4LD9A

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9A00
4XUJB 3LJAB 4WZSB 2YFVB 5JRGB 4WU8D 3AZNB 5FUGA 3B6GD 5B0YC 2PYOB 2HUEC 1P3OA 4J8XB 2HIOB 4XZQA 4E45A 5B2IB 5AV9B 5JRGA 5C3IC 1AOIC 4ZBJC 5CPJC 2FJ7B 2AROB 3WTPA 5CPKA 2PYOA 5AVBC 3C1BC 4DRAA 1KX4D 4WV4B 3AZKC 2HIOA 5BNVA 3WKJA 2NQBC 5B2IA 3B6FA 3AZIB 4H9PB 3UT9C 2FJ7A 3REIC 4J8VC 3VH6T 5GXQB 4WU9B 5AVCB 5DNMA 1P3PB 3B0DB 4KGCC 1HQ3C 1S32A 3A6NA 3AZIA 3AV2B 3MGSD 1P3GD 3AFAA 1JFIA 5GT3C 5GXQA 3W97C 4J8UC 3UTAB 4WU9A 2CWEA 3AZED 4H9OA 4ZUXC 1P3LD 2CV5B 4QLCD 1M19C 4H9NB 1BH8B 3MGPA 3MGRB 3AV2A 3AZKD 3RELB 5KDMB 3AZMA 4H9QB 2BYKB 2NZDD 3WAAA 3LZ1A 2YFWB 3MNND 5GT0C 4XZQC 3R45A 5KDMA 4KGCD 2BYMA 5B24B 4YS3A 4M6BA 3X1TC 3WTPC 3TU4C 3AYWC 5CPKC 1ZLAD 5GT3D 3W98A 3KXBD 1ID3B 3REHD 3WKJC 1M18C 1KX4B 3B6FC 3LZ0A 1TZYA 4WNNB 5B24A 4J8WD 5B31C 2FJ7C 4JJNA 3MGQA 5AY8A 3AZJD 5B2JB 5B32D 5E5AB 3C1CD 5B1LB 5DNMC 1ID3A 5DNND 3KSYA 1S32C 3A6NC 3AZLA 3AV1A 3O62B 3KWQD 4WNNA 5GT0D 4YM6C 1P3KD 3X1SB 1P3AA 2F8ND 3AFAC 5GXQC 5B2JA 3MGSB 3AZGD 4CAYB 3AZFB 5E5AA 1P3GB 5B1LA 4HGAB 5B0ZA 3VH6W 4H9SC 3AZHC 3AZEB 3MGPC 5BS7A 3O62A 1P3LB 3AZMC 4QLCB 4R8PA 1M18D 3V9RA 3X1SA 5CP6D 5CPID 3WA9B 5F99A 3KUYD 3WAAC 4CAYA 5BT1D 3LZ1C 3AZFA 3MVDD 1P34A 5B31D 2NZDB 3VH6A 5G49B 5B1MD 3W96A 3MNNB 1M1AD 4H9RA 3X1UC 3WA9A 3W99D 4AWLB 4YS3C 3LELB 4YM6D 4LD9C 5AV5D 4KUDA 1P3BA 5B33A 3UTBA 4UUZB 3W98C 1ZLAB 5GSUB 1U35D 3NQUB 1EQZA 3LZ0C 1TZYC 3REHB 3AZHD 1KX3D 3LELA 4NE6A 3X1VA 1F66D 2LY8A 4Z2MH 3MGQC 4JJNC 5AY8C 4J8WB 1P3MD 5AV6A 4UUZA 1P3FB 5GSUA 3AN2D 3AZJB 5B32B 4XUJA 3LJAA 3C1CB 3AZLC 2YFVA 3AV1C 5DNNB 3AZNA 4KHAB 5AV8D 4G92B 3X1UD 3KWQB 1P3AC 1P3KB 1P3ID 1KX5C 4J8XA 4LD9D 1P3FA 2F8NB 3AZGB 3B6GB 5B0ZC 5B40D 5AV9A 4X23D 5BS7C 4EO5B 4KHAA 4R8PC 1B6WA 4Z66B 2AROA 3REKC 5F99C 5CPIB 2IO5B 3VH5T 1P34C 4G91B 3KUYB 1WWSA 5B0YD 3B6GA 3MVDB 1TAFB 3W96C 4H9PA 4Z66A 5B1MB 4Z5TB 1M1AB 4CSRB 1AOID 5AVCA 1P3PA 5CPJD 1P3BC 3W99B 4KUDC 1B67A 5AVBD 3WTPE 5AV5B 3REJC 3UTBC 3C1BD 5B33C 1TAFA 1KX5D 2NQBD 1EQZC 4Z5TA 1U35B 4CSRA 1A7WA 3UTAA 3X1VC 3UT9D 4WU8B 5BNXB 3REID 1KX3B 4J8VD 2CV5A 1P3OC 5AV6C 1F66B 4H9NA 1BH8A 3MGRA 3RELA 5GSUC 2RVQC 4H9QA 4XUJC 1HQ3D 3LJAC 1P3MB 2BYKA 5JRGC 3AZNC 1N1JB 4WU8A 2YFWA 5BNXA 1H3OB 2PYOC 5AV8B 3W97D 4J8UD 4J8XC 2HIOC 1P3FC 4ZUXD 1P3IB 5B2IC 5AV9C 3REJD 1M19D 5B40B 4X23B 2AROC 3NQJB 1H3OA 5AV8A 5JA4B 1KX4A 3AZIC 4XZQD 5B0YB 2HUEB 2RVQD 4Z2MG 4WU9C 5AVCC 1P3PC 3X1TD 3B0DC 5C3IB 3WTPD 3TU4D 3AYWD 5CPKD 1AOIB 2PYOD 4ZBJB 5CPJB 3B0CT 3AV2C 4DRBA 4NFTA 3VH5W 3WKJD 3C1BB 3AZKB 3B6FD 5CHLB 3MGSA 2NQBB 3UTAC 1P3GA 2FJ7D 2CV5C 3UT9B 3AZEA 3MGRC 3REIB 3VH5A 5DNMD 3RELC 1P3LA 2F8NK 4QLCA 1S32D 2F8NG 4NE3A 3A6ND 3AZKA 3AZID 1F1EA 4KGCB 1HQ3B 2NZDA 3AFAD 5GXQD 3UT9A 5G49A 4WU9D 3MNNA 3B0BA 5GT3B 3W97B 4J8UB 3KXBB 3MGPD 5B24C 4ZUXB 3AV2D 4KGCA 1HQ3A 3AZMD 1M19B 3WAAD 3LZ1D 1ID3C 1ZLAA 5GT3A 3NQUA 3W97A 1KX4C 1KU5A 3KXBA 5FUGB 1BH9B 3REHA 5GT0B 1ULYA 4XZQB 5B2JC 4YS3D 4J8WA 5E5AC 5B1LC 3AZJA 5B32A 3C1CA 1BH9A 5DNNA 3WTPB 3O62C 3TU4B 3AYWB 3X1TB 5CPKB 3W98D 3X1SC 3KWQA 5GT0A 5BNVB 3LZ0D 1TZYD 2F8NH 1P3KA 5B24D 3MGSC 1M18B 3WKJB 3AZFC 1P3GC 5CP6B 4HGAC 3B6FB 2F8NA 3AZGA 4JJND 3MGQD 5AY8D 3AZEC 5B31B 3X1TA 3TU4A 1P3LC 3AYWA 1ID3D 1BFMA 4QLCC 3AZLD 3WA9C 5DNMB 3AV1D 3B0CW 2L5AA 1S32B 1M18A 5CP6A 3A6NB 5CPIA 2NZDC 3KUYA 1P3AD 2JSSA 4YM6B 5B2JD 3MVDA 5B31A 5E5AD 5B1LD 3MNNC 3AFAB 1JFIB 5B0ZD 5B1MA 1M1AA 4AWLC 4H9OB 3O62D 3LELC 5BO0B 4R8PD 3AZHB 3W99A 3MGPB 3X1SD 3REKD 5F99D 4YM6A 5AV5A 3AZMB 3AZFD 1ZLAC 1P34D 3WAAB 3LZ1B 3KXBC 3REHC 3AN2B 1U35A 3W96D 5BO0A 4H9SA 3AZHA 1KX3A 3WA9D 4J8WC 3R45B 1F66A 3X1UB 4KUDD 1P3BD 2BYMB 3AZJC 4YS3B 1P3MA 5B32C 3C1CC 4LD9B 5B33D 3UTBD 3AN2A 5DNNC 1N1JA 4G92C 3KWQC 3W98B 1EQZD 1P3KC 3LELD 3X1UA 3X1VD 3LZ0B 1TZYB 3AZGC 3B6GC 1P3IA 1P3OD 5AV6D 4LD9A 4JJNB 5GSUD 5B40A 4EO5C 5AY8B 3MGQB 4XUJD 4Z66C 4X23A 3LJAD 3NQJA 5JRGD 3AZND 5JA4A 5CPIC 5CP6C 3AZLB 2IO5C 1WWIA 3AV1B 4G91C 3KUYC 5BT1C 3MVDC 4J8XD 2HIOD 1P3AB 1P3FD 5B0YA 5AVBB 1KX5B 5B2ID 5AV9D 5B32G 5B1MC 4Z5TC 1M1AC 5B0ZB 3W99C 2AROD 1Q9CA 1AOIA 5AV5C 4R8PB 5CPJA 3V9RB 3REKB 4J8VB 5F99B 5AVBA 3C1BA 1KX5A 1P34B 1U35C 4NE5A 2NQBA 4WU8C 4Z66D 1KX3C 3W96B 1F66C 1R4VA 4H9RB 3REIA 5AVCD 4E44A 4J8VA 3REKA 1P3PD 1P3MC 4KUDB 1P3BB 3AN2C 5B31G 1HTAA 3REJB 5B33B 3UTBB 4Z5TD 5AV8C 3UTAD 1EQZB 1P3IC 2CV5D 4J8UA 3X1VB 3MGRD 4ZUXA 3RELD 5B40C 3REJA 5AV6B 4X23C 1P3OB 1M19A
chains in the Genus database with same CATH superfamily
4XUJB 3LJAB 4WZSB 2YFVB 5JRGB 4WU8D 3AZNB 5FUGA 3B6GD 2VQRA 5B0YC 2PYOB 2HUEC 1P3OA 4J8XB 2HIOB 4XZQA 4E45A 5B2IB 5AV9B 5JRGA 5C3IC 4DQYB 1AOIC 4ZBJC 5CPJC 2FJ7B 2AROB 3WTPA 5CPKA 2PYOA 5AVBC 3C1BC 4DRAA 1KX4D 4WV4B 3AZKC 2HIOA 5BNVA 3EPHA 3WKJA 2NQBC 2XD1A 5B2IA 3B6FA 3AZIB 4H9PB 3UT9C 2FJ7A 3REIC 4J8VC 3VH6T 5GXQB 4WU9B 5AVCB 5DNMA 1P3PB 3B0DB 4KGCC 1HQ3C 1S32A 3A6NA 3AZIA 2ZY2A 3AV2B 3MGSD 1P3GD 3AFAA 1JFIA 5GT3C 5GXQA 3W97C 4J8UC 3UTAB 4WU9A 2CWEA 2G5IC 3AZED 4H9OA 4ZUXC 1P3LD 2CV5B 4QLCD 1M19C 2Y2KA 4H9NB 1BH8B 3MGPA 3MGRB 3AV2A 3AZKD 3RELB 5KDMB 3AZMA 4H9QB 2BYKB 2NZDD 3WAAA 3LZ1A 2YFWB 3MNND 5GT0C 4XZQC 3R45A 5KDMA 4KGCD 2BYMA 5B24B 4YS3A 2G5HC 4M6BA 3X1TC 3WTPC 3TU4C 3AYWC 5CPKC 1ZLAD 5GT3D 3W98A 3KXBD 1ID3B 3REHD 3WKJC 1M18C 1KX4B 3B6FC 3LZ0A 1TZYA 2ZY3A 4WNNB 5B24A 2J8PA 4J8WD 5B31C 2FJ7C 4JJNA 3MGQA 5AY8A 3AZJD 5B2JB 5B32D 5E5AB 3C1CD 5B1LB 5DNMC 1ID3A 5DNND 3KSYA 1S32C 3A6NC 3AZLA 3AV1A 3O62B 3KWQD 4WNNA 5GT0D 4YM6C 1P3KD 3X1SB 1P3AA 2F8ND 3AFAC 5GXQC 5B2JA 3MGSB 3AZGD 4CAYB 3AZFB 5E5AA 1P3GB 5B1LA 4HGAB 5B0ZA 2Y2LA 3VH6W 4H9SC 3AZHC 3AZEB 3MGPC 5BS7A 3O62A 1P3LB 2Y2GA 3AZMC 4QLCB 4R8PA 1M18D 3V9RA 3X1SA 5CP6D 5CPID 3WA9B 5F99A 3KUYD 3WAAC 4CAYA 5BT1D 3LZ1C 3AZFA 3MVDD 1P34A 5B31D 2NZDB 3VH6A 5G49B 5B1MD 3W96A 3MNNB 1M1AD 4H9RA 3X1UC 3WA9A 3W99D 4AWLB 4YS3C 3LELB 3AL0C 4YM6D 4LD9C 5AV5D 4KUDA 1P3BA 5B33A 3UTBA 4UUZB 3W98C 1ZLAB 5GSUB 1U35D 3NQUB 1EQZA 3LZ0C 1TZYC 3REHB 3AZHD 1KX3D 3LELA 4NE6A 3X1VA 1F66D 2LY8A 4Z2MH 3MGQC 4JJNC 5AY8C 4J8WB 1P3MD 5AV6A 4UUZA 1P3FB 5GSUA 3AN2D 3AZJB 5B32B 4XUJA 3LJAA 3C1CB 3AZLC 2YFVA 3AV1C 5DNNB 3AZNA 2Y2MA 4KHAB 5AV8D 4G92B 3KFUG 2DF4C 3A1KA 3X1UD 3KWQB 1P3AC 1P3KB 1P3ID 1KX5C 4J8XA 4LD9D 1P3FA 2F8NB 3AZGB 3B6GB 5B0ZC 5B40D 5AV9A 4X23D 5BS7C 4EO5B 4KHAA 4R8PC 1B6WA 4Z66B 2AROA 3REKC 5F99C 5CPIB 2Y2NA 2IO5B 3VH5T 1P34C 4G91B 3KUYB 1WWSA 5B0YD 3B6GA 3MVDB 1TAFB 3W96C 2Y2OA 4H9PA 4Z66A 5B1MB 4Z5TB 1M1AB 4CSRB 1AOID 3A1IA 5AVCA 1P3PA 5CPJD 1P3BC 3W99B 4KUDC 1B67A 5AVBD 3WTPE 5AV5B 2ZY4A 3REJC 3C1BD 3UTBC 1TAFA 5B33C 1KX5D 2NQBD 1EQZC 4Z5TA 1U35B 4CSRA 1A7WA 1PZRA 3UTAA 3FDDA 3X1VC 3UT9D 4WU8B 5BNXB 3REID 1KX3B 4J8VD 2CV5A 1P3OC 5AV6C 1F66B 4H9NA 1BH8A 3MGRA 3RELA 5GSUC 2W8SA 2RVQC 4H9QA 4XUJC 1HQ3D 3LJAC 1P3MB 2BYKA 5JRGC 3AZNC 1N1JB 4WU8A 2YFWA 5BNXA 1H3OB 2PYOC 5AV8B 3W97D 4J8UD 4J8XC 2HIOC 1P3FC 4ZUXD 1P3IB 5B2IC 5AV9C 3REJD 2ZY5A 1M19D 2F2AC 5B40B 4X23B 2AROC 3NQJB 1H3OA 5AV8A 5JA4B 2ZM5A 1KX4A 3AZIC 4XZQD 5B0YB 2HUEB 2RVQD 3IP4C 4Z2MG 4WU9C 4WJ3C 5AVCC 1P3PC 3X1TD 3B0DC 5C3IB 3WTPD 3TU4D 3AYWD 5CPKD 1AOIB 2PYOD 4ZBJB 5CPJB 3B0CT 3AV2C 4DRBA 4NFTA 2Y2JA 3VH5W 3WKJD 3C1BB 3AZKB 3B6FD 3F6TA 5CHLB 3MGSA 2NQBB 3UTAC 1P3GA 4UPKA 2FJ7D 2CV5C 3UT9B 3AZEA 3MGRC 3REIB 3VH5A 5DNMD 3RELC 1P3LA 2F8NK 2DQNC 4QLCA 1S32D 2F8NG 4NE3A 3A6ND 3AZKA 3AZID 1F1EA 4KGCB 1HQ3B 2NZDA 3AFAD 5GXQD 3UT9A 5G49A 4WU9D 3MNNA 3B0BA 5GT3B 3W97B 4J8UB 3KXBB 3MGPD 5B24C 4ZUXB 3AV2D 4KGCA 1HQ3A 3AZMD 1M19B 2Y2QA 3WAAD 3LZ1D 1ID3C 1ZLAA 5GT3A 3NQUA 3P5JB 3W97A 1T3UA 1KU5A 1KX4C 3KXBA 5FUGB 1BH9B 3REHA 3EPLA 5GT0B 1ULYA 4XZQB 5B2JC 4YS3D 4J8WA 5E5AC 5B1LC 3AZJA 5B32A 3C1CA 1BH9A 5DNNA 3WTPB 3O62C 3TU4B 3AYWB 3X1TB 5CPKB 3W98D 3X1SC 3KWQA 5GT0A 5BNVB 3LZ0D 1TZYD 2F8NH 1Z2CB 5B24D 3MGSC 1P3KA 1M18B 3WKJB 3EPJA 3AZFC 5CP6B 1P3GC 4HGAC 3B6FB 2F8NA 3AZGA 4JJND 3MGQD 2UWXA 5AY8D 3AZEC 5B31B 3X1TA 3TU4A 1P3LC 3AYWA 1ID3D 1BFMA 4QLCC 3AZLD 3WA9C 5DNMB 3AV1D 3B0CW 2L5AA 1S32B 1M18A 5CP6A 3A6NB 5CPIA 2NZDC 3KUYA 1P3AD 2JSSA 4YM6B 5B2JD 3MVDA 5B31A 5E5AD 2JE5A 5B1LD 3MNNC 3AFAB 1JFIB 5B0ZD 2Y2HA 5B1MA 1M1AA 4AWLC 4H9OB 3O62D 3LELC 3H0MC 5BO0B 4R8PD 3AZHB 3W99A 3MGPB 3X1SD 3EG5B 3REKD 5F99D 4YM6A 5AV5A 3AZMB 3AZFD 1ZLAC 1P34D 2XD5A 3WAAB 3LZ1B 3H0LC 3KXBC 3REHC 3AN2B 1U35A 3W96D 5BO0A 3H0RC 4H9SA 3AZHA 2Y2PA 1KX3A 3WA9D 2Y2IA 4J8WC 3R45B 1F66A 3X1UB 4KUDD 1P3BD 2BYMB 3AZJC 4YS3B 1P3MA 5B32C 3C1CC 4LD9B 5B33D 3UTBD 3AN2A 5DNNC 2FFFB 1N1JA 4G92C 3KWQC 3W98B 1EQZD 1P3KC 3LELD 3X1UA 3X1VD 1W2EA 3LZ0B 1TZYB 3AZGC 3B6GC 1P3IA 1P3OD 5AV6D 4LD9A 4JJNB 5GSUD 5B40A 4EO5C 5AY8B 3MGQB 4XUJD 4Z66C 4X23A 3LJAD 3NQJA 5JRGD 3AZND 2RIQA 5JA4A 5CPIC 5CP6C 3AZLB 2IO5C 2JCHA 1WWIA 3AV1B 4G91C 3KUYC 5BT1C 3MVDC 4J8XD 2HIOD 1P3AB 1P3FD 5B0YA 5AVBB 1KX5B 5B2ID 5AV9D 5B32G 5B1MC 4Z5TC 1M1AC 5B0ZB 3W99C 2AROD 1Q9CA 1AOIA 5AV5C 4R8PB 5CPJA 3V9RB 3REKB 4J8VB 5F99B 5AVBA 3C1BA 1KX5A 1P34B 1U35C 4NE5A 2NQBA 4WU8C 4Z66D 1KX3C 3W96B 1F66C 1R4VA 4H9RB 3REIA 2BG1A 5AVCD 4E44A 3EPKA 4J8VA 3REKA 1P3PD 1P3MC 4KUDB 1P3BB 3AN2C 5B31G 1HTAA 3REJB 5B33B 3UTBB 4Z5TD 5AV8C 3UTAD 1EQZB 1P3IC 2CV5D 4J8UA 3X1VB 3MGRD 4ZUXA 3RELD 5B40C 3REJA 5AV6B 4X23C 1P3OB 1M19A
chains in the Genus database with same CATH topology
4XUJB 3LJAB 4WZSB 2YFVB 5JRGB 4WU8D 3AZNB 5FUGA 3B6GD 2VQRA 5B0YC 2PYOB 2HUEC 1P3OA 4J8XB 2HIOB 4XZQA 4E45A 5B2IB 5AV9B 5JRGA 5C3IC 4DQYB 1AOIC 4ZBJC 5CPJC 2FJ7B 2AROB 3WTPA 5CPKA 2PYOA 5AVBC 3C1BC 4DRAA 1KX4D 4WV4B 3AZKC 2HIOA 5BNVA 3EPHA 3WKJA 2NQBC 2XD1A 5B2IA 3B6FA 3AZIB 4H9PB 3UT9C 2FJ7A 3REIC 4J8VC 3VH6T 5GXQB 4WU9B 5AVCB 5DNMA 1P3PB 3B0DB 4KGCC 1HQ3C 1S32A 3A6NA 3AZIA 2ZY2A 3AV2B 3MGSD 1P3GD 3AFAA 1JFIA 5GT3C 5GXQA 3W97C 4J8UC 3UTAB 4WU9A 2CWEA 2G5IC 3AZED 4H9OA 4ZUXC 1P3LD 2CV5B 4QLCD 1M19C 2Y2KA 4H9NB 1BH8B 3MGPA 3MGRB 3AV2A 3AZKD 3RELB 5KDMB 3AZMA 4H9QB 2BYKB 2NZDD 3WAAA 3LZ1A 2YFWB 3MNND 5GT0C 4XZQC 3R45A 5KDMA 4KGCD 2BYMA 5B24B 4YS3A 2G5HC 4M6BA 3X1TC 3WTPC 3TU4C 3AYWC 5CPKC 1ZLAD 5GT3D 3W98A 3KXBD 1ID3B 3REHD 3WKJC 1M18C 1KX4B 3B6FC 3LZ0A 1TZYA 2ZY3A 4WNNB 5B24A 2J8PA 4J8WD 5B31C 2FJ7C 4JJNA 3MGQA 5AY8A 3AZJD 5B2JB 5B32D 5E5AB 3C1CD 5B1LB 5DNMC 1ID3A 5DNND 3KSYA 1S32C 3A6NC 3AZLA 3AV1A 3O62B 3KWQD 4WNNA 5GT0D 4YM6C 1P3KD 3X1SB 1P3AA 2F8ND 3AFAC 5GXQC 5B2JA 3MGSB 3AZGD 4CAYB 3AZFB 5E5AA 1P3GB 5B1LA 4HGAB 5B0ZA 2Y2LA 3VH6W 4H9SC 3AZHC 3AZEB 3MGPC 5BS7A 3O62A 1P3LB 2Y2GA 3AZMC 4QLCB 4R8PA 1M18D 3V9RA 3X1SA 5CP6D 5CPID 3WA9B 5F99A 3KUYD 3WAAC 4CAYA 5BT1D 3LZ1C 3AZFA 3MVDD 1P34A 5B31D 2NZDB 3VH6A 5G49B 5B1MD 3W96A 3MNNB 1M1AD 4H9RA 3X1UC 3WA9A 3W99D 4AWLB 4YS3C 3LELB 3AL0C 4YM6D 4LD9C 5AV5D 4KUDA 1P3BA 5B33A 3UTBA 4UUZB 3W98C 1ZLAB 5GSUB 1U35D 3NQUB 1EQZA 3LZ0C 1TZYC 3REHB 3AZHD 1KX3D 3LELA 4NE6A 3X1VA 1F66D 2LY8A 4Z2MH 3MGQC 4JJNC 5AY8C 4J8WB 1P3MD 5AV6A 4UUZA 1P3FB 5GSUA 3AN2D 3AZJB 5B32B 4XUJA 3LJAA 3C1CB 3AZLC 2YFVA 3AV1C 5DNNB 3AZNA 2Y2MA 4KHAB 5AV8D 4G92B 3KFUG 2DF4C 3A1KA 3X1UD 3KWQB 1P3AC 1P3KB 1P3ID 1KX5C 4J8XA 4LD9D 1P3FA 2F8NB 3AZGB 3B6GB 5B0ZC 5B40D 5AV9A 4X23D 5BS7C 4EO5B 4KHAA 4R8PC 1B6WA 4Z66B 2AROA 3REKC 5F99C 5CPIB 2Y2NA 2IO5B 3VH5T 1P34C 4G91B 3KUYB 1WWSA 5B0YD 3B6GA 3MVDB 1TAFB 3W96C 2Y2OA 4H9PA 4Z66A 5B1MB 4Z5TB 1M1AB 4CSRB 1AOID 3A1IA 5AVCA 1P3PA 5CPJD 1P3BC 3W99B 4KUDC 1B67A 5AVBD 3WTPE 5AV5B 2ZY4A 3REJC 3C1BD 3UTBC 1TAFA 5B33C 1KX5D 2NQBD 1EQZC 4Z5TA 1U35B 4CSRA 1A7WA 1PZRA 3UTAA 3FDDA 3X1VC 3UT9D 4WU8B 5BNXB 3REID 1KX3B 4J8VD 2CV5A 1P3OC 5AV6C 1F66B 4H9NA 1BH8A 3MGRA 3RELA 5GSUC 2W8SA 2RVQC 4H9QA 4XUJC 1HQ3D 3LJAC 1P3MB 2BYKA 5JRGC 3AZNC 1N1JB 4WU8A 2YFWA 5BNXA 1H3OB 2PYOC 5AV8B 3W97D 4J8UD 4J8XC 2HIOC 1P3FC 4ZUXD 1P3IB 5B2IC 5AV9C 3REJD 2ZY5A 1M19D 2F2AC 5B40B 4X23B 2AROC 3NQJB 1H3OA 5AV8A 5JA4B 2ZM5A 1KX4A 3AZIC 4XZQD 5B0YB 2HUEB 2RVQD 3IP4C 4Z2MG 4WU9C 4WJ3C 5AVCC 1P3PC 3X1TD 3B0DC 5C3IB 3WTPD 3TU4D 3AYWD 5CPKD 1AOIB 2PYOD 4ZBJB 5CPJB 3B0CT 3AV2C 4DRBA 4NFTA 2Y2JA 3VH5W 3WKJD 3C1BB 3AZKB 3B6FD 3F6TA 5CHLB 3MGSA 2NQBB 3UTAC 1P3GA 4UPKA 2FJ7D 2CV5C 3UT9B 3AZEA 3MGRC 3REIB 3VH5A 5DNMD 3RELC 1P3LA 2F8NK 2DQNC 4QLCA 1S32D 2F8NG 4NE3A 3A6ND 3AZKA 3AZID 1F1EA 4KGCB 1HQ3B 2NZDA 3AFAD 5GXQD 3UT9A 5G49A 4WU9D 3MNNA 3B0BA 5GT3B 3W97B 4J8UB 3KXBB 3MGPD 5B24C 4ZUXB 3AV2D 4KGCA 1HQ3A 3AZMD 1M19B 2Y2QA 3WAAD 3LZ1D 1ID3C 1ZLAA 5GT3A 3NQUA 3P5JB 3W97A 1T3UA 1KU5A 1KX4C 3KXBA 5FUGB 1BH9B 3REHA 3EPLA 5GT0B 1ULYA 4XZQB 5B2JC 4YS3D 4J8WA 5E5AC 5B1LC 3AZJA 5B32A 3C1CA 1BH9A 5DNNA 3WTPB 3O62C 3TU4B 3AYWB 3X1TB 5CPKB 3W98D 3X1SC 3KWQA 5GT0A 5BNVB 3LZ0D 1TZYD 2F8NH 1Z2CB 5B24D 3MGSC 1P3KA 1M18B 3WKJB 3EPJA 3AZFC 5CP6B 1P3GC 4HGAC 3B6FB 2F8NA 3AZGA 4JJND 3MGQD 2UWXA 5AY8D 3AZEC 5B31B 3X1TA 3TU4A 1P3LC 3AYWA 1ID3D 1BFMA 4QLCC 3AZLD 3WA9C 5DNMB 3AV1D 3B0CW 2L5AA 1S32B 1M18A 5CP6A 3A6NB 5CPIA 2NZDC 3KUYA 1P3AD 2JSSA 4YM6B 5B2JD 3MVDA 5B31A 5E5AD 2JE5A 5B1LD 3MNNC 3AFAB 1JFIB 5B0ZD 2Y2HA 5B1MA 1M1AA 4AWLC 4H9OB 3O62D 3LELC 3H0MC 5BO0B 4R8PD 3AZHB 3W99A 3MGPB 3X1SD 3EG5B 3REKD 5F99D 4YM6A 5AV5A 3AZMB 3AZFD 1ZLAC 1P34D 2XD5A 3WAAB 3LZ1B 3H0LC 3KXBC 3REHC 3AN2B 1U35A 3W96D 5BO0A 3H0RC 4H9SA 3AZHA 2Y2PA 1KX3A 3WA9D 2Y2IA 4J8WC 3R45B 1F66A 3X1UB 4KUDD 1P3BD 2BYMB 3AZJC 4YS3B 1P3MA 5B32C 3C1CC 4LD9B 5B33D 3UTBD 3AN2A 5DNNC 2FFFB 1N1JA 4G92C 3KWQC 3W98B 1EQZD 1P3KC 3LELD 3X1UA 3X1VD 1W2EA 3LZ0B 1TZYB 3AZGC 3B6GC 1P3IA 1P3OD 5AV6D 4LD9A 4JJNB 5GSUD 5B40A 4EO5C 5AY8B 3MGQB 4XUJD 4Z66C 4X23A 3LJAD 3NQJA 5JRGD 3AZND 2RIQA 5JA4A 5CPIC 5CP6C 3AZLB 2IO5C 2JCHA 1WWIA 3AV1B 4G91C 3KUYC 5BT1C 3MVDC 4J8XD 2HIOD 1P3AB 1P3FD 5B0YA 5AVBB 1KX5B 5B2ID 5AV9D 5B32G 5B1MC 4Z5TC 1M1AC 5B0ZB 3W99C 2AROD 1Q9CA 1AOIA 5AV5C 4R8PB 5CPJA 3V9RB 3REKB 4J8VB 5F99B 5AVBA 3C1BA 1KX5A 1P34B 1U35C 4NE5A 2NQBA 4WU8C 4Z66D 1KX3C 3W96B 1F66C 1R4VA 4H9RB 3REIA 2BG1A 5AVCD 4E44A 3EPKA 4J8VA 3REKA 1P3PD 1P3MC 4KUDB 1P3BB 3AN2C 5B31G 1HTAA 3REJB 5B33B 3UTBB 4Z5TD 5AV8C 3UTAD 1EQZB 1P3IC 2CV5D 4J8UA 3X1VB 3MGRD 4ZUXA 3RELD 5B40C 3REJA 5AV6B 4X23C 1P3OB 1M19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ B;  3LJA B;  4WZS B;  2YFV B;  5JRG B;  4WU8 D;  3AZN B;  5FUG A;  3B6G D;  5B0Y C;  2PYO B;  2HUE C;  1P3O A;  4J8X B;  2HIO B;  4XZQ A;  4E45 A;  5B2I B;  5AV9 B;  5JRG A;  5C3I C;  1AOI C;  4ZBJ C;  5CPJ C;  2FJ7 B;  2ARO B;  3WTP A;  5CPK A;  2PYO A;  5AVB C;  3C1B C;  4DRA A;  1KX4 D;  4WV4 B;  3AZK C;  2HIO A;  5BNV A;  3WKJ A;  2NQB C;  5B2I A;  3B6F A;  3AZI B;  4H9P B;  3UT9 C;  2FJ7 A;  3REI C;  4J8V C;  3VH6 T;  5GXQ B;  4WU9 B;  5AVC B;  5DNM A;  1P3P B;  3B0D B;  4KGC C;  1HQ3 C;  1S32 A;  3A6N A;  3AZI A;  3AV2 B;  3MGS D;  1P3G D;  3AFA A;  1JFI A;  5GT3 C;  5GXQ A;  3W97 C;  4J8U C;  3UTA B;  4WU9 A;  2CWE A;  3AZE D;  4H9O A;  4ZUX C;  1P3L D;  2CV5 B;  4QLC D;  1M19 C;  4H9N B;  1BH8 B;  3MGP A;  3MGR B;  3AV2 A;  3AZK D;  3REL B;  5KDM B;  3AZM A;  4H9Q B;  2BYK B;  2NZD D;  3WAA A;  3LZ1 A;  2YFW B;  3MNN D;  5GT0 C;  4XZQ C;  3R45 A;  5KDM A;  4KGC D;  2BYM A;  5B24 B;  4YS3 A;  4M6B A;  3X1T C;  3WTP C;  3TU4 C;  3AYW C;  5CPK C;  1ZLA D;  5GT3 D;  3W98 A;  3KXB D;  1ID3 B;  3REH D;  3WKJ C;  1M18 C;  1KX4 B;  3B6F C;  3LZ0 A;  1TZY A;  4WNN B;  5B24 A;  4J8W D;  5B31 C;  2FJ7 C;  4JJN A;  3MGQ A;  5AY8 A;  3AZJ D;  5B2J B;  5B32 D;  5E5A B;  3C1C D;  5B1L B;  5DNM C;  1ID3 A;  5DNN D;  3KSY A;  1S32 C;  3A6N C;  3AZL A;  3AV1 A;  3O62 B;  3KWQ D;  4WNN A;  5GT0 D;  4YM6 C;  1P3K D;  3X1S B;  1P3A A;  2F8N D;  3AFA C;  5GXQ C;  5B2J A;  3MGS B;  3AZG D;  4CAY B;  3AZF B;  5E5A A;  1P3G B;  5B1L A;  4HGA B;  5B0Z A;  3VH6 W;  4H9S C;  3AZH C;  3AZE B;  3MGP C;  5BS7 A;  3O62 A;  1P3L B;  3AZM C;  4QLC B;  4R8P A;  1M18 D;  3V9R A;  3X1S A;  5CP6 D;  5CPI D;  3WA9 B;  5F99 A;  3KUY D;  3WAA C;  4CAY A;  5BT1 D;  3LZ1 C;  3AZF A;  3MVD D;  1P34 A;  5B31 D;  2NZD B;  3VH6 A;  5G49 B;  5B1M D;  3W96 A;  3MNN B;  1M1A D;  4H9R A;  3X1U C;  3WA9 A;  3W99 D;  4AWL B;  4YS3 C;  3LEL B;  4YM6 D;  4LD9 C;  5AV5 D;  4KUD A;  1P3B A;  5B33 A;  3UTB A;  4UUZ B;  3W98 C;  1ZLA B;  5GSU B;  1U35 D;  3NQU B;  1EQZ A;  3LZ0 C;  1TZY C;  3REH B;  3AZH D;  1KX3 D;  3LEL A;  4NE6 A;  3X1V A;  1F66 D;  2LY8 A;  4Z2M H;  3MGQ C;  4JJN C;  5AY8 C;  4J8W B;  1P3M D;  5AV6 A;  4UUZ A;  1P3F B;  5GSU A;  3AN2 D;  3AZJ B;  5B32 B;  4XUJ A;  3LJA A;  3C1C B;  3AZL C;  2YFV A;  3AV1 C;  5DNN B;  3AZN A;  4KHA B;  5AV8 D;  4G92 B;  3X1U D;  3KWQ B;  1P3A C;  1P3K B;  1P3I D;  1KX5 C;  4J8X A;  4LD9 D;  1P3F A;  2F8N B;  3AZG B;  3B6G B;  5B0Z C;  5B40 D;  5AV9 A;  4X23 D;  5BS7 C;  4EO5 B;  4KHA A;  4R8P C;  1B6W A;  4Z66 B;  2ARO A;  3REK C;  5F99 C;  5CPI B;  2IO5 B;  3VH5 T;  1P34 C;  4G91 B;  3KUY B;  1WWS A;  5B0Y D;  3B6G A;  3MVD B;  1TAF B;  3W96 C;  4H9P A;  4Z66 A;  5B1M B;  4Z5T B;  1M1A B;  4CSR B;  1AOI D;  5AVC A;  1P3P A;  5CPJ D;  1P3B C;  3W99 B;  4KUD C;  1B67 A;  5AVB D;  3WTP E;  5AV5 B;  3REJ C;  3UTB C;  3C1B D;  5B33 C;  1TAF A;  1KX5 D;  2NQB D;  1EQZ C;  4Z5T A;  1U35 B;  4CSR A;  1A7W A;  3UTA A;  3X1V C;  3UT9 D;  4WU8 B;  5BNX B;  3REI D;  1KX3 B;  4J8V D;  2CV5 A;  1P3O C;  5AV6 C;  1F66 B;  4H9N A;  1BH8 A;  3MGR A;  3REL A;  5GSU C;  2RVQ C;  4H9Q A;  4XUJ C;  1HQ3 D;  3LJA C;  1P3M B;  2BYK A;  5JRG C;  3AZN C;  1N1J B;  4WU8 A;  2YFW A;  5BNX A;  1H3O B;  2PYO C;  5AV8 B;  3W97 D;  4J8U D;  4J8X C;  2HIO C;  1P3F C;  4ZUX D;  1P3I B;  5B2I C;  5AV9 C;  3REJ D;  1M19 D;  5B40 B;  4X23 B;  2ARO C;  3NQJ B;  1H3O A;  5AV8 A;  5JA4 B;  1KX4 A;  3AZI C;  4XZQ D;  5B0Y B;  2HUE B;  2RVQ D;  4Z2M G;  4WU9 C;  5AVC C;  1P3P C;  3X1T D;  3B0D C;  5C3I B;  3WTP D;  3TU4 D;  3AYW D;  5CPK D;  1AOI B;  2PYO D;  4ZBJ B;  5CPJ B;  3B0C T;  3AV2 C;  4DRB A;  4NFT A;  3VH5 W;  3WKJ D;  3C1B B;  3AZK B;  3B6F D;  5CHL B;  3MGS A;  2NQB B;  3UTA C;  1P3G A;  2FJ7 D;  2CV5 C;  3UT9 B;  3AZE A;  3MGR C;  3REI B;  3VH5 A;  5DNM D;  3REL C;  1P3L A;  2F8N K;  4QLC A;  1S32 D;  2F8N G;  4NE3 A;  3A6N D;  3AZK A;  3AZI D;  1F1E A;  4KGC B;  1HQ3 B;  2NZD A;  3AFA D;  5GXQ D;  3UT9 A;  5G49 A;  4WU9 D;  3MNN A;  3B0B A;  5GT3 B;  3W97 B;  4J8U B;  3KXB B;  3MGP D;  5B24 C;  4ZUX B;  3AV2 D;  4KGC A;  1HQ3 A;  3AZM D;  1M19 B;  3WAA D;  3LZ1 D;  1ID3 C;  1ZLA A;  5GT3 A;  3NQU A;  3W97 A;  1KX4 C;  1KU5 A;  3KXB A;  5FUG B;  1BH9 B;  3REH A;  5GT0 B;  1ULY A;  4XZQ B;  5B2J C;  4YS3 D;  4J8W A;  5E5A C;  5B1L C;  3AZJ A;  5B32 A;  3C1C A;  1BH9 A;  5DNN A;  3WTP B;  3O62 C;  3TU4 B;  3AYW B;  3X1T B;  5CPK B;  3W98 D;  3X1S C;  3KWQ A;  5GT0 A;  5BNV B;  3LZ0 D;  1TZY D;  2F8N H;  1P3K A;  5B24 D;  3MGS C;  1M18 B;  3WKJ B;  3AZF C;  1P3G C;  5CP6 B;  4HGA C;  3B6F B;  2F8N A;  3AZG A;  4JJN D;  3MGQ D;  5AY8 D;  3AZE C;  5B31 B;  3X1T A;  3TU4 A;  1P3L C;  3AYW A;  1ID3 D;  1BFM A;  4QLC C;  3AZL D;  3WA9 C;  5DNM B;  3AV1 D;  3B0C W;  2L5A A;  1S32 B;  1M18 A;  5CP6 A;  3A6N B;  5CPI A;  2NZD C;  3KUY A;  1P3A D;  2JSS A;  4YM6 B;  5B2J D;  3MVD A;  5B31 A;  5E5A D;  5B1L D;  3MNN C;  3AFA B;  1JFI B;  5B0Z D;  5B1M A;  1M1A A;  4AWL C;  4H9O B;  3O62 D;  3LEL C;  5BO0 B;  4R8P D;  3AZH B;  3W99 A;  3MGP B;  3X1S D;  3REK D;  5F99 D;  4YM6 A;  5AV5 A;  3AZM B;  3AZF D;  1ZLA C;  1P34 D;  3WAA B;  3LZ1 B;  3KXB C;  3REH C;  3AN2 B;  1U35 A;  3W96 D;  5BO0 A;  4H9S A;  3AZH A;  1KX3 A;  3WA9 D;  4J8W C;  3R45 B;  1F66 A;  3X1U B;  4KUD D;  1P3B D;  2BYM B;  3AZJ C;  4YS3 B;  1P3M A;  5B32 C;  3C1C C;  4LD9 B;  5B33 D;  3UTB D;  3AN2 A;  5DNN C;  1N1J A;  4G92 C;  3KWQ C;  3W98 B;  1EQZ D;  1P3K C;  3LEL D;  3X1U A;  3X1V D;  3LZ0 B;  1TZY B;  3AZG C;  3B6G C;  1P3I A;  1P3O D;  5AV6 D;  4LD9 A;  4JJN B;  5GSU D;  5B40 A;  4EO5 C;  5AY8 B;  3MGQ B;  4XUJ D;  4Z66 C;  4X23 A;  3LJA D;  3NQJ A;  5JRG D;  3AZN D;  5JA4 A;  5CPI C;  5CP6 C;  3AZL B;  2IO5 C;  1WWI A;  3AV1 B;  4G91 C;  3KUY C;  5BT1 C;  3MVD C;  4J8X D;  2HIO D;  1P3A B;  1P3F D;  5B0Y A;  5AVB B;  1KX5 B;  5B2I D;  5AV9 D;  5B32 G;  5B1M C;  4Z5T C;  1M1A C;  5B0Z B;  3W99 C;  2ARO D;  1Q9C A;  1AOI A;  5AV5 C;  4R8P B;  5CPJ A;  3V9R B;  3REK B;  4J8V B;  5F99 B;  5AVB A;  3C1B A;  1KX5 A;  1P34 B;  1U35 C;  4NE5 A;  2NQB A;  4WU8 C;  4Z66 D;  1KX3 C;  3W96 B;  1F66 C;  1R4V A;  4H9R B;  3REI A;  5AVC D;  4E44 A;  4J8V A;  3REK A;  1P3P D;  1P3M C;  4KUD B;  1P3B B;  3AN2 C;  5B31 G;  1HTA A;  3REJ B;  5B33 B;  3UTB B;  4Z5T D;  5AV8 C;  3UTA D;  1EQZ B;  1P3I C;  2CV5 D;  4J8U A;  3X1V B;  3MGR D;  4ZUX A;  3REL D;  5B40 C;  3REJ A;  5AV6 B;  4X23 C;  1P3O B;  1M19 A; 
#chains in the Genus database with same CATH topology
 4XUJ B;  3LJA B;  4WZS B;  2YFV B;  5JRG B;  4WU8 D;  3AZN B;  5FUG A;  3B6G D;  2VQR A;  5B0Y C;  2PYO B;  2HUE C;  1P3O A;  4J8X B;  2HIO B;  4XZQ A;  4E45 A;  5B2I B;  5AV9 B;  5JRG A;  5C3I C;  4DQY B;  1AOI C;  4ZBJ C;  5CPJ C;  2FJ7 B;  2ARO B;  3WTP A;  5CPK A;  2PYO A;  5AVB C;  3C1B C;  4DRA A;  1KX4 D;  4WV4 B;  3AZK C;  2HIO A;  5BNV A;  3EPH A;  3WKJ A;  2NQB C;  2XD1 A;  5B2I A;  3B6F A;  3AZI B;  4H9P B;  3UT9 C;  2FJ7 A;  3REI C;  4J8V C;  3VH6 T;  5GXQ B;  4WU9 B;  5AVC B;  5DNM A;  1P3P B;  3B0D B;  4KGC C;  1HQ3 C;  1S32 A;  3A6N A;  3AZI A;  2ZY2 A;  3AV2 B;  3MGS D;  1P3G D;  3AFA A;  1JFI A;  5GT3 C;  5GXQ A;  3W97 C;  4J8U C;  3UTA B;  4WU9 A;  2CWE A;  2G5I C;  3AZE D;  4H9O A;  4ZUX C;  1P3L D;  2CV5 B;  4QLC D;  1M19 C;  2Y2K A;  4H9N B;  1BH8 B;  3MGP A;  3MGR B;  3AV2 A;  3AZK D;  3REL B;  5KDM B;  3AZM A;  4H9Q B;  2BYK B;  2NZD D;  3WAA A;  3LZ1 A;  2YFW B;  3MNN D;  5GT0 C;  4XZQ C;  3R45 A;  5KDM A;  4KGC D;  2BYM A;  5B24 B;  4YS3 A;  2G5H C;  4M6B A;  3X1T C;  3WTP C;  3TU4 C;  3AYW C;  5CPK C;  1ZLA D;  5GT3 D;  3W98 A;  3KXB D;  1ID3 B;  3REH D;  3WKJ C;  1M18 C;  1KX4 B;  3B6F C;  3LZ0 A;  1TZY A;  2ZY3 A;  4WNN B;  5B24 A;  2J8P A;  4J8W D;  5B31 C;  2FJ7 C;  4JJN A;  3MGQ A;  5AY8 A;  3AZJ D;  5B2J B;  5B32 D;  5E5A B;  3C1C D;  5B1L B;  5DNM C;  1ID3 A;  5DNN D;  3KSY A;  1S32 C;  3A6N C;  3AZL A;  3AV1 A;  3O62 B;  3KWQ D;  4WNN A;  5GT0 D;  4YM6 C;  1P3K D;  3X1S B;  1P3A A;  2F8N D;  3AFA C;  5GXQ C;  5B2J A;  3MGS B;  3AZG D;  4CAY B;  3AZF B;  5E5A A;  1P3G B;  5B1L A;  4HGA B;  5B0Z A;  2Y2L A;  3VH6 W;  4H9S C;  3AZH C;  3AZE B;  3MGP C;  5BS7 A;  3O62 A;  1P3L B;  2Y2G A;  3AZM C;  4QLC B;  4R8P A;  1M18 D;  3V9R A;  3X1S A;  5CP6 D;  5CPI D;  3WA9 B;  5F99 A;  3KUY D;  3WAA C;  4CAY A;  5BT1 D;  3LZ1 C;  3AZF A;  3MVD D;  1P34 A;  5B31 D;  2NZD B;  3VH6 A;  5G49 B;  5B1M D;  3W96 A;  3MNN B;  1M1A D;  4H9R A;  3X1U C;  3WA9 A;  3W99 D;  4AWL B;  4YS3 C;  3LEL B;  3AL0 C;  4YM6 D;  4LD9 C;  5AV5 D;  4KUD A;  1P3B A;  5B33 A;  3UTB A;  4UUZ B;  3W98 C;  1ZLA B;  5GSU B;  1U35 D;  3NQU B;  1EQZ A;  3LZ0 C;  1TZY C;  3REH B;  3AZH D;  1KX3 D;  3LEL A;  4NE6 A;  3X1V A;  1F66 D;  2LY8 A;  4Z2M H;  3MGQ C;  4JJN C;  5AY8 C;  4J8W B;  1P3M D;  5AV6 A;  4UUZ A;  1P3F B;  5GSU A;  3AN2 D;  3AZJ B;  5B32 B;  4XUJ A;  3LJA A;  3C1C B;  3AZL C;  2YFV A;  3AV1 C;  5DNN B;  3AZN A;  2Y2M A;  4KHA B;  5AV8 D;  4G92 B;  3KFU G;  2DF4 C;  3A1K A;  3X1U D;  3KWQ B;  1P3A C;  1P3K B;  1P3I D;  1KX5 C;  4J8X A;  4LD9 D;  1P3F A;  2F8N B;  3AZG B;  3B6G B;  5B0Z C;  5B40 D;  5AV9 A;  4X23 D;  5BS7 C;  4EO5 B;  4KHA A;  4R8P C;  1B6W A;  4Z66 B;  2ARO A;  3REK C;  5F99 C;  5CPI B;  2Y2N A;  2IO5 B;  3VH5 T;  1P34 C;  4G91 B;  3KUY B;  1WWS A;  5B0Y D;  3B6G A;  3MVD B;  1TAF B;  3W96 C;  2Y2O A;  4H9P A;  4Z66 A;  5B1M B;  4Z5T B;  1M1A B;  4CSR B;  1AOI D;  3A1I A;  5AVC A;  1P3P A;  5CPJ D;  1P3B C;  3W99 B;  4KUD C;  1B67 A;  5AVB D;  3WTP E;  5AV5 B;  2ZY4 A;  3REJ C;  3C1B D;  3UTB C;  1TAF A;  5B33 C;  1KX5 D;  2NQB D;  1EQZ C;  4Z5T A;  1U35 B;  4CSR A;  1A7W A;  1PZR A;  3UTA A;  3FDD A;  3X1V C;  3UT9 D;  4WU8 B;  5BNX B;  3REI D;  1KX3 B;  4J8V D;  2CV5 A;  1P3O C;  5AV6 C;  1F66 B;  4H9N A;  1BH8 A;  3MGR A;  3REL A;  5GSU C;  2W8S A;  2RVQ C;  4H9Q A;  4XUJ C;  1HQ3 D;  3LJA C;  1P3M B;  2BYK A;  5JRG C;  3AZN C;  1N1J B;  4WU8 A;  2YFW A;  5BNX A;  1H3O B;  2PYO C;  5AV8 B;  3W97 D;  4J8U D;  4J8X C;  2HIO C;  1P3F C;  4ZUX D;  1P3I B;  5B2I C;  5AV9 C;  3REJ D;  2ZY5 A;  1M19 D;  2F2A C;  5B40 B;  4X23 B;  2ARO C;  3NQJ B;  1H3O A;  5AV8 A;  5JA4 B;  2ZM5 A;  1KX4 A;  3AZI C;  4XZQ D;  5B0Y B;  2HUE B;  2RVQ D;  3IP4 C;  4Z2M G;  4WU9 C;  4WJ3 C;  5AVC C;  1P3P C;  3X1T D;  3B0D C;  5C3I B;  3WTP D;  3TU4 D;  3AYW D;  5CPK D;  1AOI B;  2PYO D;  4ZBJ B;  5CPJ B;  3B0C T;  3AV2 C;  4DRB A;  4NFT A;  2Y2J A;  3VH5 W;  3WKJ D;  3C1B B;  3AZK B;  3B6F D;  3F6T A;  5CHL B;  3MGS A;  2NQB B;  3UTA C;  1P3G A;  4UPK A;  2FJ7 D;  2CV5 C;  3UT9 B;  3AZE A;  3MGR C;  3REI B;  3VH5 A;  5DNM D;  3REL C;  1P3L A;  2F8N K;  2DQN C;  4QLC A;  1S32 D;  2F8N G;  4NE3 A;  3A6N D;  3AZK A;  3AZI D;  1F1E A;  4KGC B;  1HQ3 B;  2NZD A;  3AFA D;  5GXQ D;  3UT9 A;  5G49 A;  4WU9 D;  3MNN A;  3B0B A;  5GT3 B;  3W97 B;  4J8U B;  3KXB B;  3MGP D;  5B24 C;  4ZUX B;  3AV2 D;  4KGC A;  1HQ3 A;  3AZM D;  1M19 B;  2Y2Q A;  3WAA D;  3LZ1 D;  1ID3 C;  1ZLA A;  5GT3 A;  3NQU A;  3P5J B;  3W97 A;  1T3U A;  1KU5 A;  1KX4 C;  3KXB A;  5FUG B;  1BH9 B;  3REH A;  3EPL A;  5GT0 B;  1ULY A;  4XZQ B;  5B2J C;  4YS3 D;  4J8W A;  5E5A C;  5B1L C;  3AZJ A;  5B32 A;  3C1C A;  1BH9 A;  5DNN A;  3WTP B;  3O62 C;  3TU4 B;  3AYW B;  3X1T B;  5CPK B;  3W98 D;  3X1S C;  3KWQ A;  5GT0 A;  5BNV B;  3LZ0 D;  1TZY D;  2F8N H;  1Z2C B;  5B24 D;  3MGS C;  1P3K A;  1M18 B;  3WKJ B;  3EPJ A;  3AZF C;  5CP6 B;  1P3G C;  4HGA C;  3B6F B;  2F8N A;  3AZG A;  4JJN D;  3MGQ D;  2UWX A;  5AY8 D;  3AZE C;  5B31 B;  3X1T A;  3TU4 A;  1P3L C;  3AYW A;  1ID3 D;  1BFM A;  4QLC C;  3AZL D;  3WA9 C;  5DNM B;  3AV1 D;  3B0C W;  2L5A A;  1S32 B;  1M18 A;  5CP6 A;  3A6N B;  5CPI A;  2NZD C;  3KUY A;  1P3A D;  2JSS A;  4YM6 B;  5B2J D;  3MVD A;  5B31 A;  5E5A D;  2JE5 A;  5B1L D;  3MNN C;  3AFA B;  1JFI B;  5B0Z D;  2Y2H A;  5B1M A;  1M1A A;  4AWL C;  4H9O B;  3O62 D;  3LEL C;  3H0M C;  5BO0 B;  4R8P D;  3AZH B;  3W99 A;  3MGP B;  3X1S D;  3EG5 B;  3REK D;  5F99 D;  4YM6 A;  5AV5 A;  3AZM B;  3AZF D;  1ZLA C;  1P34 D;  2XD5 A;  3WAA B;  3LZ1 B;  3H0L C;  3KXB C;  3REH C;  3AN2 B;  1U35 A;  3W96 D;  5BO0 A;  3H0R C;  4H9S A;  3AZH A;  2Y2P A;  1KX3 A;  3WA9 D;  2Y2I A;  4J8W C;  3R45 B;  1F66 A;  3X1U B;  4KUD D;  1P3B D;  2BYM B;  3AZJ C;  4YS3 B;  1P3M A;  5B32 C;  3C1C C;  4LD9 B;  5B33 D;  3UTB D;  3AN2 A;  5DNN C;  2FFF B;  1N1J A;  4G92 C;  3KWQ C;  3W98 B;  1EQZ D;  1P3K C;  3LEL D;  3X1U A;  3X1V D;  1W2E A;  3LZ0 B;  1TZY B;  3AZG C;  3B6G C;  1P3I A;  1P3O D;  5AV6 D;  4LD9 A;  4JJN B;  5GSU D;  5B40 A;  4EO5 C;  5AY8 B;  3MGQ B;  4XUJ D;  4Z66 C;  4X23 A;  3LJA D;  3NQJ A;  5JRG D;  3AZN D;  2RIQ A;  5JA4 A;  5CPI C;  5CP6 C;  3AZL B;  2IO5 C;  2JCH A;  1WWI A;  3AV1 B;  4G91 C;  3KUY C;  5BT1 C;  3MVD C;  4J8X D;  2HIO D;  1P3A B;  1P3F D;  5B0Y A;  5AVB B;  1KX5 B;  5B2I D;  5AV9 D;  5B32 G;  5B1M C;  4Z5T C;  1M1A C;  5B0Z B;  3W99 C;  2ARO D;  1Q9C A;  1AOI A;  5AV5 C;  4R8P B;  5CPJ A;  3V9R B;  3REK B;  4J8V B;  5F99 B;  5AVB A;  3C1B A;  1KX5 A;  1P34 B;  1U35 C;  4NE5 A;  2NQB A;  4WU8 C;  4Z66 D;  1KX3 C;  3W96 B;  1F66 C;  1R4V A;  4H9R B;  3REI A;  2BG1 A;  5AVC D;  4E44 A;  3EPK A;  4J8V A;  3REK A;  1P3P D;  1P3M C;  4KUD B;  1P3B B;  3AN2 C;  5B31 G;  1HTA A;  3REJ B;  5B33 B;  3UTB B;  4Z5T D;  5AV8 C;  3UTA D;  1EQZ B;  1P3I C;  2CV5 D;  4J8U A;  3X1V B;  3MGR D;  4ZUX A;  3REL D;  5B40 C;  3REJ A;  5AV6 B;  4X23 C;  1P3O B;  1M19 A; 
#chains in the Genus database with same CATH homology
 4XUJ B;  3LJA B;  4WZS B;  2YFV B;  5JRG B;  4WU8 D;  3AZN B;  5FUG A;  3B6G D;  2VQR A;  5B0Y C;  2PYO B;  2HUE C;  1P3O A;  4J8X B;  2HIO B;  4XZQ A;  4E45 A;  5B2I B;  5AV9 B;  5JRG A;  5C3I C;  4DQY B;  1AOI C;  4ZBJ C;  5CPJ C;  2FJ7 B;  2ARO B;  3WTP A;  5CPK A;  2PYO A;  5AVB C;  3C1B C;  4DRA A;  1KX4 D;  4WV4 B;  3AZK C;  2HIO A;  5BNV A;  3EPH A;  3WKJ A;  2NQB C;  2XD1 A;  5B2I A;  3B6F A;  3AZI B;  4H9P B;  3UT9 C;  2FJ7 A;  3REI C;  4J8V C;  3VH6 T;  5GXQ B;  4WU9 B;  5AVC B;  5DNM A;  1P3P B;  3B0D B;  4KGC C;  1HQ3 C;  1S32 A;  3A6N A;  3AZI A;  2ZY2 A;  3AV2 B;  3MGS D;  1P3G D;  3AFA A;  1JFI A;  5GT3 C;  5GXQ A;  3W97 C;  4J8U C;  3UTA B;  4WU9 A;  2CWE A;  2G5I C;  3AZE D;  4H9O A;  4ZUX C;  1P3L D;  2CV5 B;  4QLC D;  1M19 C;  2Y2K A;  4H9N B;  1BH8 B;  3MGP A;  3MGR B;  3AV2 A;  3AZK D;  3REL B;  5KDM B;  3AZM A;  4H9Q B;  2BYK B;  2NZD D;  3WAA A;  3LZ1 A;  2YFW B;  3MNN D;  5GT0 C;  4XZQ C;  3R45 A;  5KDM A;  4KGC D;  2BYM A;  5B24 B;  4YS3 A;  2G5H C;  4M6B A;  3X1T C;  3WTP C;  3TU4 C;  3AYW C;  5CPK C;  1ZLA D;  5GT3 D;  3W98 A;  3KXB D;  1ID3 B;  3REH D;  3WKJ C;  1M18 C;  1KX4 B;  3B6F C;  3LZ0 A;  1TZY A;  2ZY3 A;  4WNN B;  5B24 A;  2J8P A;  4J8W D;  5B31 C;  2FJ7 C;  4JJN A;  3MGQ A;  5AY8 A;  3AZJ D;  5B2J B;  5B32 D;  5E5A B;  3C1C D;  5B1L B;  5DNM C;  1ID3 A;  5DNN D;  3KSY A;  1S32 C;  3A6N C;  3AZL A;  3AV1 A;  3O62 B;  3KWQ D;  4WNN A;  5GT0 D;  4YM6 C;  1P3K D;  3X1S B;  1P3A A;  2F8N D;  3AFA C;  5GXQ C;  5B2J A;  3MGS B;  3AZG D;  4CAY B;  3AZF B;  5E5A A;  1P3G B;  5B1L A;  4HGA B;  5B0Z A;  2Y2L A;  3VH6 W;  4H9S C;  3AZH C;  3AZE B;  3MGP C;  5BS7 A;  3O62 A;  1P3L B;  2Y2G A;  3AZM C;  4QLC B;  4R8P A;  1M18 D;  3V9R A;  3X1S A;  5CP6 D;  5CPI D;  3WA9 B;  5F99 A;  3KUY D;  3WAA C;  4CAY A;  5BT1 D;  3LZ1 C;  3AZF A;  3MVD D;  1P34 A;  5B31 D;  2NZD B;  3VH6 A;  5G49 B;  5B1M D;  3W96 A;  3MNN B;  1M1A D;  4H9R A;  3X1U C;  3WA9 A;  3W99 D;  4AWL B;  4YS3 C;  3LEL B;  3AL0 C;  4YM6 D;  4LD9 C;  5AV5 D;  4KUD A;  1P3B A;  5B33 A;  3UTB A;  4UUZ B;  3W98 C;  1ZLA B;  5GSU B;  1U35 D;  3NQU B;  1EQZ A;  3LZ0 C;  1TZY C;  3REH B;  3AZH D;  1KX3 D;  3LEL A;  4NE6 A;  3X1V A;  1F66 D;  2LY8 A;  4Z2M H;  3MGQ C;  4JJN C;  5AY8 C;  4J8W B;  1P3M D;  5AV6 A;  4UUZ A;  1P3F B;  5GSU A;  3AN2 D;  3AZJ B;  5B32 B;  4XUJ A;  3LJA A;  3C1C B;  3AZL C;  2YFV A;  3AV1 C;  5DNN B;  3AZN A;  2Y2M A;  4KHA B;  5AV8 D;  4G92 B;  3KFU G;  2DF4 C;  3A1K A;  3X1U D;  3KWQ B;  1P3A C;  1P3K B;  1P3I D;  1KX5 C;  4J8X A;  4LD9 D;  1P3F A;  2F8N B;  3AZG B;  3B6G B;  5B0Z C;  5B40 D;  5AV9 A;  4X23 D;  5BS7 C;  4EO5 B;  4KHA A;  4R8P C;  1B6W A;  4Z66 B;  2ARO A;  3REK C;  5F99 C;  5CPI B;  2Y2N A;  2IO5 B;  3VH5 T;  1P34 C;  4G91 B;  3KUY B;  1WWS A;  5B0Y D;  3B6G A;  3MVD B;  1TAF B;  3W96 C;  2Y2O A;  4H9P A;  4Z66 A;  5B1M B;  4Z5T B;  1M1A B;  4CSR B;  1AOI D;  3A1I A;  5AVC A;  1P3P A;  5CPJ D;  1P3B C;  3W99 B;  4KUD C;  1B67 A;  5AVB D;  3WTP E;  5AV5 B;  2ZY4 A;  3REJ C;  3C1B D;  3UTB C;  1TAF A;  5B33 C;  1KX5 D;  2NQB D;  1EQZ C;  4Z5T A;  1U35 B;  4CSR A;  1A7W A;  1PZR A;  3UTA A;  3FDD A;  3X1V C;  3UT9 D;  4WU8 B;  5BNX B;  3REI D;  1KX3 B;  4J8V D;  2CV5 A;  1P3O C;  5AV6 C;  1F66 B;  4H9N A;  1BH8 A;  3MGR A;  3REL A;  5GSU C;  2W8S A;  2RVQ C;  4H9Q A;  4XUJ C;  1HQ3 D;  3LJA C;  1P3M B;  2BYK A;  5JRG C;  3AZN C;  1N1J B;  4WU8 A;  2YFW A;  5BNX A;  1H3O B;  2PYO C;  5AV8 B;  3W97 D;  4J8U D;  4J8X C;  2HIO C;  1P3F C;  4ZUX D;  1P3I B;  5B2I C;  5AV9 C;  3REJ D;  2ZY5 A;  1M19 D;  2F2A C;  5B40 B;  4X23 B;  2ARO C;  3NQJ B;  1H3O A;  5AV8 A;  5JA4 B;  2ZM5 A;  1KX4 A;  3AZI C;  4XZQ D;  5B0Y B;  2HUE B;  2RVQ D;  3IP4 C;  4Z2M G;  4WU9 C;  4WJ3 C;  5AVC C;  1P3P C;  3X1T D;  3B0D C;  5C3I B;  3WTP D;  3TU4 D;  3AYW D;  5CPK D;  1AOI B;  2PYO D;  4ZBJ B;  5CPJ B;  3B0C T;  3AV2 C;  4DRB A;  4NFT A;  2Y2J A;  3VH5 W;  3WKJ D;  3C1B B;  3AZK B;  3B6F D;  3F6T A;  5CHL B;  3MGS A;  2NQB B;  3UTA C;  1P3G A;  4UPK A;  2FJ7 D;  2CV5 C;  3UT9 B;  3AZE A;  3MGR C;  3REI B;  3VH5 A;  5DNM D;  3REL C;  1P3L A;  2F8N K;  2DQN C;  4QLC A;  1S32 D;  2F8N G;  4NE3 A;  3A6N D;  3AZK A;  3AZI D;  1F1E A;  4KGC B;  1HQ3 B;  2NZD A;  3AFA D;  5GXQ D;  3UT9 A;  5G49 A;  4WU9 D;  3MNN A;  3B0B A;  5GT3 B;  3W97 B;  4J8U B;  3KXB B;  3MGP D;  5B24 C;  4ZUX B;  3AV2 D;  4KGC A;  1HQ3 A;  3AZM D;  1M19 B;  2Y2Q A;  3WAA D;  3LZ1 D;  1ID3 C;  1ZLA A;  5GT3 A;  3NQU A;  3P5J B;  3W97 A;  1T3U A;  1KU5 A;  1KX4 C;  3KXB A;  5FUG B;  1BH9 B;  3REH A;  3EPL A;  5GT0 B;  1ULY A;  4XZQ B;  5B2J C;  4YS3 D;  4J8W A;  5E5A C;  5B1L C;  3AZJ A;  5B32 A;  3C1C A;  1BH9 A;  5DNN A;  3WTP B;  3O62 C;  3TU4 B;  3AYW B;  3X1T B;  5CPK B;  3W98 D;  3X1S C;  3KWQ A;  5GT0 A;  5BNV B;  3LZ0 D;  1TZY D;  2F8N H;  1Z2C B;  5B24 D;  3MGS C;  1P3K A;  1M18 B;  3WKJ B;  3EPJ A;  3AZF C;  5CP6 B;  1P3G C;  4HGA C;  3B6F B;  2F8N A;  3AZG A;  4JJN D;  3MGQ D;  2UWX A;  5AY8 D;  3AZE C;  5B31 B;  3X1T A;  3TU4 A;  1P3L C;  3AYW A;  1ID3 D;  1BFM A;  4QLC C;  3AZL D;  3WA9 C;  5DNM B;  3AV1 D;  3B0C W;  2L5A A;  1S32 B;  1M18 A;  5CP6 A;  3A6N B;  5CPI A;  2NZD C;  3KUY A;  1P3A D;  2JSS A;  4YM6 B;  5B2J D;  3MVD A;  5B31 A;  5E5A D;  2JE5 A;  5B1L D;  3MNN C;  3AFA B;  1JFI B;  5B0Z D;  2Y2H A;  5B1M A;  1M1A A;  4AWL C;  4H9O B;  3O62 D;  3LEL C;  3H0M C;  5BO0 B;  4R8P D;  3AZH B;  3W99 A;  3MGP B;  3X1S D;  3EG5 B;  3REK D;  5F99 D;  4YM6 A;  5AV5 A;  3AZM B;  3AZF D;  1ZLA C;  1P34 D;  2XD5 A;  3WAA B;  3LZ1 B;  3H0L C;  3KXB C;  3REH C;  3AN2 B;  1U35 A;  3W96 D;  5BO0 A;  3H0R C;  4H9S A;  3AZH A;  2Y2P A;  1KX3 A;  3WA9 D;  2Y2I A;  4J8W C;  3R45 B;  1F66 A;  3X1U B;  4KUD D;  1P3B D;  2BYM B;  3AZJ C;  4YS3 B;  1P3M A;  5B32 C;  3C1C C;  4LD9 B;  5B33 D;  3UTB D;  3AN2 A;  5DNN C;  2FFF B;  1N1J A;  4G92 C;  3KWQ C;  3W98 B;  1EQZ D;  1P3K C;  3LEL D;  3X1U A;  3X1V D;  1W2E A;  3LZ0 B;  1TZY B;  3AZG C;  3B6G C;  1P3I A;  1P3O D;  5AV6 D;  4LD9 A;  4JJN B;  5GSU D;  5B40 A;  4EO5 C;  5AY8 B;  3MGQ B;  4XUJ D;  4Z66 C;  4X23 A;  3LJA D;  3NQJ A;  5JRG D;  3AZN D;  2RIQ A;  5JA4 A;  5CPI C;  5CP6 C;  3AZL B;  2IO5 C;  2JCH A;  1WWI A;  3AV1 B;  4G91 C;  3KUY C;  5BT1 C;  3MVD C;  4J8X D;  2HIO D;  1P3A B;  1P3F D;  5B0Y A;  5AVB B;  1KX5 B;  5B2I D;  5AV9 D;  5B32 G;  5B1M C;  4Z5T C;  1M1A C;  5B0Z B;  3W99 C;  2ARO D;  1Q9C A;  1AOI A;  5AV5 C;  4R8P B;  5CPJ A;  3V9R B;  3REK B;  4J8V B;  5F99 B;  5AVB A;  3C1B A;  1KX5 A;  1P34 B;  1U35 C;  4NE5 A;  2NQB A;  4WU8 C;  4Z66 D;  1KX3 C;  3W96 B;  1F66 C;  1R4V A;  4H9R B;  3REI A;  2BG1 A;  5AVC D;  4E44 A;  3EPK A;  4J8V A;  3REK A;  1P3P D;  1P3M C;  4KUD B;  1P3B B;  3AN2 C;  5B31 G;  1HTA A;  3REJ B;  5B33 B;  3UTB B;  4Z5T D;  5AV8 C;  3UTA D;  1EQZ B;  1P3I C;  2CV5 D;  4J8U A;  3X1V B;  3MGR D;  4ZUX A;  3REL D;  5B40 C;  3REJ A;  5AV6 B;  4X23 C;  1P3O B;  1M19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...