OD 4WNNA 3LZ0C 3AV1B 5B31A 5BO0B 3B6FA 3AN2C 1WWSA 4UPKA 1Q9CA 3MGPB 4YS3C 2IO5C 3WAAC 3REJB 2NZDC 1P3BB 3B0CW 3AFAC 1JFIA 5BT1D 4JJNA 3AZLD 4G91C 4QLCA 1P3PC 2ZY4A 5AV8B 3AZMC 1P3LD 1U35C 3WA9B 3REIC 5B24D 1AOIB 1KX4B 3RELA 3MGRA 2YFWB 1HQ3D 5DNMA 5JA4B 4WU8A 2Y2KA 2Y2GA 3W96C 4X23C 3MGQC 3MNNA 1TZYA 4J8VA 3EPKA 4CSRA 5GT0D 2PYOB 5E5AD 3KWQC 3EPLA 3B0DC 1BFMA 5B40C 4KGCC 1S32C 3LZ1C 3W99B 4H9QB 2Y2QA 3AZNA 1P3KC 2F2AC 5FUGB 2CV5B 3X1UC 3MVDA 4XUJC 2G5IC 4ZUXB 3UTBC 3WTPB 4YM6A 1BH8B 2HUEB 4HGAC 3AZEA 3EPHA 5B2JD 3TU4D 3X1VA 1EQZC 1H3OB 2AROB 1P34B 3KUYB 2HIOD 4NE5A 4J8UC 3LELD 5AY8D 2BG1A 5CPJA 2NQBC 3W98A 1F1EA 2VQRA 3VH5W 5B0YB 3REHD 3C1BC 5KDMB 3H0LC 3AZJC 3AV1D 5F99B 3KFUG 3LZ0A 4H9NA 3REJD 5JRGB 3AN2A 5CPKA 3AV2C 4YS3A 1KX3C 1P3BD 3O62B 1ZLAB 3AZFC 3AFAA 3C1CC 2Y2LA 4H9RB 5AV8D 1P3PA 3WA9D 3AZMA 3AZIB 1U35A 1AOID 3REIA 1KX4D 3B6FC 5BNVB 3AZGB 1M19A 4Z66B 3VH6T 5GSUA 1W2EA 3W96A 4X23A 3MGQA 1KX5B 2PYOD 3X1SB 3H0MC 4KUDB 3KWQA 4Z5TC 3KXBA 2BYKB 5B2IC 5B40A 4R8PB 3W99D 3MGSB 2ZM5A 5AV5B 1S32A 4KGCA 3A1KA 3LZ1A 2CV5D 5B31B 1P3KA 3X1UA 2UWXA 5B24C 4XUJA 4ZUXD 1JFIB 3WTPD 3UTBA 4JJNB 2F8NA 2Y2HA 3WKJC 1A7WA 4EO5C 4QLCB 1P3GC 4G92C 5G49B 2FJ7C 2AROD 1P34D 3KUYD 1P3MC 1M18D 1EQZA 1P3IC 4J8UA 2NQBA 3RELB 3MGRB 5B0YD 5DNMB 1Z2CB 5AVCB 4WU8B 3REKC 5AVBC 3C1BA 5F99D 3MNNB 3AZJA 1TZYB 5C3IB 5AV9C 1ULYA 5JRGD 5B0ZB 2ZY3A 5B32G 5B33A 3O62D 1KX3A 1N1JA 1ZLAD 4ZBJC 1M1AA 3AZFA 4LD9B 3C1CA 4LD9A 3A6NC 2RVQD 5CP6C 3AZID 1P3AC 3UT9C 3MVDB 2HIOC 2DQNC 1F66C 1ID3C 1WWIA 3LJAA 3AZGD 4Z66D 4YM6B 4CAYA 3UTAA 3EPJA 5CPKC 5AV6C 2F8NG 1P3OA 1KX5D 4XZQD 1PZRA 3X1SD 3MGPC 4KUDD 5CPJB 3W98B 4R8PD 4Z5TA 3MGSD 5AV5D 4UUZA 3R45B 5B2IA 3AZLA 5B31D 4DQYB 5CHLB 3LZ0B 1M19C 3AN2B 2BYMA 5GSUC 2IO5B 4YS3B 3WAAB 2NZDB 5B24A 1KX4C 3AFAB 4JJND 4QLCD 5B32C 3WKJA 3B6GC 1P3GA 1P3PB 3KXBC 2FJ7A 1U35B 1P3MA 2PYOC 3REIB 1P3IA 2F8NH 3RELD 3MGRD 5DNMD 5AVCD 4WU8D 4Z2MH 3MNND 5B1MC 3REKA 3MGQB 4X23B 5AVBA 1TZYD 3AZHC 4WU9B 3W96B 2W8SA 5DNNC 5AV9A 3F6TA 5B0ZD 3KWQB 3B0DB 5B1LC 4ZUXC 3X1TC 4KGCB 1M18B 3LZ1B 2Y2IA 5GT3B 3A6NA 1P3KB 5CP6A 2AROC 3MVDD 1P3AA 3UT9A 2HIOA 4J8WC 4XUJB 4AWLC 1F66A 5AY8A 1ID3A 4YM6D 3UTBB 2Y2JA 3NQUB 3W97C 4DRBA 5AV6A 1P3FC 5B33C 1EQZB 2RIQA 1M1AC 4LD9C 2XD5A 3B0CT 5GXQB 5CPJD 3MGPA 3W98D 2NQBB 3WTPE 3C1BB 5CPIC 3AZJB 4DRAA 3LZ0D 3LJAC 2YFVB 3AN2D 3UTAC 4YS3D 2NZDD 3WAAD 3AZKC 3AV2B 3EG5B 3AYWC 1KX3B 1P3OC 1N1JB 3AFAD 1KX4A 2YFWA 4J8XB 3AZFB 4XZQB 5B32A 1P3PD 3B6GA 3AZMD 1U35D 3REID 2PYOA 5BT1C 4KUDC 3AZLC 4WNNB 4E45A 3B6FB 4KHAA 4WU9D 1P3LC 3MGQD 4X23D 3W96D 5BS7C 3AZHA 2Y2PA 5B1MA 3NQJA 5DNNA 1TAFA 1HQ3C 2J8PA 3KWQD 4KGCD 4Z5TB 5B1LA 4UUZB 5B2IB 4ZUXA 3X1TA 3LZ1D 2CWEA 3WTPA 5GT0C 5GT3D 5E5AC 1P3KD 3VH5A 2AROA 2BYMB 3VH5T 4XUJD 2XD1A 4J8WA 3V9RA 3UTBD 4J8VB 4CSRB 5B0YA 5AVCC 3WKJB 3W97A 2G5HC 4EO5B 1P3GB 4G92B 1P3FA 1EQZD 5GXQD 2FJ7B 1P3MB 5JRGA 1P3IB 2NQBD 5B0ZC 3AZNB 5B2JC 3TU4C 5BNXA 3C1BD 3KSYA 3REKB 3AZJD 5AVBB 5CPIA 3LELC 4H9RA 5AY8C 3B0BA 5AV9B 1M1AB 3AV2D 3REHC 1KX3D 3AZKA 2JCHA 3AZEB 3AYWA 3AZFD 4J8XD 3AV1C 4ZBJB 3X1VB 5BNVA 2L5AA 4Z66A 3REJC 4Z2MG 3A6NB 5CP6B 1P3BC 4H9PA 1P3AB 3UT9B 2Y2NA 2JSSA 4KUDA 1F66B 1ID3B 3B6FD 5AV8C 1B6WA 4H9NB 3P5JB 3WA9C 1P3LA 3A1IA 5CPKB 1AOIC 5AV6B 5BS7A 2ZY2A 1HQ3A 4G91B 4Z5TD 5B2ID 3AZMB 5GT0A 5E5AA 5G49A 1BH9A 1M19B 3W99C 1R4VA 5GSUB 4J8VD 2CV5C 3VH6W 2ZY5A 3WKJD 4WU9C 1P3GD 5B32B 5AVCA 3B6GB 1HTAA 2FJ7D 3KXBB 1P3MD 5B40B 1P3ID 3WTPC 1S32B 3AZND 2HUEC 4H9OA 5B0ZA 4KHAB 5B2JA 3TU4A 3REKD 1P34C 1M18C 5AVBD 3KUYC 3AZHB 3X1UB 5B1MB 5GT3C 2F8NK 3NQJB 5AV9D 3LELA 5DNNB 1TAFB 3H0RC 5B31G 5B0YC 2F8NB 3AZED 3REHA 3X1VD 5F99C 4E44A 4HGAB 5B1LB 3AV1A 3X1TB 5BO0A 5JRGC 1B67A 2JE5A 3A6ND 3REJA 4J8UB 5CP6D 3O62C 1P3AD 1ZLAC 3UT9D 1P3BA 5GXQC 3FDDA 4H9SC 1F66D 1ID3D 4AWLB 4J8WB 3V9RB 4NFTA 2RVQC 5AV8A 3R45A 3AZIC 5AV6D 5CPKD 3W97B 3WA9A 1AOIA 1P3FB 5B33B 3AZGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP D;  3C1C B;  4Z66 C;  5JA4 A;  2NZD A;  3WAA A;  5BNX B;  4J8X C;  1KX5 C;  4XZQ C;  5CPI B;  3X1S C;  3LJA B;  1M19 D;  4R8P C;  4CAY B;  3MGS C;  3UTA B;  5GSU D;  5AV5 C;  3AZK B;  3W99 A;  4H9Q A;  4NE3 A;  3AYW B;  1P3O B;  3VH6 A;  5B31 C;  5FUG A;  2CV5 A;  5B32 D;  1KU5 A;  4WU9 A;  3B6G D;  3KXB D;  5B40 D;  1S32 D;  4H9P B;  4JJN C;  4QLC C;  1BH8 A;  3AZL B;  1H3O A;  3X1U D;  5B1M D;  3AZH D;  1P34 A;  1P3L B;  3KUY A;  1M18 A;  5B24 B;  5GT3 A;  5DNN D;  3REL C;  3MGR C;  2F8N D;  5DNM C;  1HQ3 B;  4WU8 C;  5KDM A;  3MNN C;  5B1L D;  1TZY C;  5F99 A;  5C3I C;  3X1T D;  4J8V C;  3NQU A;  4J8U D;  5GT0 B;  5E5A B;  4NE6 A;  1BH9 B;  3O62 A;  1ZLA A;  5GXQ A;  4J8W D;  4H9S A;  3AZN C;  4WZS B;  4WV4 B;  3W97 D;  3AZI A;  3MVD C;  1P3F D;  5B33 D;  1M1A D;  2YFV A;  4LD9 D;  3C1C D;  4YM6 C;  3AZG A;  4M6B A;  4H9O B;  3AZE C;  3AV2 A;  3X1V C;  5B2J B;  3TU4 B;  1KX5 A;  4J8X A;  5CPI D;  4XZQ A;  5CPJ C;  2HIO B;  3X1S A;  3LJA D;  3W98 C;  3LEL B;  5AY8 B;  3UTA D;  2BYK A;  3AZK D;  4R8P A;  3MGS A;  2LY8 A;  5AV5 A;  3REH B;  3AYW D;  1P3O D;  4WNN A;  3LZ0 C;  3AV1 B;  5B31 A;  5BO0 B;  3B6F A;  3AN2 C;  1WWS A;  3REJ B;  1Q9C A;  3MGP B;  4YS3 C;  2IO5 C;  3WAA C;  2NZD C;  1P3B B;  3B0C W;  3AFA C;  1JFI A;  5BT1 D;  4JJN A;  3AZL D;  4G91 C;  4QLC A;  1P3P C;  5AV8 B;  3AZM C;  1P3L D;  1U35 C;  3WA9 B;  3REI C;  5B24 D;  1AOI B;  1KX4 B;  3REL A;  3MGR A;  2YFW B;  1HQ3 D;  5DNM A;  5JA4 B;  4WU8 A;  3W96 C;  4X23 C;  3MGQ C;  3MNN A;  1TZY A;  4J8V A;  4CSR A;  5GT0 D;  2PYO B;  5E5A D;  3KWQ C;  3B0D C;  1BFM A;  5B40 C;  4KGC C;  1S32 C;  3LZ1 C;  3W99 B;  4H9Q B;  3AZN A;  1P3K C;  5FUG B;  2CV5 B;  3X1U C;  3MVD A;  4XUJ C;  4ZUX B;  3UTB C;  3WTP B;  4YM6 A;  1BH8 B;  2HUE B;  4HGA C;  3AZE A;  5B2J D;  3TU4 D;  3X1V A;  1EQZ C;  1H3O B;  2ARO B;  1P34 B;  3KUY B;  2HIO D;  4NE5 A;  4J8U C;  3LEL D;  5AY8 D;  5CPJ A;  2NQB C;  3W98 A;  1F1E A;  3VH5 W;  5B0Y B;  3REH D;  3C1B C;  5KDM B;  3AZJ C;  3AV1 D;  5F99 B;  3LZ0 A;  4H9N A;  3REJ D;  5JRG B;  3AN2 A;  5CPK A;  3AV2 C;  4YS3 A;  1KX3 C;  1P3B D;  3O62 B;  1ZLA B;  3AZF C;  3AFA A;  3C1C C;  4H9R B;  5AV8 D;  1P3P A;  3WA9 D;  3AZM A;  3AZI B;  1U35 A;  1AOI D;  3REI A;  1KX4 D;  3B6F C;  5BNV B;  3AZG B;  1M19 A;  4Z66 B;  3VH6 T;  5GSU A;  3W96 A;  4X23 A;  3MGQ A;  1KX5 B;  2PYO D;  3X1S B;  4KUD B;  3KWQ A;  4Z5T C;  3KXB A;  2BYK B;  5B2I C;  4R8P B;  5B40 A;  3W99 D;  3MGS B;  1S32 A;  5AV5 B;  4KGC A;  3LZ1 A;  2CV5 D;  5B31 B;  1P3K A;  3X1U A;  5B24 C;  4XUJ A;  4ZUX D;  1JFI B;  3WTP D;  3UTB A;  4JJN B;  2F8N A;  3WKJ C;  1A7W A;  4EO5 C;  4QLC B;  1P3G C;  4G92 C;  5G49 B;  2FJ7 C;  2ARO D;  1P34 D;  3KUY D;  1P3M C;  1M18 D;  1EQZ A;  1P3I C;  4J8U A;  2NQB A;  3REL B;  3MGR B;  5B0Y D;  5DNM B;  5AVC B;  4WU8 B;  3REK C;  5AVB C;  3C1B A;  5F99 D;  3MNN B;  3AZJ A;  1TZY B;  5C3I B;  5AV9 C;  1ULY A;  5JRG D;  5B0Z B;  5B32 G;  3O62 D;  5B33 A;  1KX3 A;  1ZLA D;  1N1J A;  4ZBJ C;  1M1A A;  3AZF A;  4LD9 B;  3C1C A;  4LD9 A;  3A6N C;  2RVQ D;  5CP6 C;  3AZI D;  1P3A C;  3UT9 C;  3MVD B;  2HIO C;  1F66 C;  1ID3 C;  1WWI A;  3LJA A;  3AZG D;  4Z66 D;  4YM6 B;  4CAY A;  3UTA A;  5CPK C;  5AV6 C;  2F8N G;  1P3O A;  1KX5 D;  4XZQ D;  3X1S D;  3MGP C;  4KUD D;  5CPJ B;  3W98 B;  4R8P D;  4Z5T A;  3MGS D;  5AV5 D;  4UUZ A;  3R45 B;  5B2I A;  3AZL A;  5B31 D;  5CHL B;  3LZ0 B;  1M19 C;  3AN2 B;  2BYM A;  5GSU C;  2IO5 B;  4YS3 B;  3WAA B;  2NZD B;  5B24 A;  1KX4 C;  3AFA B;  4JJN D;  4QLC D;  5B32 C;  3WKJ A;  3B6G C;  1P3G A;  1P3P B;  3KXB C;  2FJ7 A;  1U35 B;  1P3M A;  2PYO C;  3REI B;  1P3I A;  2F8N H;  3REL D;  3MGR D;  5DNM D;  5AVC D;  4WU8 D;  4Z2M H;  3MNN D;  5B1M C;  3REK A;  3MGQ B;  4X23 B;  5AVB A;  1TZY D;  3AZH C;  4WU9 B;  3W96 B;  5DNN C;  5AV9 A;  5B0Z D;  3KWQ B;  3B0D B;  5B1L C;  4ZUX C;  3X1T C;  4KGC B;  1M18 B;  3LZ1 B;  5GT3 B;  3A6N A;  1P3K B;  5CP6 A;  2ARO C;  3MVD D;  1P3A A;  3UT9 A;  2HIO A;  4J8W C;  4XUJ B;  4AWL C;  1F66 A;  5AY8 A;  1ID3 A;  4YM6 D;  3UTB B;  3NQU B;  3W97 C;  4DRB A;  5AV6 A;  1P3F C;  5B33 C;  1EQZ B;  1M1A C;  4LD9 C;  3B0C T;  5GXQ B;  5CPJ D;  3MGP A;  3W98 D;  2NQB B;  3WTP E;  3C1B B;  5CPI C;  3AZJ B;  4DRA A;  3LZ0 D;  3LJA C;  2YFV B;  3AN2 D;  3UTA C;  4YS3 D;  2NZD D;  3WAA D;  3AZK C;  3AV2 B;  3AYW C;  1KX3 B;  1P3O C;  1N1J B;  3AFA D;  1KX4 A;  2YFW A;  4J8X B;  3AZF B;  4XZQ B;  5B32 A;  1P3P D;  3B6G A;  3AZM D;  1U35 D;  3REI D;  2PYO A;  5BT1 C;  4KUD C;  3AZL C;  4WNN B;  4E45 A;  3B6F B;  4KHA A;  4WU9 D;  1P3L C;  3MGQ D;  4X23 D;  3W96 D;  5BS7 C;  3AZH A;  5B1M A;  3NQJ A;  5DNN A;  1TAF A;  1HQ3 C;  3KWQ D;  4KGC D;  4Z5T B;  5B1L A;  4UUZ B;  5B2I B;  4ZUX A;  3X1T A;  3LZ1 D;  2CWE A;  3WTP A;  5GT0 C;  5GT3 D;  5E5A C;  1P3K D;  3VH5 A;  2ARO A;  2BYM B;  3VH5 T;  4XUJ D;  4J8W A;  3V9R A;  3UTB D;  4J8V B;  4CSR B;  5B0Y A;  5AVC C;  3WKJ B;  3W97 A;  4EO5 B;  1P3G B;  4G92 B;  1P3F A;  1EQZ D;  5GXQ D;  2FJ7 B;  1P3M B;  5JRG A;  1P3I B;  2NQB D;  5B0Z C;  3AZN B;  5B2J C;  3TU4 C;  5BNX A;  3C1B D;  3KSY A;  3REK B;  3AZJ D;  5AVB B;  5CPI A;  3LEL C;  4H9R A;  5AY8 C;  3B0B A;  5AV9 B;  1M1A B;  3AV2 D;  3REH C;  1KX3 D;  3AZK A;  3AZE B;  3AYW A;  3AZF D;  4J8X D;  3AV1 C;  4ZBJ B;  3X1V B;  5BNV A;  2L5A A;  4Z66 A;  3REJ C;  4Z2M G;  3A6N B;  5CP6 B;  1P3B C;  4H9P A;  1P3A B;  3UT9 B;  2JSS A;  4KUD A;  1F66 B;  1ID3 B;  3B6F D;  5AV8 C;  1B6W A;  4H9N B;  3WA9 C;  1P3L A;  5CPK B;  1AOI C;  5AV6 B;  5BS7 A;  1HQ3 A;  4G91 B;  4Z5T D;  5B2I D;  3AZM B;  5GT0 A;  5E5A A;  5G49 A;  1BH9 A;  1M19 B;  3W99 C;  1R4V A;  5GSU B;  4J8V D;  2CV5 C;  3VH6 W;  3WKJ D;  4WU9 C;  1P3G D;  5B32 B;  5AVC A;  3B6G B;  1HTA A;  2FJ7 D;  3KXB B;  1P3M D;  5B40 B;  1P3I D;  3WTP C;  1S32 B;  3AZN D;  2HUE C;  4H9O A;  5B0Z A;  4KHA B;  5B2J A;  3TU4 A;  3REK D;  1P34 C;  1M18 C;  5AVB D;  3KUY C;  3AZH B;  3X1U B;  5B1M B;  5GT3 C;  2F8N K;  3NQJ B;  5AV9 D;  3LEL A;  5DNN B;  1TAF B;  5B31 G;  5B0Y C;  2F8N B;  3AZE D;  3REH A;  3X1V D;  5F99 C;  4E44 A;  4HGA B;  5B1L B;  3AV1 A;  3X1T B;  5BO0 A;  5JRG C;  1B67 A;  3A6N D;  3REJ A;  4J8U B;  5CP6 D;  3O62 C;  1P3A D;  1ZLA C;  3UT9 D;  1P3B A;  5GXQ C;  4H9S C;  1F66 D;  1ID3 D;  4AWL B;  4J8W B;  3V9R B;  4NFT A;  2RVQ C;  5AV8 A;  3R45 A;  3AZI C;  5AV6 D;  5CPK D;  3W97 B;  3WA9 A;  1AOI A;  1P3F B;  5B33 B;  3AZG C; 
#chains in the Genus database with same CATH topology
 3MGP D;  3C1C B;  4Z66 C;  5JA4 A;  2NZD A;  3WAA A;  4WJ3 C;  5BNX B;  4J8X C;  1KX5 C;  4XZQ C;  3IP4 C;  5CPI B;  3X1S C;  3LJA B;  1M19 D;  4R8P C;  4CAY B;  3MGS C;  3UTA B;  5GSU D;  5AV5 C;  3AZK B;  3W99 A;  4H9Q A;  4NE3 A;  3AYW B;  1P3O B;  3VH6 A;  5B31 C;  5FUG A;  2CV5 A;  5B32 D;  1KU5 A;  4WU9 A;  3B6G D;  3KXB D;  5B40 D;  1T3U A;  4H9P B;  1S32 D;  4JJN C;  4QLC C;  1BH8 A;  3AZL B;  1H3O A;  3X1U D;  5B1M D;  3AZH D;  1P34 A;  1P3L B;  3KUY A;  1M18 A;  5B24 B;  5GT3 A;  5DNN D;  3REL C;  3MGR C;  2F8N D;  5DNM C;  1HQ3 B;  4WU8 C;  5KDM A;  3MNN C;  2Y2M A;  5B1L D;  1TZY C;  5F99 A;  5C3I C;  3X1T D;  4J8V C;  3NQU A;  4J8U D;  5GT0 B;  5E5A B;  4NE6 A;  1BH9 B;  3O62 A;  1ZLA A;  5GXQ A;  4J8W D;  4H9S A;  3AZN C;  4WZS B;  4WV4 B;  3W97 D;  3AZI A;  3MVD C;  1P3F D;  5B33 D;  1M1A D;  2YFV A;  4LD9 D;  3C1C D;  4YM6 C;  3AZG A;  3AL0 C;  4M6B A;  4H9O B;  3AZE C;  3AV2 A;  3X1V C;  5B2J B;  3TU4 B;  2DF4 C;  4J8X A;  1KX5 A;  5CPI D;  4XZQ A;  2FFF B;  5CPJ C;  2HIO B;  3X1S A;  3LJA D;  3W98 C;  3LEL B;  5AY8 B;  3UTA D;  2BYK A;  3AZK D;  2Y2O A;  4R8P A;  3MGS A;  2LY8 A;  5AV5 A;  3REH B;  3AYW D;  1P3O D;  4WNN A;  3LZ0 C;  3AV1 B;  5B31 A;  5BO0 B;  3B6F A;  3AN2 C;  1WWS A;  4UPK A;  1Q9C A;  3MGP B;  4YS3 C;  2IO5 C;  3WAA C;  3REJ B;  2NZD C;  1P3B B;  3B0C W;  3AFA C;  1JFI A;  5BT1 D;  4JJN A;  3AZL D;  4G91 C;  4QLC A;  1P3P C;  2ZY4 A;  5AV8 B;  3AZM C;  1P3L D;  1U35 C;  3WA9 B;  3REI C;  5B24 D;  1AOI B;  1KX4 B;  3REL A;  3MGR A;  2YFW B;  1HQ3 D;  5DNM A;  5JA4 B;  4WU8 A;  2Y2K A;  2Y2G A;  3W96 C;  4X23 C;  3MGQ C;  3MNN A;  1TZY A;  4J8V A;  3EPK A;  4CSR A;  5GT0 D;  2PYO B;  5E5A D;  3KWQ C;  3EPL A;  3B0D C;  1BFM A;  5B40 C;  4KGC C;  1S32 C;  3LZ1 C;  3W99 B;  4H9Q B;  2Y2Q A;  3AZN A;  1P3K C;  2F2A C;  5FUG B;  2CV5 B;  3X1U C;  3MVD A;  4XUJ C;  2G5I C;  4ZUX B;  3UTB C;  3WTP B;  4YM6 A;  1BH8 B;  2HUE B;  4HGA C;  3AZE A;  3EPH A;  5B2J D;  3TU4 D;  3X1V A;  1EQZ C;  1H3O B;  2ARO B;  1P34 B;  3KUY B;  2HIO D;  4NE5 A;  4J8U C;  3LEL D;  5AY8 D;  2BG1 A;  5CPJ A;  2NQB C;  3W98 A;  1F1E A;  2VQR A;  3VH5 W;  5B0Y B;  3REH D;  3C1B C;  5KDM B;  3H0L C;  3AZJ C;  3AV1 D;  5F99 B;  3KFU G;  3LZ0 A;  4H9N A;  3REJ D;  5JRG B;  3AN2 A;  5CPK A;  3AV2 C;  4YS3 A;  1KX3 C;  1P3B D;  3O62 B;  1ZLA B;  3AZF C;  3AFA A;  3C1C C;  2Y2L A;  4H9R B;  5AV8 D;  1P3P A;  3WA9 D;  3AZM A;  3AZI B;  1U35 A;  1AOI D;  3REI A;  1KX4 D;  3B6F C;  5BNV B;  3AZG B;  1M19 A;  4Z66 B;  3VH6 T;  5GSU A;  1W2E A;  3W96 A;  4X23 A;  3MGQ A;  1KX5 B;  2PYO D;  3X1S B;  3H0M C;  4KUD B;  3KWQ A;  4Z5T C;  3KXB A;  2BYK B;  5B2I C;  5B40 A;  4R8P B;  3W99 D;  3MGS B;  2ZM5 A;  5AV5 B;  1S32 A;  4KGC A;  3A1K A;  3LZ1 A;  2CV5 D;  5B31 B;  1P3K A;  3X1U A;  2UWX A;  5B24 C;  4XUJ A;  4ZUX D;  1JFI B;  3WTP D;  3UTB A;  4JJN B;  2F8N A;  2Y2H A;  3WKJ C;  1A7W A;  4EO5 C;  4QLC B;  1P3G C;  4G92 C;  5G49 B;  2FJ7 C;  2ARO D;  1P34 D;  3KUY D;  1P3M C;  1M18 D;  1EQZ A;  1P3I C;  4J8U A;  2NQB A;  3REL B;  3MGR B;  5B0Y D;  5DNM B;  1Z2C B;  5AVC B;  4WU8 B;  3REK C;  5AVB C;  3C1B A;  5F99 D;  3MNN B;  3AZJ A;  1TZY B;  5C3I B;  5AV9 C;  1ULY A;  5JRG D;  5B0Z B;  2ZY3 A;  5B32 G;  5B33 A;  3O62 D;  1KX3 A;  1N1J A;  1ZLA D;  4ZBJ C;  1M1A A;  3AZF A;  4LD9 B;  3C1C A;  4LD9 A;  3A6N C;  2RVQ D;  5CP6 C;  3AZI D;  1P3A C;  3UT9 C;  3MVD B;  2HIO C;  2DQN C;  1F66 C;  1ID3 C;  1WWI A;  3LJA A;  3AZG D;  4Z66 D;  4YM6 B;  4CAY A;  3UTA A;  3EPJ A;  5CPK C;  5AV6 C;  2F8N G;  1P3O A;  1KX5 D;  4XZQ D;  1PZR A;  3X1S D;  3MGP C;  4KUD D;  5CPJ B;  3W98 B;  4R8P D;  4Z5T A;  3MGS D;  5AV5 D;  4UUZ A;  3R45 B;  5B2I A;  3AZL A;  5B31 D;  4DQY B;  5CHL B;  3LZ0 B;  1M19 C;  3AN2 B;  2BYM A;  5GSU C;  2IO5 B;  4YS3 B;  3WAA B;  2NZD B;  5B24 A;  1KX4 C;  3AFA B;  4JJN D;  4QLC D;  5B32 C;  3WKJ A;  3B6G C;  1P3G A;  1P3P B;  3KXB C;  2FJ7 A;  1U35 B;  1P3M A;  2PYO C;  3REI B;  1P3I A;  2F8N H;  3REL D;  3MGR D;  5DNM D;  5AVC D;  4WU8 D;  4Z2M H;  3MNN D;  5B1M C;  3REK A;  3MGQ B;  4X23 B;  5AVB A;  1TZY D;  3AZH C;  4WU9 B;  3W96 B;  2W8S A;  5DNN C;  5AV9 A;  3F6T A;  5B0Z D;  3KWQ B;  3B0D B;  5B1L C;  4ZUX C;  3X1T C;  4KGC B;  1M18 B;  3LZ1 B;  2Y2I A;  5GT3 B;  3A6N A;  1P3K B;  5CP6 A;  2ARO C;  3MVD D;  1P3A A;  3UT9 A;  2HIO A;  4J8W C;  4XUJ B;  4AWL C;  1F66 A;  5AY8 A;  1ID3 A;  4YM6 D;  3UTB B;  2Y2J A;  3NQU B;  3W97 C;  4DRB A;  5AV6 A;  1P3F C;  5B33 C;  1EQZ B;  2RIQ A;  1M1A C;  4LD9 C;  2XD5 A;  3B0C T;  5GXQ B;  5CPJ D;  3MGP A;  3W98 D;  2NQB B;  3WTP E;  3C1B B;  5CPI C;  3AZJ B;  4DRA A;  3LZ0 D;  3LJA C;  2YFV B;  3AN2 D;  3UTA C;  4YS3 D;  2NZD D;  3WAA D;  3AZK C;  3AV2 B;  3EG5 B;  3AYW C;  1KX3 B;  1P3O C;  1N1J B;  3AFA D;  1KX4 A;  2YFW A;  4J8X B;  3AZF B;  4XZQ B;  5B32 A;  1P3P D;  3B6G A;  3AZM D;  1U35 D;  3REI D;  2PYO A;  5BT1 C;  4KUD C;  3AZL C;  4WNN B;  4E45 A;  3B6F B;  4KHA A;  4WU9 D;  1P3L C;  3MGQ D;  4X23 D;  3W96 D;  5BS7 C;  3AZH A;  2Y2P A;  5B1M A;  3NQJ A;  5DNN A;  1TAF A;  1HQ3 C;  2J8P A;  3KWQ D;  4KGC D;  4Z5T B;  5B1L A;  4UUZ B;  5B2I B;  4ZUX A;  3X1T A;  3LZ1 D;  2CWE A;  3WTP A;  5GT0 C;  5GT3 D;  5E5A C;  1P3K D;  3VH5 A;  2ARO A;  2BYM B;  3VH5 T;  4XUJ D;  2XD1 A;  4J8W A;  3V9R A;  3UTB D;  4J8V B;  4CSR B;  5B0Y A;  5AVC C;  3WKJ B;  3W97 A;  2G5H C;  4EO5 B;  1P3G B;  4G92 B;  1P3F A;  1EQZ D;  5GXQ D;  2FJ7 B;  1P3M B;  5JRG A;  1P3I B;  2NQB D;  5B0Z C;  3AZN B;  5B2J C;  3TU4 C;  5BNX A;  3C1B D;  3KSY A;  3REK B;  3AZJ D;  5AVB B;  5CPI A;  3LEL C;  4H9R A;  5AY8 C;  3B0B A;  5AV9 B;  1M1A B;  3AV2 D;  3REH C;  1KX3 D;  3AZK A;  2JCH A;  3AZE B;  3AYW A;  3AZF D;  4J8X D;  3AV1 C;  4ZBJ B;  3X1V B;  5BNV A;  2L5A A;  4Z66 A;  3REJ C;  4Z2M G;  3A6N B;  5CP6 B;  1P3B C;  4H9P A;  1P3A B;  3UT9 B;  2Y2N A;  2JSS A;  4KUD A;  1F66 B;  1ID3 B;  3B6F D;  5AV8 C;  1B6W A;  4H9N B;  3P5J B;  3WA9 C;  1P3L A;  3A1I A;  5CPK B;  1AOI C;  5AV6 B;  5BS7 A;  2ZY2 A;  1HQ3 A;  4G91 B;  4Z5T D;  5B2I D;  3AZM B;  5GT0 A;  5E5A A;  5G49 A;  1BH9 A;  1M19 B;  3W99 C;  1R4V A;  5GSU B;  4J8V D;  2CV5 C;  3VH6 W;  2ZY5 A;  3WKJ D;  4WU9 C;  1P3G D;  5B32 B;  5AVC A;  3B6G B;  1HTA A;  2FJ7 D;  3KXB B;  1P3M D;  5B40 B;  1P3I D;  3WTP C;  1S32 B;  3AZN D;  2HUE C;  4H9O A;  5B0Z A;  4KHA B;  5B2J A;  3TU4 A;  3REK D;  1P34 C;  1M18 C;  5AVB D;  3KUY C;  3AZH B;  3X1U B;  5B1M B;  5GT3 C;  2F8N K;  3NQJ B;  5AV9 D;  3LEL A;  5DNN B;  1TAF B;  3H0R C;  5B31 G;  5B0Y C;  2F8N B;  3AZE D;  3REH A;  3X1V D;  5F99 C;  4E44 A;  4HGA B;  5B1L B;  3AV1 A;  3X1T B;  5BO0 A;  5JRG C;  1B67 A;  2JE5 A;  3A6N D;  3REJ A;  4J8U B;  5CP6 D;  3O62 C;  1P3A D;  1ZLA C;  3UT9 D;  1P3B A;  5GXQ C;  3FDD A;  4H9S C;  1F66 D;  1ID3 D;  4AWL B;  4J8W B;  3V9R B;  4NFT A;  2RVQ C;  5AV8 A;  3R45 A;  3AZI C;  5AV6 D;  5CPK D;  3W97 B;  3WA9 A;  1AOI A;  1P3F B;  5B33 B;  3AZG C; 
#chains in the Genus database with same CATH homology
 3MGP D;  3C1C B;  4Z66 C;  5JA4 A;  2NZD A;  3WAA A;  4WJ3 C;  5BNX B;  4J8X C;  1KX5 C;  4XZQ C;  3IP4 C;  5CPI B;  3X1S C;  3LJA B;  1M19 D;  4R8P C;  4CAY B;  3MGS C;  3UTA B;  5GSU D;  5AV5 C;  3AZK B;  3W99 A;  4H9Q A;  4NE3 A;  3AYW B;  1P3O B;  3VH6 A;  5B31 C;  5FUG A;  2CV5 A;  5B32 D;  1KU5 A;  4WU9 A;  3B6G D;  3KXB D;  5B40 D;  1T3U A;  4H9P B;  1S32 D;  4JJN C;  4QLC C;  1BH8 A;  3AZL B;  1H3O A;  3X1U D;  5B1M D;  3AZH D;  1P34 A;  1P3L B;  3KUY A;  1M18 A;  5B24 B;  5GT3 A;  5DNN D;  3REL C;  3MGR C;  2F8N D;  5DNM C;  1HQ3 B;  4WU8 C;  5KDM A;  3MNN C;  2Y2M A;  5B1L D;  1TZY C;  5F99 A;  5C3I C;  3X1T D;  4J8V C;  3NQU A;  4J8U D;  5GT0 B;  5E5A B;  4NE6 A;  1BH9 B;  3O62 A;  1ZLA A;  5GXQ A;  4J8W D;  4H9S A;  3AZN C;  4WZS B;  4WV4 B;  3W97 D;  3AZI A;  3MVD C;  1P3F D;  5B33 D;  1M1A D;  2YFV A;  4LD9 D;  3C1C D;  4YM6 C;  3AZG A;  3AL0 C;  4M6B A;  4H9O B;  3AZE C;  3AV2 A;  3X1V C;  5B2J B;  3TU4 B;  2DF4 C;  4J8X A;  1KX5 A;  5CPI D;  4XZQ A;  2FFF B;  5CPJ C;  2HIO B;  3X1S A;  3LJA D;  3W98 C;  3LEL B;  5AY8 B;  3UTA D;  2BYK A;  3AZK D;  2Y2O A;  4R8P A;  3MGS A;  2LY8 A;  5AV5 A;  3REH B;  3AYW D;  1P3O D;  4WNN A;  3LZ0 C;  3AV1 B;  5B31 A;  5BO0 B;  3B6F A;  3AN2 C;  1WWS A;  4UPK A;  1Q9C A;  3MGP B;  4YS3 C;  2IO5 C;  3WAA C;  3REJ B;  2NZD C;  1P3B B;  3B0C W;  3AFA C;  1JFI A;  5BT1 D;  4JJN A;  3AZL D;  4G91 C;  4QLC A;  1P3P C;  2ZY4 A;  5AV8 B;  3AZM C;  1P3L D;  1U35 C;  3WA9 B;  3REI C;  5B24 D;  1AOI B;  1KX4 B;  3REL A;  3MGR A;  2YFW B;  1HQ3 D;  5DNM A;  5JA4 B;  4WU8 A;  2Y2K A;  2Y2G A;  3W96 C;  4X23 C;  3MGQ C;  3MNN A;  1TZY A;  4J8V A;  3EPK A;  4CSR A;  5GT0 D;  2PYO B;  5E5A D;  3KWQ C;  3EPL A;  3B0D C;  1BFM A;  5B40 C;  4KGC C;  1S32 C;  3LZ1 C;  3W99 B;  4H9Q B;  2Y2Q A;  3AZN A;  1P3K C;  2F2A C;  5FUG B;  2CV5 B;  3X1U C;  3MVD A;  4XUJ C;  2G5I C;  4ZUX B;  3UTB C;  3WTP B;  4YM6 A;  1BH8 B;  2HUE B;  4HGA C;  3AZE A;  3EPH A;  5B2J D;  3TU4 D;  3X1V A;  1EQZ C;  1H3O B;  2ARO B;  1P34 B;  3KUY B;  2HIO D;  4NE5 A;  4J8U C;  3LEL D;  5AY8 D;  2BG1 A;  5CPJ A;  2NQB C;  3W98 A;  1F1E A;  2VQR A;  3VH5 W;  5B0Y B;  3REH D;  3C1B C;  5KDM B;  3H0L C;  3AZJ C;  3AV1 D;  5F99 B;  3KFU G;  3LZ0 A;  4H9N A;  3REJ D;  5JRG B;  3AN2 A;  5CPK A;  3AV2 C;  4YS3 A;  1KX3 C;  1P3B D;  3O62 B;  1ZLA B;  3AZF C;  3AFA A;  3C1C C;  2Y2L A;  4H9R B;  5AV8 D;  1P3P A;  3WA9 D;  3AZM A;  3AZI B;  1U35 A;  1AOI D;  3REI A;  1KX4 D;  3B6F C;  5BNV B;  3AZG B;  1M19 A;  4Z66 B;  3VH6 T;  5GSU A;  1W2E A;  3W96 A;  4X23 A;  3MGQ A;  1KX5 B;  2PYO D;  3X1S B;  3H0M C;  4KUD B;  3KWQ A;  4Z5T C;  3KXB A;  2BYK B;  5B2I C;  5B40 A;  4R8P B;  3W99 D;  3MGS B;  2ZM5 A;  5AV5 B;  1S32 A;  4KGC A;  3A1K A;  3LZ1 A;  2CV5 D;  5B31 B;  1P3K A;  3X1U A;  2UWX A;  5B24 C;  4XUJ A;  4ZUX D;  1JFI B;  3WTP D;  3UTB A;  4JJN B;  2F8N A;  2Y2H A;  3WKJ C;  1A7W A;  4EO5 C;  4QLC B;  1P3G C;  4G92 C;  5G49 B;  2FJ7 C;  2ARO D;  1P34 D;  3KUY D;  1P3M C;  1M18 D;  1EQZ A;  1P3I C;  4J8U A;  2NQB A;  3REL B;  3MGR B;  5B0Y D;  5DNM B;  1Z2C B;  5AVC B;  4WU8 B;  3REK C;  5AVB C;  3C1B A;  5F99 D;  3MNN B;  3AZJ A;  1TZY B;  5C3I B;  5AV9 C;  1ULY A;  5JRG D;  5B0Z B;  2ZY3 A;  5B32 G;  5B33 A;  3O62 D;  1KX3 A;  1N1J A;  1ZLA D;  4ZBJ C;  1M1A A;  3AZF A;  4LD9 B;  3C1C A;  4LD9 A;  3A6N C;  2RVQ D;  5CP6 C;  3AZI D;  1P3A C;  3UT9 C;  3MVD B;  2HIO C;  2DQN C;  1F66 C;  1ID3 C;  1WWI A;  3LJA A;  3AZG D;  4Z66 D;  4YM6 B;  4CAY A;  3UTA A;  3EPJ A;  5CPK C;  5AV6 C;  2F8N G;  1P3O A;  1KX5 D;  4XZQ D;  1PZR A;  3X1S D;  3MGP C;  4KUD D;  5CPJ B;  3W98 B;  4R8P D;  4Z5T A;  3MGS D;  5AV5 D;  4UUZ A;  3R45 B;  5B2I A;  3AZL A;  5B31 D;  4DQY B;  5CHL B;  3LZ0 B;  1M19 C;  3AN2 B;  2BYM A;  5GSU C;  2IO5 B;  4YS3 B;  3WAA B;  2NZD B;  5B24 A;  1KX4 C;  3AFA B;  4JJN D;  4QLC D;  5B32 C;  3WKJ A;  3B6G C;  1P3G A;  1P3P B;  3KXB C;  2FJ7 A;  1U35 B;  1P3M A;  2PYO C;  3REI B;  1P3I A;  2F8N H;  3REL D;  3MGR D;  5DNM D;  5AVC D;  4WU8 D;  4Z2M H;  3MNN D;  5B1M C;  3REK A;  3MGQ B;  4X23 B;  5AVB A;  1TZY D;  3AZH C;  4WU9 B;  3W96 B;  2W8S A;  5DNN C;  5AV9 A;  3F6T A;  5B0Z D;  3KWQ B;  3B0D B;  5B1L C;  4ZUX C;  3X1T C;  4KGC B;  1M18 B;  3LZ1 B;  2Y2I A;  5GT3 B;  3A6N A;  1P3K B;  5CP6 A;  2ARO C;  3MVD D;  1P3A A;  3UT9 A;  2HIO A;  4J8W C;  4XUJ B;  4AWL C;  1F66 A;  5AY8 A;  1ID3 A;  4YM6 D;  3UTB B;  2Y2J A;  3NQU B;  3W97 C;  4DRB A;  5AV6 A;  1P3F C;  5B33 C;  1EQZ B;  2RIQ A;  1M1A C;  4LD9 C;  2XD5 A;  3B0C T;  5GXQ B;  5CPJ D;  3MGP A;  3W98 D;  2NQB B;  3WTP E;  3C1B B;  5CPI C;  3AZJ B;  4DRA A;  3LZ0 D;  3LJA C;  2YFV B;  3AN2 D;  3UTA C;  4YS3 D;  2NZD D;  3WAA D;  3AZK C;  3AV2 B;  3EG5 B;  3AYW C;  1KX3 B;  1P3O C;  1N1J B;  3AFA D;  1KX4 A;  2YFW A;  4J8X B;  3AZF B;  4XZQ B;  5B32 A;  1P3P D;  3B6G A;  3AZM D;  1U35 D;  3REI D;  2PYO A;  5BT1 C;  4KUD C;  3AZL C;  4WNN B;  4E45 A;  3B6F B;  4KHA A;  4WU9 D;  1P3L C;  3MGQ D;  4X23 D;  3W96 D;  5BS7 C;  3AZH A;  2Y2P A;  5B1M A;  3NQJ A;  5DNN A;  1TAF A;  1HQ3 C;  2J8P A;  3KWQ D;  4KGC D;  4Z5T B;  5B1L A;  4UUZ B;  5B2I B;  4ZUX A;  3X1T A;  3LZ1 D;  2CWE A;  3WTP A;  5GT0 C;  5GT3 D;  5E5A C;  1P3K D;  3VH5 A;  2ARO A;  2BYM B;  3VH5 T;  4XUJ D;  2XD1 A;  4J8W A;  3V9R A;  3UTB D;  4J8V B;  4CSR B;  5B0Y A;  5AVC C;  3WKJ B;  3W97 A;  2G5H C;  4EO5 B;  1P3G B;  4G92 B;  1P3F A;  1EQZ D;  5GXQ D;  2FJ7 B;  1P3M B;  5JRG A;  1P3I B;  2NQB D;  5B0Z C;  3AZN B;  5B2J C;  3TU4 C;  5BNX A;  3C1B D;  3KSY A;  3REK B;  3AZJ D;  5AVB B;  5CPI A;  3LEL C;  4H9R A;  5AY8 C;  3B0B A;  5AV9 B;  1M1A B;  3AV2 D;  3REH C;  1KX3 D;  3AZK A;  2JCH A;  3AZE B;  3AYW A;  3AZF D;  4J8X D;  3AV1 C;  4ZBJ B;  3X1V B;  5BNV A;  2L5A A;  4Z66 A;  3REJ C;  4Z2M G;  3A6N B;  5CP6 B;  1P3B C;  4H9P A;  1P3A B;  3UT9 B;  2Y2N A;  2JSS A;  4KUD A;  1F66 B;  1ID3 B;  3B6F D;  5AV8 C;  1B6W A;  4H9N B;  3P5J B;  3WA9 C;  1P3L A;  3A1I A;  5CPK B;  1AOI C;  5AV6 B;  5BS7 A;  2ZY2 A;  1HQ3 A;  4G91 B;  4Z5T D;  5B2I D;  3AZM B;  5GT0 A;  5E5A A;  5G49 A;  1BH9 A;  1M19 B;  3W99 C;  1R4V A;  5GSU B;  4J8V D;  2CV5 C;  3VH6 W;  2ZY5 A;  3WKJ D;  4WU9 C;  1P3G D;  5B32 B;  5AVC A;  3B6G B;  1HTA A;  2FJ7 D;  3KXB B;  1P3M D;  5B40 B;  1P3I D;  3WTP C;  1S32 B;  3AZN D;  2HUE C;  4H9O A;  5B0Z A;  4KHA B;  5B2J A;  3TU4 A;  3REK D;  1P34 C;  1M18 C;  5AVB D;  3KUY C;  3AZH B;  3X1U B;  5B1M B;  5GT3 C;  2F8N K;  3NQJ B;  5AV9 D;  3LEL A;  5DNN B;  1TAF B;  3H0R C;  5B31 G;  5B0Y C;  2F8N B;  3AZE D;  3REH A;  3X1V D;  5F99 C;  4E44 A;  4HGA B;  5B1L B;  3AV1 A;  3X1T B;  5BO0 A;  5JRG C;  1B67 A;  2JE5 A;  3A6N D;  3REJ A;  4J8U B;  5CP6 D;  3O62 C;  1P3A D;  1ZLA C;  3UT9 D;  1P3B A;  5GXQ C;  3FDD A;  4H9S C;  1F66 D;  1ID3 D;  4AWL B;  4J8W B;  3V9R B;  4NFT A;  2RVQ C;  5AV8 A;  3R45 A;  3AZI C;  5AV6 D;  5CPK D;  3W97 B;  3WA9 A;  1AOI A;  1P3F B;  5B33 B;  3AZG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...