4LD9A

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9A00
3A6NA 4H9PA 5B33C 5B40C 1P3FC 2YFVB 3NQJA 3KXBB 5FUGA 3MGRD 3RELA 1KX3B 1ZLAB 1P3AB 5CPIC 3B0BA 4YS3C 1Q9CA 3KXBD 4WU9C 5B40A 1P3FA 1N1JB 3AZHB 3W96C 3AZED 5F99B 4Z66B 3B6GB 5CPIA 4ZBJC 4QLCB 3AV2C 3LZ1D 4KGCC 4YS3A 4WU9A 2NZDC 5B1LB 3B6GD 2RVQC 5DNNB 1M19C 3C1BC 2HIOB 3W96A 3MNNC 4DRBA 4WV4B 4YM6C 4CAYB 3C1CB 3AV2A 4KGCA 1TAFA 4XUJC 4WU8B 3UTBC 3UTAB 4LD9B 3REHA 1M19A 3C1BA 3KWQD 3C1CD 1S32C 3KUYB 3MNNA 3AFAD 1P34B 4E45A 5B2IB 1P3BB 5B1MB 5GT3C 4YM6A 3UTAD 5B31C 5AV9C 1KX5B 5B0YB 5AV5B 4JJND 2F8NA 4XUJA 3KUYD 3AYWC 3UTBA 1P34D 1P3BD 3R45B 5B2ID 5B32C 3WA9C 1F66B 3A6ND 1S32A 1KX5D 5B0YD 4Z5TC 5BO0A 2BYMA 3AN2C 1M1AC 1P3GC 5GT3A 3RELD 5B31A 5AV9A 2CV5C 5BT1C 3LELB 3AYWA 1HQ3B 5B24B 5C3IC 5B32A 3REKC 1F1EA 1A7WA 3WA9A 3VH6W 3AZMB 1P3KA 4Z5TA 1M1AA 5GSUC 1P3GA 4DRAA 5B24D 4WZSB 5AY8D 2CV5A 2CWEA 3AZKC 5BS7C 3REKA 4X23A 1H3OA 4WU9D 4Z2MH 5GSUA 5B2JB 1EQZA 1TZYC 1KX3C 4NE5A 5JRGB 2AROC 4KHAA 2IO5B 4H9RA 3AZNC 3W99D 1P3AC 3AZLB 4J8XC 3AZKA 5BS7A 5B2JD 3AZJB 3AV2D 1P3PB 3LZ0C 5JRGD 5AV8B 5CP6B 3UT9C 2BYKA 3MGQB 4UUZA 2PYOC 3REHD 1TZYA 1KX3A 1AOIB 5AV6C 2AROA 3MGSB 1P3OC 5F99C 4Z66C 3AZNA 1P3AA 1WWSA 4QLCC 4J8XA 5BNVB 1P3IB 3X1VC 3LZ0A 3UT9A 4XUJD 3NQUB 5B1LC 1HTAA 4XZQB 2PYOA 5DNNC 3AZIB 3MGPC 2HIOC 5AV6A 4G91B 1P3OA 5F99A 3W97C 5GT3D 4XZQD 5G49B 3X1VA 4WU8C 3MGRB 3AYWD 4J8UC 4LD9C 5B0ZC 3V9RB 3LJAC 3MGPA 3REIC 1M18D 2F8NH 3WA9D 1P3KD 3O62B 4Z5TD 3AZFA 3W97A 1M1AD 5B1MC 4CAYA 5AV5C 5CPJD 3X1SB 5AVBB 1ID3C 1JFIA 3AZGB 2YFWB 3O62D 1KX4C 3VH6T 4H9NB 5BNXA 4J8UA 3AZEB 4LD9A 5B33A 1KU5A 4EO5C 5B0ZA 4X23D 1F66C 3LJAA 3WTPB 3REIA 3LZ1B 4KUDC 3X1SD 5AVBD 1BFMA 4H9OA 3X1TB 3REJC 3AZGD 2NQBC 1EQZD 1B67A 1P3LC 5AVCB 5AV5A 3WTPD 1ID3A 3VH5A 4NE3A 1KX4A 3WTPE 4J8VB 3X1TD 3WAAB 1F66A 5AVCD 4KUDA 1U35C 3REJA 3X1UC 2FJ7B 2NQBA 4J8VD 3WAAD 1P3LA 1BH8A 3KWQB 3AZND 5E5AC 5DNMD 4R8PC 3AFAB 2FJ7D 2NZDA 3UT9D 3B6FB 3W98B 4JJNB 1U35A 2PYOD 3X1UA 2HUEB 5KDMB 5CPKC 3A6NB 3B6FD 4H9PB 3W98D 5E5AA 3AZLC 5GXQC 4R8PA 1P3PC 3X1VD 5AV8C 3NQJB 5FUGB 3RELB 1P3MC 3MGQC 3TU4C 3MVDC 3AV1C 1AOIC 4E44A 3MGSC 5CPKA 3AZFD 3W97D 3WKJC 5B40B 5GXQA 5GT0C 5AV8A 1B6WA 4ZUXC 5AY8B 3MGQA 1P3MA 3TU4A 3MVDA 5B33D 3AV1A 5B40D 5B0ZD 4WNNA 5CPIB 1P3FD 1AOIA 4J8WC 3AN2A 4G91C 3MGSA 4YS3B 1BH9A 4WU9B 3WKJA 3B0DC 4G92B 5BNVA 5JA4A 5GT0A 5CPID 1ID3D 3MGRC 4ZUXA 4YS3D 4CSRA 3W96B 5CHLB 3W99B 4ZBJB 4J8WA 3AV2B 1ZLAC 3KXBC 3REJD 4NFTA 3W96D 3REHB 4KGCD 2NZDD 3LZ1C 2RVQD 2YFVA 3AZHC 3KXBA 3C1BD 1M19D 1ZLAA 2F8NB 4XUJB 3MNND 3B6GC 4YM6D 2F8ND 5BO0B 2BYMB 3UTBD 5GT3B 3LZ1A 5B31B 5AV9B 1N1JA 3AZHA 1S32D 3AYWB 4Z66A 5B32B 3B6GA 4QLCA 3C1CC 1M18B 3WA9B 5B31D 5AV9D 1P3KB 4Z5TB 3AFAC 2JSSA 1M1AB 1P3GB 3UTAC 5B1LA 5B32D 1P3MD 3VH5T 5DNNA 5CPJB 4JJNC 2HIOA 3KUYC 2HUEC 1P34C 1P3BC 5C3IB 5B2IC 3AN2D 1P3GD 4X23B 3C1CA 1H3OB 1KX5C 5B0YC 2CV5D 3WKJD 1R4VA 5BT1D 4WU8A 5GSUB 1EQZB 3UTAA 3REKD 4KHAB 4JJNA 4H9RB 3KUYA 1P34A 1P3BA 5B2IA 5GSUD 5B1MA 4HGAB 1KX5A 5B0YA 2BYKB 4UUZB 3LELC 1HQ3C 1TZYB 4M6BA 5B24C 3R45A 3AZKD 5AY8C 2AROB 3AZMC 3AZNB 5DNMB 4J8XB 2LY8A 1TZYD 1ULYA 3LZ0B 1KX3D 4AWLB 1ZLAD 3UT9B 4G92C 2AROD 3LELA 1P3AD 2PYOB 1HQ3A 5B24A 4H9QB 4J8XD 5AY8A 5AV6B 3LZ0D 3W99C 3AZMA 1P3OB 5B2JC 3X1VB 5JRGC 3AZHD 5AV6D 2IO5C 1WWIA 1P3OD 5F99D 4Z66D 4H9SC 3REHC 4QLCD 3MGPB 3AZJC 4Z2MG 5CP6C 3AZFB 3W97B 3W99A 3VH6A 5B1LD 5B2JA 5DNND 5JRGA 3VH5W 3MGPD 2HIOD 1JFIB 5BNXB 4J8UB 4H9SA 5B33B 3AZLA 5B0ZB 3LJAB 1P3IC 3AZJA 3REIB 1P3FB 1P3PA 5CP6A 4H9OB 4WU8D 3B0CW 4J8UD 4LD9D 4XZQC 3AZIC 3LJAD 1ID3B 3REID 1KX4B 5B1MD 2L5AA 4EO5B 1M18C 1P3IA 5AV5D 1P3KC 4KUDB 3REJB 2NQBB 1KX4D 3NQUA 4XZQA 1P3LB 3AZIA 5CPJC 1F66D 1BH8B 3O62C 4KGCB 4KUDD 1TAFB 2NQBD 2NZDB 4X23C 1M18A 5G49A 1P3LD 3X1SC 5AVBC 1M19B 3LELD 3C1BB 3MGRA 3AZGC 1U35B 3X1UB 1EQZC 1HQ3D 3AZEC 2F8NG 3MNNB 5CPJA 3V9RA 3WTPC 4YM6B 3AZMD 3O62A 4NE6A 5E5AB 3X1TC 4R8PB 1U35D 3X1UD 4HGAC 3UTBB 5AVCC 3X1SA 5AVBA 5B31G 3AZGA 2YFWA 1S32B 5E5AD 4J8VC 4H9NA 4R8PD 3WAAC 3AZEA 5CPKB 3WTPA 5B32G 5DNMC 5GXQB 3X1TA 2FJ7C 3KSYA 4AWLC 5AVCA 1P3MB 5CPKD 3KWQC 3TU4B 3MVDB 3AZLD 3AV1B 5GXQD 4J8VA 4WNNB 2F8NK 3WAAA 3AZJD 1P3PD 3AN2B 5CP6D 5AV8D 1BH9B 3B6FC 3WKJB 3W98C 3MGQD 2CV5B 5DNMA 3TU4D 3MVDD 5JA4B 5GT0B 2FJ7A 3AV1D 1AOID 4ZUXB 3MGSD 3REKB 4CSRB 3A6NC 3KWQA 4H9QA 3AFAA 1P3ID 3B0CT 5GT0D 4J8WB 3RELC 4ZUXD 3AZFC 3B6FA 3B0DB 3W98A 3AZID 3AZKB 5KDMA 4J8WD
chains in the Genus database with same CATH superfamily
3A6NA 4H9PA 5B33C 3P5JB 5B40C 1P3FC 2YFVB 3NQJA 3KXBB 5FUGA 3MGRD 3RELA 1KX3B 1ZLAB 3H0LC 1P3AB 5CPIC 3B0BA 4YS3C 1Q9CA 3A1IA 3KXBD 2BG1A 4WU9C 5B40A 1P3FA 1N1JB 3AZHB 2J8PA 3W96C 3AZED 5F99B 4Z66B 3B6GB 5CPIA 4ZBJC 4QLCB 3AV2C 3LZ1D 4KGCC 4YS3A 4WU9A 2FFFB 2NZDC 3EPKA 5B1LB 2ZM5A 3B6GD 2RVQC 5DNNB 1M19C 3C1BC 2HIOB 3W96A 3MNNC 4DRBA 4WV4B 4YM6C 4CAYB 3C1CB 3AV2A 4KGCA 1TAFA 4XUJC 4WU8B 3UTBC 3UTAB 4LD9B 3REHA 1M19A 3C1BA 3KWQD 3C1CD 1S32C 3KUYB 4UPKA 3MNNA 3AFAD 1P34B 4E45A 5B2IB 1P3BB 5B1MB 5GT3C 4YM6A 3UTAD 5B31C 5AV9C 1KX5B 5B0YB 5AV5B 4JJND 2F8NA 4XUJA 3KUYD 3AYWC 3UTBA 1P34D 1P3BD 3R45B 5B2ID 5B32C 3WA9C 1F66B 3A6ND 1S32A 1KX5D 5B0YD 4Z5TC 5BO0A 2BYMA 3AN2C 1M1AC 1P3GC 5GT3A 3RELD 5B31A 5AV9A 2CV5C 1W2EA 5BT1C 3LELB 3EG5B 3AYWA 1HQ3B 5B24B 5C3IC 5B32A 3REKC 1F1EA 1A7WA 3WA9A 3VH6W 3KFUG 2UWXA 3AZMB 1P3KA 4Z5TA 1M1AA 5GSUC 1P3GA 4DRAA 5B24D 1Z2CB 4WZSB 5AY8D 2CV5A 2CWEA 3AL0C 3AZKC 5BS7C 3REKA 4X23A 1H3OA 4WU9D 4Z2MH 5GSUA 5B2JB 1EQZA 1TZYC 1KX3C 4NE5A 5JRGB 2AROC 4KHAA 2IO5B 4H9RA 3AZNC 3W99D 1P3AC 2ZY3A 4J8XC 3AZKA 3AZLB 5BS7A 5B2JD 3AZJB 3AV2D 1P3PB 2Y2PA 3LZ0C 5JRGD 5AV8B 5CP6B 3UT9C 2BYKA 3MGQB 4UUZA 2PYOC 3REHD 1TZYA 1KX3A 1AOIB 5AV6C 2AROA 3MGSB 1P3OC 5F99C 4Z66C 3AZNA 1P3AA 1WWSA 4QLCC 4J8XA 5BNVB 1P3IB 3X1VC 3LZ0A 3UT9A 4XUJD 3NQUB 5B1LC 1HTAA 4XZQB 2PYOA 5DNNC 3AZIB 3MGPC 2HIOC 5AV6A 2RIQA 4G91B 3EPLA 1P3OA 5F99A 3W97C 5GT3D 4XZQD 5G49B 3X1VA 2Y2JA 4WU8C 3MGRB 3AYWD 4J8UC 4LD9C 2JE5A 5B0ZC 3V9RB 3LJAC 3MGPA 3REIC 1M18D 2F8NH 3WA9D 1P3KD 3O62B 4Z5TD 3AZFA 3W97A 1M1AD 5B1MC 4CAYA 5AV5C 5CPJD 3X1SB 5AVBB 1ID3C 1JFIA 3AZGB 2YFWB 3O62D 1KX4C 3VH6T 1T3UA 4H9NB 1PZRA 5BNXA 4J8UA 3AZEB 2XD5A 5B33A 1KU5A 4LD9A 4EO5C 5B0ZA 4X23D 1F66C 3LJAA 3WTPB 3REIA 3LZ1B 4KUDC 3X1SD 5AVBD 1BFMA 4H9OA 3X1TB 3REJC 3AZGD 2NQBC 1EQZD 1B67A 1P3LC 5AVCB 5AV5A 2Y2NA 3WTPD 1ID3A 3VH5A 4NE3A 1KX4A 2VQRA 3WTPE 4J8VB 3X1TD 3WAAB 3EPHA 1F66A 5AVCD 4KUDA 3H0RC 1U35C 3REJA 3X1UC 2FJ7B 2NQBA 4J8VD 3WAAD 1P3LA 1BH8A 3KWQB 3AZND 3F6TA 5E5AC 5DNMD 4R8PC 3AFAB 2FJ7D 2NZDA 3UT9D 3B6FB 2G5HC 3W98B 4JJNB 1U35A 2PYOD 3X1UA 2HUEB 5KDMB 5CPKC 3A6NB 2ZY4A 4H9PB 3B6FD 5E5AA 3AZLC 5GXQC 3W98D 4R8PA 1P3PC 3X1VD 5AV8C 3NQJB 5FUGB 3RELB 1P3MC 3MGQC 3TU4C 3MVDC 3AV1C 1AOIC 2XD1A 4E44A 3MGSC 5CPKA 3AZFD 2ZY5A 3W97D 3WKJC 5B40B 5GXQA 5GT0C 5AV8A 1B6WA 4ZUXC 5AY8B 3MGQA 1P3MA 3TU4A 3MVDA 5B33D 3AV1A 5B40D 5B0ZD 4WNNA 5CPIB 1P3FD 1AOIA 4J8WC 3AN2A 4G91C 3MGSA 4YS3B 1BH9A 4WU9B 3WKJA 3B0DC 4G92B 5BNVA 5JA4A 5GT0A 3EPJA 5CPID 1ID3D 3MGRC 4ZUXA 2W8SA 2Y2QA 4YS3D 4CSRA 3W96B 5CHLB 3W99B 4ZBJB 4J8WA 3AV2B 2DF4C 1ZLAC 3KXBC 3REJD 4NFTA 3W96D 3REHB 4KGCD 2NZDD 3LZ1C 2RVQD 2YFVA 3AZHC 3KXBA 3C1BD 1M19D 1ZLAA 2F8NB 4XUJB 3MNND 3B6GC 4YM6D 3IP4C 2F8ND 5BO0B 2BYMB 3UTBD 5GT3B 3LZ1A 5AV9B 5B31B 1N1JA 3AZHA 1S32D 2JCHA 3AYWB 4Z66A 5B32B 3B6GA 2Y2KA 4QLCA 3C1CC 1M18B 2ZY2A 5B31D 5AV9D 3WA9B 1P3KB 4Z5TB 3AFAC 2JSSA 1M1AB 1P3GB 3UTAC 5B1LA 5B32D 1P3MD 3VH5T 5DNNA 5CPJB 4JJNC 2HIOA 2Y2HA 2HUEC 3KUYC 1P34C 1P3BC 5C3IB 5B2IC 3AN2D 1P3GD 4X23B 3C1CA 1H3OB 1KX5C 5B0YC 2CV5D 3WKJD 2Y2LA 1R4VA 5BT1D 4WU8A 5GSUB 1EQZB 3UTAA 3REKD 4KHAB 4JJNA 4H9RB 3KUYA 1P34A 1P3BA 2DQNC 5B2IA 5GSUD 5B1MA 4HGAB 1KX5A 5B0YA 2BYKB 4UUZB 3LELC 1HQ3C 1TZYB 4M6BA 5B24C 3R45A 3AZKD 5AY8C 2AROB 3AZMC 3AZNB 5DNMB 4J8XB 2LY8A 1TZYD 1ULYA 3LZ0B 1KX3D 4AWLB 1ZLAD 3UT9B 4G92C 2AROD 3LELA 1P3AD 2PYOB 2Y2GA 1HQ3A 4H9QB 5B24A 4J8XD 5AY8A 5AV6B 3LZ0D 3W99C 3AZMA 1P3OB 5B2JC 3X1VB 5JRGC 3AZHD 5AV6D 2IO5C 1WWIA 1P3OD 5F99D 4Z66D 4H9SC 3REHC 4QLCD 3MGPB 3AZJC 4Z2MG 5CP6C 3AZFB 3W97B 3W99A 3VH6A 3A1KA 5B1LD 5B2JA 5DNND 5JRGA 3VH5W 3MGPD 2HIOD 1JFIB 5BNXB 4J8UB 4H9SA 5B33B 3AZLA 5B0ZB 2Y2OA 3LJAB 1P3IC 3AZJA 3REIB 1P3FB 1P3PA 4WJ3C 5CP6A 4H9OB 4WU8D 3B0CW 3H0MC 4J8UD 4LD9D 4XZQC 3AZIC 3LJAD 1ID3B 3REID 1KX4B 4DQYB 5B1MD 2L5AA 4EO5B 1M18C 1P3IA 5AV5D 1P3KC 4KUDB 3REJB 2F2AC 2NQBB 1KX4D 3NQUA 4XZQA 1P3LB 3AZIA 5CPJC 1F66D 1BH8B 3O62C 4KGCB 4KUDD 1TAFB 2NQBD 2NZDB 4X23C 1M18A 5G49A 1P3LD 3X1SC 5AVBC 1M19B 3LELD 3C1BB 3MGRA 3AZGC 1U35B 3X1UB 1EQZC 1HQ3D 3AZEC 2F8NG 3MNNB 5CPJA 3V9RA 3WTPC 4YM6B 3AZMD 3O62A 4NE6A 5E5AB 3X1TC 4R8PB 1U35D 3X1UD 4HGAC 3UTBB 5AVCC 3X1SA 5AVBA 5B31G 3AZGA 2YFWA 1S32B 5E5AD 4J8VC 4H9NA 4R8PD 3WAAC 3AZEA 3FDDA 5CPKB 3WTPA 5B32G 5DNMC 5GXQB 2G5IC 3X1TA 2FJ7C 3KSYA 2Y2IA 4AWLC 5AVCA 1P3MB 5CPKD 3KWQC 3TU4B 3MVDB 3AZLD 3AV1B 5GXQD 4J8VA 4WNNB 2F8NK 3WAAA 3AZJD 1P3PD 3AN2B 2Y2MA 5CP6D 5AV8D 1BH9B 3B6FC 3WKJB 3W98C 3MGQD 2CV5B 5DNMA 3TU4D 3MVDD 5JA4B 5GT0B 2FJ7A 3AV1D 1AOID 4ZUXB 3MGSD 3REKB 4CSRB 3A6NC 3KWQA 4H9QA 3AFAA 1P3ID 3B0CT 5GT0D 4J8WB 3RELC 4ZUXD 3AZFC 3B6FA 3B0DB 3W98A 3AZID 3AZKB 5KDMA 4J8WD
chains in the Genus database with same CATH topology
3A6NA 4H9PA 5B33C 3P5JB 5B40C 1P3FC 2YFVB 3NQJA 3KXBB 5FUGA 3MGRD 3RELA 1KX3B 1ZLAB 3H0LC 1P3AB 5CPIC 3B0BA 4YS3C 1Q9CA 3A1IA 3KXBD 2BG1A 4WU9C 5B40A 1P3FA 1N1JB 3AZHB 2J8PA 3W96C 3AZED 5F99B 4Z66B 3B6GB 5CPIA 4ZBJC 4QLCB 3AV2C 3LZ1D 4KGCC 4YS3A 4WU9A 2FFFB 2NZDC 3EPKA 5B1LB 2ZM5A 3B6GD 2RVQC 5DNNB 1M19C 3C1BC 2HIOB 3W96A 3MNNC 4DRBA 4WV4B 4YM6C 4CAYB 3C1CB 3AV2A 4KGCA 1TAFA 4XUJC 4WU8B 3UTBC 3UTAB 4LD9B 3REHA 1M19A 3C1BA 3KWQD 3C1CD 1S32C 3KUYB 4UPKA 3MNNA 3AFAD 1P34B 4E45A 5B2IB 1P3BB 5B1MB 5GT3C 4YM6A 3UTAD 5B31C 5AV9C 1KX5B 5B0YB 5AV5B 4JJND 2F8NA 4XUJA 3KUYD 3AYWC 3UTBA 1P34D 1P3BD 3R45B 5B2ID 5B32C 3WA9C 1F66B 3A6ND 1S32A 1KX5D 5B0YD 4Z5TC 5BO0A 2BYMA 3AN2C 1M1AC 1P3GC 5GT3A 3RELD 5B31A 5AV9A 2CV5C 1W2EA 5BT1C 3LELB 3EG5B 3AYWA 1HQ3B 5B24B 5C3IC 5B32A 3REKC 1F1EA 1A7WA 3WA9A 3VH6W 3KFUG 2UWXA 3AZMB 1P3KA 4Z5TA 1M1AA 5GSUC 1P3GA 4DRAA 5B24D 1Z2CB 4WZSB 5AY8D 2CV5A 2CWEA 3AL0C 3AZKC 5BS7C 3REKA 4X23A 1H3OA 4WU9D 4Z2MH 5GSUA 5B2JB 1EQZA 1TZYC 1KX3C 4NE5A 5JRGB 2AROC 4KHAA 2IO5B 4H9RA 3AZNC 3W99D 1P3AC 2ZY3A 4J8XC 3AZKA 3AZLB 5BS7A 5B2JD 3AZJB 3AV2D 1P3PB 2Y2PA 3LZ0C 5JRGD 5AV8B 5CP6B 3UT9C 2BYKA 3MGQB 4UUZA 2PYOC 3REHD 1TZYA 1KX3A 1AOIB 5AV6C 2AROA 3MGSB 1P3OC 5F99C 4Z66C 3AZNA 1P3AA 1WWSA 4QLCC 4J8XA 5BNVB 1P3IB 3X1VC 3LZ0A 3UT9A 4XUJD 3NQUB 5B1LC 1HTAA 4XZQB 2PYOA 5DNNC 3AZIB 3MGPC 2HIOC 5AV6A 2RIQA 4G91B 3EPLA 1P3OA 5F99A 3W97C 5GT3D 4XZQD 5G49B 3X1VA 2Y2JA 4WU8C 3MGRB 3AYWD 4J8UC 4LD9C 2JE5A 5B0ZC 3V9RB 3LJAC 3MGPA 3REIC 1M18D 2F8NH 3WA9D 1P3KD 3O62B 4Z5TD 3AZFA 3W97A 1M1AD 5B1MC 4CAYA 5AV5C 5CPJD 3X1SB 5AVBB 1ID3C 1JFIA 3AZGB 2YFWB 3O62D 1KX4C 3VH6T 1T3UA 4H9NB 1PZRA 5BNXA 4J8UA 3AZEB 2XD5A 5B33A 1KU5A 4LD9A 4EO5C 5B0ZA 4X23D 1F66C 3LJAA 3WTPB 3REIA 3LZ1B 4KUDC 3X1SD 5AVBD 1BFMA 4H9OA 3X1TB 3REJC 3AZGD 2NQBC 1EQZD 1B67A 1P3LC 5AVCB 5AV5A 2Y2NA 3WTPD 1ID3A 3VH5A 4NE3A 1KX4A 2VQRA 3WTPE 4J8VB 3X1TD 3WAAB 3EPHA 1F66A 5AVCD 4KUDA 3H0RC 1U35C 3REJA 3X1UC 2FJ7B 2NQBA 4J8VD 3WAAD 1P3LA 1BH8A 3KWQB 3AZND 3F6TA 5E5AC 5DNMD 4R8PC 3AFAB 2FJ7D 2NZDA 3UT9D 3B6FB 2G5HC 3W98B 4JJNB 1U35A 2PYOD 3X1UA 2HUEB 5KDMB 5CPKC 3A6NB 2ZY4A 4H9PB 3B6FD 5E5AA 3AZLC 5GXQC 3W98D 4R8PA 1P3PC 3X1VD 5AV8C 3NQJB 5FUGB 3RELB 1P3MC 3MGQC 3TU4C 3MVDC 3AV1C 1AOIC 2XD1A 4E44A 3MGSC 5CPKA 3AZFD 2ZY5A 3W97D 3WKJC 5B40B 5GXQA 5GT0C 5AV8A 1B6WA 4ZUXC 5AY8B 3MGQA 1P3MA 3TU4A 3MVDA 5B33D 3AV1A 5B40D 5B0ZD 4WNNA 5CPIB 1P3FD 1AOIA 4J8WC 3AN2A 4G91C 3MGSA 4YS3B 1BH9A 4WU9B 3WKJA 3B0DC 4G92B 5BNVA 5JA4A 5GT0A 3EPJA 5CPID 1ID3D 3MGRC 4ZUXA 2W8SA 2Y2QA 4YS3D 4CSRA 3W96B 5CHLB 3W99B 4ZBJB 4J8WA 3AV2B 2DF4C 1ZLAC 3KXBC 3REJD 4NFTA 3W96D 3REHB 4KGCD 2NZDD 3LZ1C 2RVQD 2YFVA 3AZHC 3KXBA 3C1BD 1M19D 1ZLAA 2F8NB 4XUJB 3MNND 3B6GC 4YM6D 3IP4C 2F8ND 5BO0B 2BYMB 3UTBD 5GT3B 3LZ1A 5AV9B 5B31B 1N1JA 3AZHA 1S32D 2JCHA 3AYWB 4Z66A 5B32B 3B6GA 2Y2KA 4QLCA 3C1CC 1M18B 2ZY2A 5B31D 5AV9D 3WA9B 1P3KB 4Z5TB 3AFAC 2JSSA 1M1AB 1P3GB 3UTAC 5B1LA 5B32D 1P3MD 3VH5T 5DNNA 5CPJB 4JJNC 2HIOA 2Y2HA 2HUEC 3KUYC 1P34C 1P3BC 5C3IB 5B2IC 3AN2D 1P3GD 4X23B 3C1CA 1H3OB 1KX5C 5B0YC 2CV5D 3WKJD 2Y2LA 1R4VA 5BT1D 4WU8A 5GSUB 1EQZB 3UTAA 3REKD 4KHAB 4JJNA 4H9RB 3KUYA 1P34A 1P3BA 2DQNC 5B2IA 5GSUD 5B1MA 4HGAB 1KX5A 5B0YA 2BYKB 4UUZB 3LELC 1HQ3C 1TZYB 4M6BA 5B24C 3R45A 3AZKD 5AY8C 2AROB 3AZMC 3AZNB 5DNMB 4J8XB 2LY8A 1TZYD 1ULYA 3LZ0B 1KX3D 4AWLB 1ZLAD 3UT9B 4G92C 2AROD 3LELA 1P3AD 2PYOB 2Y2GA 1HQ3A 4H9QB 5B24A 4J8XD 5AY8A 5AV6B 3LZ0D 3W99C 3AZMA 1P3OB 5B2JC 3X1VB 5JRGC 3AZHD 5AV6D 2IO5C 1WWIA 1P3OD 5F99D 4Z66D 4H9SC 3REHC 4QLCD 3MGPB 3AZJC 4Z2MG 5CP6C 3AZFB 3W97B 3W99A 3VH6A 3A1KA 5B1LD 5B2JA 5DNND 5JRGA 3VH5W 3MGPD 2HIOD 1JFIB 5BNXB 4J8UB 4H9SA 5B33B 3AZLA 5B0ZB 2Y2OA 3LJAB 1P3IC 3AZJA 3REIB 1P3FB 1P3PA 4WJ3C 5CP6A 4H9OB 4WU8D 3B0CW 3H0MC 4J8UD 4LD9D 4XZQC 3AZIC 3LJAD 1ID3B 3REID 1KX4B 4DQYB 5B1MD 2L5AA 4EO5B 1M18C 1P3IA 5AV5D 1P3KC 4KUDB 3REJB 2F2AC 2NQBB 1KX4D 3NQUA 4XZQA 1P3LB 3AZIA 5CPJC 1F66D 1BH8B 3O62C 4KGCB 4KUDD 1TAFB 2NQBD 2NZDB 4X23C 1M18A 5G49A 1P3LD 3X1SC 5AVBC 1M19B 3LELD 3C1BB 3MGRA 3AZGC 1U35B 3X1UB 1EQZC 1HQ3D 3AZEC 2F8NG 3MNNB 5CPJA 3V9RA 3WTPC 4YM6B 3AZMD 3O62A 4NE6A 5E5AB 3X1TC 4R8PB 1U35D 3X1UD 4HGAC 3UTBB 5AVCC 3X1SA 5AVBA 5B31G 3AZGA 2YFWA 1S32B 5E5AD 4J8VC 4H9NA 4R8PD 3WAAC 3AZEA 3FDDA 5CPKB 3WTPA 5B32G 5DNMC 5GXQB 2G5IC 3X1TA 2FJ7C 3KSYA 2Y2IA 4AWLC 5AVCA 1P3MB 5CPKD 3KWQC 3TU4B 3MVDB 3AZLD 3AV1B 5GXQD 4J8VA 4WNNB 2F8NK 3WAAA 3AZJD 1P3PD 3AN2B 2Y2MA 5CP6D 5AV8D 1BH9B 3B6FC 3WKJB 3W98C 3MGQD 2CV5B 5DNMA 3TU4D 3MVDD 5JA4B 5GT0B 2FJ7A 3AV1D 1AOID 4ZUXB 3MGSD 3REKB 4CSRB 3A6NC 3KWQA 4H9QA 3AFAA 1P3ID 3B0CT 5GT0D 4J8WB 3RELC 4ZUXD 3AZFC 3B6FA 3B0DB 3W98A 3AZID 3AZKB 5KDMA 4J8WD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  4H9P A;  5B33 C;  5B40 C;  1P3F C;  2YFV B;  3NQJ A;  3KXB B;  5FUG A;  3MGR D;  3REL A;  1KX3 B;  1ZLA B;  1P3A B;  5CPI C;  3B0B A;  4YS3 C;  1Q9C A;  3KXB D;  4WU9 C;  5B40 A;  1P3F A;  1N1J B;  3AZH B;  3W96 C;  3AZE D;  5F99 B;  4Z66 B;  3B6G B;  5CPI A;  4ZBJ C;  4QLC B;  3AV2 C;  3LZ1 D;  4KGC C;  4YS3 A;  4WU9 A;  2NZD C;  5B1L B;  3B6G D;  2RVQ C;  5DNN B;  1M19 C;  3C1B C;  2HIO B;  3W96 A;  3MNN C;  4DRB A;  4WV4 B;  4YM6 C;  4CAY B;  3C1C B;  3AV2 A;  4KGC A;  1TAF A;  4XUJ C;  4WU8 B;  3UTB C;  3UTA B;  4LD9 B;  3REH A;  1M19 A;  3C1B A;  3KWQ D;  3C1C D;  1S32 C;  3KUY B;  3MNN A;  3AFA D;  1P34 B;  4E45 A;  5B2I B;  1P3B B;  5B1M B;  5GT3 C;  4YM6 A;  3UTA D;  5B31 C;  5AV9 C;  1KX5 B;  5B0Y B;  5AV5 B;  4JJN D;  2F8N A;  4XUJ A;  3KUY D;  3AYW C;  3UTB A;  1P34 D;  1P3B D;  3R45 B;  5B2I D;  5B32 C;  3WA9 C;  1F66 B;  3A6N D;  1S32 A;  1KX5 D;  5B0Y D;  4Z5T C;  5BO0 A;  2BYM A;  3AN2 C;  1M1A C;  1P3G C;  5GT3 A;  3REL D;  5B31 A;  5AV9 A;  2CV5 C;  5BT1 C;  3LEL B;  3AYW A;  1HQ3 B;  5B24 B;  5C3I C;  5B32 A;  3REK C;  1F1E A;  1A7W A;  3WA9 A;  3VH6 W;  3AZM B;  1P3K A;  4Z5T A;  1M1A A;  5GSU C;  1P3G A;  4DRA A;  5B24 D;  4WZS B;  5AY8 D;  2CV5 A;  2CWE A;  3AZK C;  5BS7 C;  3REK A;  4X23 A;  1H3O A;  4WU9 D;  4Z2M H;  5GSU A;  5B2J B;  1EQZ A;  1TZY C;  1KX3 C;  4NE5 A;  5JRG B;  2ARO C;  4KHA A;  2IO5 B;  4H9R A;  3AZN C;  3W99 D;  1P3A C;  3AZL B;  4J8X C;  3AZK A;  5BS7 A;  5B2J D;  3AZJ B;  3AV2 D;  1P3P B;  3LZ0 C;  5JRG D;  5AV8 B;  5CP6 B;  3UT9 C;  2BYK A;  3MGQ B;  4UUZ A;  2PYO C;  3REH D;  1TZY A;  1KX3 A;  1AOI B;  5AV6 C;  2ARO A;  3MGS B;  1P3O C;  5F99 C;  4Z66 C;  3AZN A;  1P3A A;  1WWS A;  4QLC C;  4J8X A;  5BNV B;  1P3I B;  3X1V C;  3LZ0 A;  3UT9 A;  4XUJ D;  3NQU B;  5B1L C;  1HTA A;  4XZQ B;  2PYO A;  5DNN C;  3AZI B;  3MGP C;  2HIO C;  5AV6 A;  4G91 B;  1P3O A;  5F99 A;  3W97 C;  5GT3 D;  4XZQ D;  5G49 B;  3X1V A;  4WU8 C;  3MGR B;  3AYW D;  4J8U C;  4LD9 C;  5B0Z C;  3V9R B;  3LJA C;  3MGP A;  3REI C;  1M18 D;  2F8N H;  3WA9 D;  1P3K D;  3O62 B;  4Z5T D;  3AZF A;  3W97 A;  1M1A D;  5B1M C;  4CAY A;  5AV5 C;  5CPJ D;  3X1S B;  5AVB B;  1ID3 C;  1JFI A;  3AZG B;  2YFW B;  3O62 D;  1KX4 C;  3VH6 T;  4H9N B;  5BNX A;  4J8U A;  3AZE B;  4LD9 A;  5B33 A;  1KU5 A;  4EO5 C;  5B0Z A;  4X23 D;  1F66 C;  3LJA A;  3WTP B;  3REI A;  3LZ1 B;  4KUD C;  3X1S D;  5AVB D;  1BFM A;  4H9O A;  3X1T B;  3REJ C;  3AZG D;  2NQB C;  1EQZ D;  1B67 A;  1P3L C;  5AVC B;  5AV5 A;  3WTP D;  1ID3 A;  3VH5 A;  4NE3 A;  1KX4 A;  3WTP E;  4J8V B;  3X1T D;  3WAA B;  1F66 A;  5AVC D;  4KUD A;  1U35 C;  3REJ A;  3X1U C;  2FJ7 B;  2NQB A;  4J8V D;  3WAA D;  1P3L A;  1BH8 A;  3KWQ B;  3AZN D;  5E5A C;  5DNM D;  4R8P C;  3AFA B;  2FJ7 D;  2NZD A;  3UT9 D;  3B6F B;  3W98 B;  4JJN B;  1U35 A;  2PYO D;  3X1U A;  2HUE B;  5KDM B;  5CPK C;  3A6N B;  3B6F D;  4H9P B;  3W98 D;  5E5A A;  3AZL C;  5GXQ C;  4R8P A;  1P3P C;  3X1V D;  5AV8 C;  3NQJ B;  5FUG B;  3REL B;  1P3M C;  3MGQ C;  3TU4 C;  3MVD C;  3AV1 C;  1AOI C;  4E44 A;  3MGS C;  5CPK A;  3AZF D;  3W97 D;  3WKJ C;  5B40 B;  5GXQ A;  5GT0 C;  5AV8 A;  1B6W A;  4ZUX C;  5AY8 B;  3MGQ A;  1P3M A;  3TU4 A;  3MVD A;  5B33 D;  3AV1 A;  5B40 D;  5B0Z D;  4WNN A;  5CPI B;  1P3F D;  1AOI A;  4J8W C;  3AN2 A;  4G91 C;  3MGS A;  4YS3 B;  1BH9 A;  4WU9 B;  3WKJ A;  3B0D C;  4G92 B;  5BNV A;  5JA4 A;  5GT0 A;  5CPI D;  1ID3 D;  3MGR C;  4ZUX A;  4YS3 D;  4CSR A;  3W96 B;  5CHL B;  3W99 B;  4ZBJ B;  4J8W A;  3AV2 B;  1ZLA C;  3KXB C;  3REJ D;  4NFT A;  3W96 D;  3REH B;  4KGC D;  2NZD D;  3LZ1 C;  2RVQ D;  2YFV A;  3AZH C;  3KXB A;  3C1B D;  1M19 D;  1ZLA A;  2F8N B;  4XUJ B;  3MNN D;  3B6G C;  4YM6 D;  2F8N D;  5BO0 B;  2BYM B;  3UTB D;  5GT3 B;  3LZ1 A;  5B31 B;  5AV9 B;  1N1J A;  3AZH A;  1S32 D;  3AYW B;  4Z66 A;  5B32 B;  3B6G A;  4QLC A;  3C1C C;  1M18 B;  3WA9 B;  5B31 D;  5AV9 D;  1P3K B;  4Z5T B;  3AFA C;  2JSS A;  1M1A B;  1P3G B;  3UTA C;  5B1L A;  5B32 D;  1P3M D;  3VH5 T;  5DNN A;  5CPJ B;  4JJN C;  2HIO A;  3KUY C;  2HUE C;  1P34 C;  1P3B C;  5C3I B;  5B2I C;  3AN2 D;  1P3G D;  4X23 B;  3C1C A;  1H3O B;  1KX5 C;  5B0Y C;  2CV5 D;  3WKJ D;  1R4V A;  5BT1 D;  4WU8 A;  5GSU B;  1EQZ B;  3UTA A;  3REK D;  4KHA B;  4JJN A;  4H9R B;  3KUY A;  1P34 A;  1P3B A;  5B2I A;  5GSU D;  5B1M A;  4HGA B;  1KX5 A;  5B0Y A;  2BYK B;  4UUZ B;  3LEL C;  1HQ3 C;  1TZY B;  4M6B A;  5B24 C;  3R45 A;  3AZK D;  5AY8 C;  2ARO B;  3AZM C;  3AZN B;  5DNM B;  4J8X B;  2LY8 A;  1TZY D;  1ULY A;  3LZ0 B;  1KX3 D;  4AWL B;  1ZLA D;  3UT9 B;  4G92 C;  2ARO D;  3LEL A;  1P3A D;  2PYO B;  1HQ3 A;  5B24 A;  4H9Q B;  4J8X D;  5AY8 A;  5AV6 B;  3LZ0 D;  3W99 C;  3AZM A;  1P3O B;  5B2J C;  3X1V B;  5JRG C;  3AZH D;  5AV6 D;  2IO5 C;  1WWI A;  1P3O D;  5F99 D;  4Z66 D;  4H9S C;  3REH C;  4QLC D;  3MGP B;  3AZJ C;  4Z2M G;  5CP6 C;  3AZF B;  3W97 B;  3W99 A;  3VH6 A;  5B1L D;  5B2J A;  5DNN D;  5JRG A;  3VH5 W;  3MGP D;  2HIO D;  1JFI B;  5BNX B;  4J8U B;  4H9S A;  5B33 B;  3AZL A;  5B0Z B;  3LJA B;  1P3I C;  3AZJ A;  3REI B;  1P3F B;  1P3P A;  5CP6 A;  4H9O B;  4WU8 D;  3B0C W;  4J8U D;  4LD9 D;  4XZQ C;  3AZI C;  3LJA D;  1ID3 B;  3REI D;  1KX4 B;  5B1M D;  2L5A A;  4EO5 B;  1M18 C;  1P3I A;  5AV5 D;  1P3K C;  4KUD B;  3REJ B;  2NQB B;  1KX4 D;  3NQU A;  4XZQ A;  1P3L B;  3AZI A;  5CPJ C;  1F66 D;  1BH8 B;  3O62 C;  4KGC B;  4KUD D;  1TAF B;  2NQB D;  2NZD B;  4X23 C;  1M18 A;  5G49 A;  1P3L D;  3X1S C;  5AVB C;  1M19 B;  3LEL D;  3C1B B;  3MGR A;  3AZG C;  1U35 B;  3X1U B;  1EQZ C;  1HQ3 D;  3AZE C;  2F8N G;  3MNN B;  5CPJ A;  3V9R A;  3WTP C;  4YM6 B;  3AZM D;  3O62 A;  4NE6 A;  5E5A B;  3X1T C;  4R8P B;  1U35 D;  3X1U D;  4HGA C;  3UTB B;  5AVC C;  3X1S A;  5AVB A;  5B31 G;  3AZG A;  2YFW A;  1S32 B;  5E5A D;  4J8V C;  4H9N A;  4R8P D;  3WAA C;  3AZE A;  5CPK B;  3WTP A;  5B32 G;  5DNM C;  5GXQ B;  3X1T A;  2FJ7 C;  3KSY A;  4AWL C;  5AVC A;  1P3M B;  5CPK D;  3KWQ C;  3TU4 B;  3MVD B;  3AZL D;  3AV1 B;  5GXQ D;  4J8V A;  4WNN B;  2F8N K;  3WAA A;  3AZJ D;  1P3P D;  3AN2 B;  5CP6 D;  5AV8 D;  1BH9 B;  3B6F C;  3WKJ B;  3W98 C;  3MGQ D;  2CV5 B;  5DNM A;  3TU4 D;  3MVD D;  5JA4 B;  5GT0 B;  2FJ7 A;  3AV1 D;  1AOI D;  4ZUX B;  3MGS D;  3REK B;  4CSR B;  3A6N C;  3KWQ A;  4H9Q A;  3AFA A;  1P3I D;  3B0C T;  5GT0 D;  4J8W B;  3REL C;  4ZUX D;  3AZF C;  3B6F A;  3B0D B;  3W98 A;  3AZI D;  3AZK B;  5KDM A;  4J8W D; 
#chains in the Genus database with same CATH topology
 3A6N A;  4H9P A;  5B33 C;  3P5J B;  5B40 C;  1P3F C;  2YFV B;  3NQJ A;  3KXB B;  5FUG A;  3MGR D;  3REL A;  1KX3 B;  1ZLA B;  3H0L C;  1P3A B;  5CPI C;  3B0B A;  4YS3 C;  1Q9C A;  3A1I A;  3KXB D;  2BG1 A;  4WU9 C;  5B40 A;  1P3F A;  1N1J B;  3AZH B;  2J8P A;  3W96 C;  3AZE D;  5F99 B;  4Z66 B;  3B6G B;  5CPI A;  4ZBJ C;  4QLC B;  3AV2 C;  3LZ1 D;  4KGC C;  4YS3 A;  4WU9 A;  2FFF B;  2NZD C;  3EPK A;  5B1L B;  2ZM5 A;  3B6G D;  2RVQ C;  5DNN B;  1M19 C;  3C1B C;  2HIO B;  3W96 A;  3MNN C;  4DRB A;  4WV4 B;  4YM6 C;  4CAY B;  3C1C B;  3AV2 A;  4KGC A;  1TAF A;  4XUJ C;  4WU8 B;  3UTB C;  3UTA B;  4LD9 B;  3REH A;  1M19 A;  3C1B A;  3KWQ D;  3C1C D;  1S32 C;  3KUY B;  4UPK A;  3MNN A;  3AFA D;  1P34 B;  4E45 A;  5B2I B;  1P3B B;  5B1M B;  5GT3 C;  4YM6 A;  3UTA D;  5B31 C;  5AV9 C;  1KX5 B;  5B0Y B;  5AV5 B;  4JJN D;  2F8N A;  4XUJ A;  3KUY D;  3AYW C;  3UTB A;  1P34 D;  1P3B D;  3R45 B;  5B2I D;  5B32 C;  3WA9 C;  1F66 B;  3A6N D;  1S32 A;  1KX5 D;  5B0Y D;  4Z5T C;  5BO0 A;  2BYM A;  3AN2 C;  1M1A C;  1P3G C;  5GT3 A;  3REL D;  5B31 A;  5AV9 A;  2CV5 C;  1W2E A;  5BT1 C;  3LEL B;  3EG5 B;  3AYW A;  1HQ3 B;  5B24 B;  5C3I C;  5B32 A;  3REK C;  1F1E A;  1A7W A;  3WA9 A;  3VH6 W;  3KFU G;  2UWX A;  3AZM B;  1P3K A;  4Z5T A;  1M1A A;  5GSU C;  1P3G A;  4DRA A;  5B24 D;  1Z2C B;  4WZS B;  5AY8 D;  2CV5 A;  2CWE A;  3AL0 C;  3AZK C;  5BS7 C;  3REK A;  4X23 A;  1H3O A;  4WU9 D;  4Z2M H;  5GSU A;  5B2J B;  1EQZ A;  1TZY C;  1KX3 C;  4NE5 A;  5JRG B;  2ARO C;  4KHA A;  2IO5 B;  4H9R A;  3AZN C;  3W99 D;  1P3A C;  2ZY3 A;  4J8X C;  3AZK A;  3AZL B;  5BS7 A;  5B2J D;  3AZJ B;  3AV2 D;  1P3P B;  2Y2P A;  3LZ0 C;  5JRG D;  5AV8 B;  5CP6 B;  3UT9 C;  2BYK A;  3MGQ B;  4UUZ A;  2PYO C;  3REH D;  1TZY A;  1KX3 A;  1AOI B;  5AV6 C;  2ARO A;  3MGS B;  1P3O C;  5F99 C;  4Z66 C;  3AZN A;  1P3A A;  1WWS A;  4QLC C;  4J8X A;  5BNV B;  1P3I B;  3X1V C;  3LZ0 A;  3UT9 A;  4XUJ D;  3NQU B;  5B1L C;  1HTA A;  4XZQ B;  2PYO A;  5DNN C;  3AZI B;  3MGP C;  2HIO C;  5AV6 A;  2RIQ A;  4G91 B;  3EPL A;  1P3O A;  5F99 A;  3W97 C;  5GT3 D;  4XZQ D;  5G49 B;  3X1V A;  2Y2J A;  4WU8 C;  3MGR B;  3AYW D;  4J8U C;  4LD9 C;  2JE5 A;  5B0Z C;  3V9R B;  3LJA C;  3MGP A;  3REI C;  1M18 D;  2F8N H;  3WA9 D;  1P3K D;  3O62 B;  4Z5T D;  3AZF A;  3W97 A;  1M1A D;  5B1M C;  4CAY A;  5AV5 C;  5CPJ D;  3X1S B;  5AVB B;  1ID3 C;  1JFI A;  3AZG B;  2YFW B;  3O62 D;  1KX4 C;  3VH6 T;  1T3U A;  4H9N B;  1PZR A;  5BNX A;  4J8U A;  3AZE B;  2XD5 A;  5B33 A;  1KU5 A;  4LD9 A;  4EO5 C;  5B0Z A;  4X23 D;  1F66 C;  3LJA A;  3WTP B;  3REI A;  3LZ1 B;  4KUD C;  3X1S D;  5AVB D;  1BFM A;  4H9O A;  3X1T B;  3REJ C;  3AZG D;  2NQB C;  1EQZ D;  1B67 A;  1P3L C;  5AVC B;  5AV5 A;  2Y2N A;  3WTP D;  1ID3 A;  3VH5 A;  4NE3 A;  1KX4 A;  2VQR A;  3WTP E;  4J8V B;  3X1T D;  3WAA B;  3EPH A;  1F66 A;  5AVC D;  4KUD A;  3H0R C;  1U35 C;  3REJ A;  3X1U C;  2FJ7 B;  2NQB A;  4J8V D;  3WAA D;  1P3L A;  1BH8 A;  3KWQ B;  3AZN D;  3F6T A;  5E5A C;  5DNM D;  4R8P C;  3AFA B;  2FJ7 D;  2NZD A;  3UT9 D;  3B6F B;  2G5H C;  3W98 B;  4JJN B;  1U35 A;  2PYO D;  3X1U A;  2HUE B;  5KDM B;  5CPK C;  3A6N B;  2ZY4 A;  4H9P B;  3B6F D;  5E5A A;  3AZL C;  5GXQ C;  3W98 D;  4R8P A;  1P3P C;  3X1V D;  5AV8 C;  3NQJ B;  5FUG B;  3REL B;  1P3M C;  3MGQ C;  3TU4 C;  3MVD C;  3AV1 C;  1AOI C;  2XD1 A;  4E44 A;  3MGS C;  5CPK A;  3AZF D;  2ZY5 A;  3W97 D;  3WKJ C;  5B40 B;  5GXQ A;  5GT0 C;  5AV8 A;  1B6W A;  4ZUX C;  5AY8 B;  3MGQ A;  1P3M A;  3TU4 A;  3MVD A;  5B33 D;  3AV1 A;  5B40 D;  5B0Z D;  4WNN A;  5CPI B;  1P3F D;  1AOI A;  4J8W C;  3AN2 A;  4G91 C;  3MGS A;  4YS3 B;  1BH9 A;  4WU9 B;  3WKJ A;  3B0D C;  4G92 B;  5BNV A;  5JA4 A;  5GT0 A;  3EPJ A;  5CPI D;  1ID3 D;  3MGR C;  4ZUX A;  2W8S A;  2Y2Q A;  4YS3 D;  4CSR A;  3W96 B;  5CHL B;  3W99 B;  4ZBJ B;  4J8W A;  3AV2 B;  2DF4 C;  1ZLA C;  3KXB C;  3REJ D;  4NFT A;  3W96 D;  3REH B;  4KGC D;  2NZD D;  3LZ1 C;  2RVQ D;  2YFV A;  3AZH C;  3KXB A;  3C1B D;  1M19 D;  1ZLA A;  2F8N B;  4XUJ B;  3MNN D;  3B6G C;  4YM6 D;  3IP4 C;  2F8N D;  5BO0 B;  2BYM B;  3UTB D;  5GT3 B;  3LZ1 A;  5AV9 B;  5B31 B;  1N1J A;  3AZH A;  1S32 D;  2JCH A;  3AYW B;  4Z66 A;  5B32 B;  3B6G A;  2Y2K A;  4QLC A;  3C1C C;  1M18 B;  2ZY2 A;  5B31 D;  5AV9 D;  3WA9 B;  1P3K B;  4Z5T B;  3AFA C;  2JSS A;  1M1A B;  1P3G B;  3UTA C;  5B1L A;  5B32 D;  1P3M D;  3VH5 T;  5DNN A;  5CPJ B;  4JJN C;  2HIO A;  2Y2H A;  2HUE C;  3KUY C;  1P34 C;  1P3B C;  5C3I B;  5B2I C;  3AN2 D;  1P3G D;  4X23 B;  3C1C A;  1H3O B;  1KX5 C;  5B0Y C;  2CV5 D;  3WKJ D;  2Y2L A;  1R4V A;  5BT1 D;  4WU8 A;  5GSU B;  1EQZ B;  3UTA A;  3REK D;  4KHA B;  4JJN A;  4H9R B;  3KUY A;  1P34 A;  1P3B A;  2DQN C;  5B2I A;  5GSU D;  5B1M A;  4HGA B;  1KX5 A;  5B0Y A;  2BYK B;  4UUZ B;  3LEL C;  1HQ3 C;  1TZY B;  4M6B A;  5B24 C;  3R45 A;  3AZK D;  5AY8 C;  2ARO B;  3AZM C;  3AZN B;  5DNM B;  4J8X B;  2LY8 A;  1TZY D;  1ULY A;  3LZ0 B;  1KX3 D;  4AWL B;  1ZLA D;  3UT9 B;  4G92 C;  2ARO D;  3LEL A;  1P3A D;  2PYO B;  2Y2G A;  1HQ3 A;  4H9Q B;  5B24 A;  4J8X D;  5AY8 A;  5AV6 B;  3LZ0 D;  3W99 C;  3AZM A;  1P3O B;  5B2J C;  3X1V B;  5JRG C;  3AZH D;  5AV6 D;  2IO5 C;  1WWI A;  1P3O D;  5F99 D;  4Z66 D;  4H9S C;  3REH C;  4QLC D;  3MGP B;  3AZJ C;  4Z2M G;  5CP6 C;  3AZF B;  3W97 B;  3W99 A;  3VH6 A;  3A1K A;  5B1L D;  5B2J A;  5DNN D;  5JRG A;  3VH5 W;  3MGP D;  2HIO D;  1JFI B;  5BNX B;  4J8U B;  4H9S A;  5B33 B;  3AZL A;  5B0Z B;  2Y2O A;  3LJA B;  1P3I C;  3AZJ A;  3REI B;  1P3F B;  1P3P A;  4WJ3 C;  5CP6 A;  4H9O B;  4WU8 D;  3B0C W;  3H0M C;  4J8U D;  4LD9 D;  4XZQ C;  3AZI C;  3LJA D;  1ID3 B;  3REI D;  1KX4 B;  4DQY B;  5B1M D;  2L5A A;  4EO5 B;  1M18 C;  1P3I A;  5AV5 D;  1P3K C;  4KUD B;  3REJ B;  2F2A C;  2NQB B;  1KX4 D;  3NQU A;  4XZQ A;  1P3L B;  3AZI A;  5CPJ C;  1F66 D;  1BH8 B;  3O62 C;  4KGC B;  4KUD D;  1TAF B;  2NQB D;  2NZD B;  4X23 C;  1M18 A;  5G49 A;  1P3L D;  3X1S C;  5AVB C;  1M19 B;  3LEL D;  3C1B B;  3MGR A;  3AZG C;  1U35 B;  3X1U B;  1EQZ C;  1HQ3 D;  3AZE C;  2F8N G;  3MNN B;  5CPJ A;  3V9R A;  3WTP C;  4YM6 B;  3AZM D;  3O62 A;  4NE6 A;  5E5A B;  3X1T C;  4R8P B;  1U35 D;  3X1U D;  4HGA C;  3UTB B;  5AVC C;  3X1S A;  5AVB A;  5B31 G;  3AZG A;  2YFW A;  1S32 B;  5E5A D;  4J8V C;  4H9N A;  4R8P D;  3WAA C;  3AZE A;  3FDD A;  5CPK B;  3WTP A;  5B32 G;  5DNM C;  5GXQ B;  2G5I C;  3X1T A;  2FJ7 C;  3KSY A;  2Y2I A;  4AWL C;  5AVC A;  1P3M B;  5CPK D;  3KWQ C;  3TU4 B;  3MVD B;  3AZL D;  3AV1 B;  5GXQ D;  4J8V A;  4WNN B;  2F8N K;  3WAA A;  3AZJ D;  1P3P D;  3AN2 B;  2Y2M A;  5CP6 D;  5AV8 D;  1BH9 B;  3B6F C;  3WKJ B;  3W98 C;  3MGQ D;  2CV5 B;  5DNM A;  3TU4 D;  3MVD D;  5JA4 B;  5GT0 B;  2FJ7 A;  3AV1 D;  1AOI D;  4ZUX B;  3MGS D;  3REK B;  4CSR B;  3A6N C;  3KWQ A;  4H9Q A;  3AFA A;  1P3I D;  3B0C T;  5GT0 D;  4J8W B;  3REL C;  4ZUX D;  3AZF C;  3B6F A;  3B0D B;  3W98 A;  3AZI D;  3AZK B;  5KDM A;  4J8W D; 
#chains in the Genus database with same CATH homology
 3A6N A;  4H9P A;  5B33 C;  3P5J B;  5B40 C;  1P3F C;  2YFV B;  3NQJ A;  3KXB B;  5FUG A;  3MGR D;  3REL A;  1KX3 B;  1ZLA B;  3H0L C;  1P3A B;  5CPI C;  3B0B A;  4YS3 C;  1Q9C A;  3A1I A;  3KXB D;  2BG1 A;  4WU9 C;  5B40 A;  1P3F A;  1N1J B;  3AZH B;  2J8P A;  3W96 C;  3AZE D;  5F99 B;  4Z66 B;  3B6G B;  5CPI A;  4ZBJ C;  4QLC B;  3AV2 C;  3LZ1 D;  4KGC C;  4YS3 A;  4WU9 A;  2FFF B;  2NZD C;  3EPK A;  5B1L B;  2ZM5 A;  3B6G D;  2RVQ C;  5DNN B;  1M19 C;  3C1B C;  2HIO B;  3W96 A;  3MNN C;  4DRB A;  4WV4 B;  4YM6 C;  4CAY B;  3C1C B;  3AV2 A;  4KGC A;  1TAF A;  4XUJ C;  4WU8 B;  3UTB C;  3UTA B;  4LD9 B;  3REH A;  1M19 A;  3C1B A;  3KWQ D;  3C1C D;  1S32 C;  3KUY B;  4UPK A;  3MNN A;  3AFA D;  1P34 B;  4E45 A;  5B2I B;  1P3B B;  5B1M B;  5GT3 C;  4YM6 A;  3UTA D;  5B31 C;  5AV9 C;  1KX5 B;  5B0Y B;  5AV5 B;  4JJN D;  2F8N A;  4XUJ A;  3KUY D;  3AYW C;  3UTB A;  1P34 D;  1P3B D;  3R45 B;  5B2I D;  5B32 C;  3WA9 C;  1F66 B;  3A6N D;  1S32 A;  1KX5 D;  5B0Y D;  4Z5T C;  5BO0 A;  2BYM A;  3AN2 C;  1M1A C;  1P3G C;  5GT3 A;  3REL D;  5B31 A;  5AV9 A;  2CV5 C;  1W2E A;  5BT1 C;  3LEL B;  3EG5 B;  3AYW A;  1HQ3 B;  5B24 B;  5C3I C;  5B32 A;  3REK C;  1F1E A;  1A7W A;  3WA9 A;  3VH6 W;  3KFU G;  2UWX A;  3AZM B;  1P3K A;  4Z5T A;  1M1A A;  5GSU C;  1P3G A;  4DRA A;  5B24 D;  1Z2C B;  4WZS B;  5AY8 D;  2CV5 A;  2CWE A;  3AL0 C;  3AZK C;  5BS7 C;  3REK A;  4X23 A;  1H3O A;  4WU9 D;  4Z2M H;  5GSU A;  5B2J B;  1EQZ A;  1TZY C;  1KX3 C;  4NE5 A;  5JRG B;  2ARO C;  4KHA A;  2IO5 B;  4H9R A;  3AZN C;  3W99 D;  1P3A C;  2ZY3 A;  4J8X C;  3AZK A;  3AZL B;  5BS7 A;  5B2J D;  3AZJ B;  3AV2 D;  1P3P B;  2Y2P A;  3LZ0 C;  5JRG D;  5AV8 B;  5CP6 B;  3UT9 C;  2BYK A;  3MGQ B;  4UUZ A;  2PYO C;  3REH D;  1TZY A;  1KX3 A;  1AOI B;  5AV6 C;  2ARO A;  3MGS B;  1P3O C;  5F99 C;  4Z66 C;  3AZN A;  1P3A A;  1WWS A;  4QLC C;  4J8X A;  5BNV B;  1P3I B;  3X1V C;  3LZ0 A;  3UT9 A;  4XUJ D;  3NQU B;  5B1L C;  1HTA A;  4XZQ B;  2PYO A;  5DNN C;  3AZI B;  3MGP C;  2HIO C;  5AV6 A;  2RIQ A;  4G91 B;  3EPL A;  1P3O A;  5F99 A;  3W97 C;  5GT3 D;  4XZQ D;  5G49 B;  3X1V A;  2Y2J A;  4WU8 C;  3MGR B;  3AYW D;  4J8U C;  4LD9 C;  2JE5 A;  5B0Z C;  3V9R B;  3LJA C;  3MGP A;  3REI C;  1M18 D;  2F8N H;  3WA9 D;  1P3K D;  3O62 B;  4Z5T D;  3AZF A;  3W97 A;  1M1A D;  5B1M C;  4CAY A;  5AV5 C;  5CPJ D;  3X1S B;  5AVB B;  1ID3 C;  1JFI A;  3AZG B;  2YFW B;  3O62 D;  1KX4 C;  3VH6 T;  1T3U A;  4H9N B;  1PZR A;  5BNX A;  4J8U A;  3AZE B;  2XD5 A;  5B33 A;  1KU5 A;  4LD9 A;  4EO5 C;  5B0Z A;  4X23 D;  1F66 C;  3LJA A;  3WTP B;  3REI A;  3LZ1 B;  4KUD C;  3X1S D;  5AVB D;  1BFM A;  4H9O A;  3X1T B;  3REJ C;  3AZG D;  2NQB C;  1EQZ D;  1B67 A;  1P3L C;  5AVC B;  5AV5 A;  2Y2N A;  3WTP D;  1ID3 A;  3VH5 A;  4NE3 A;  1KX4 A;  2VQR A;  3WTP E;  4J8V B;  3X1T D;  3WAA B;  3EPH A;  1F66 A;  5AVC D;  4KUD A;  3H0R C;  1U35 C;  3REJ A;  3X1U C;  2FJ7 B;  2NQB A;  4J8V D;  3WAA D;  1P3L A;  1BH8 A;  3KWQ B;  3AZN D;  3F6T A;  5E5A C;  5DNM D;  4R8P C;  3AFA B;  2FJ7 D;  2NZD A;  3UT9 D;  3B6F B;  2G5H C;  3W98 B;  4JJN B;  1U35 A;  2PYO D;  3X1U A;  2HUE B;  5KDM B;  5CPK C;  3A6N B;  2ZY4 A;  4H9P B;  3B6F D;  5E5A A;  3AZL C;  5GXQ C;  3W98 D;  4R8P A;  1P3P C;  3X1V D;  5AV8 C;  3NQJ B;  5FUG B;  3REL B;  1P3M C;  3MGQ C;  3TU4 C;  3MVD C;  3AV1 C;  1AOI C;  2XD1 A;  4E44 A;  3MGS C;  5CPK A;  3AZF D;  2ZY5 A;  3W97 D;  3WKJ C;  5B40 B;  5GXQ A;  5GT0 C;  5AV8 A;  1B6W A;  4ZUX C;  5AY8 B;  3MGQ A;  1P3M A;  3TU4 A;  3MVD A;  5B33 D;  3AV1 A;  5B40 D;  5B0Z D;  4WNN A;  5CPI B;  1P3F D;  1AOI A;  4J8W C;  3AN2 A;  4G91 C;  3MGS A;  4YS3 B;  1BH9 A;  4WU9 B;  3WKJ A;  3B0D C;  4G92 B;  5BNV A;  5JA4 A;  5GT0 A;  3EPJ A;  5CPI D;  1ID3 D;  3MGR C;  4ZUX A;  2W8S A;  2Y2Q A;  4YS3 D;  4CSR A;  3W96 B;  5CHL B;  3W99 B;  4ZBJ B;  4J8W A;  3AV2 B;  2DF4 C;  1ZLA C;  3KXB C;  3REJ D;  4NFT A;  3W96 D;  3REH B;  4KGC D;  2NZD D;  3LZ1 C;  2RVQ D;  2YFV A;  3AZH C;  3KXB A;  3C1B D;  1M19 D;  1ZLA A;  2F8N B;  4XUJ B;  3MNN D;  3B6G C;  4YM6 D;  3IP4 C;  2F8N D;  5BO0 B;  2BYM B;  3UTB D;  5GT3 B;  3LZ1 A;  5AV9 B;  5B31 B;  1N1J A;  3AZH A;  1S32 D;  2JCH A;  3AYW B;  4Z66 A;  5B32 B;  3B6G A;  2Y2K A;  4QLC A;  3C1C C;  1M18 B;  2ZY2 A;  5B31 D;  5AV9 D;  3WA9 B;  1P3K B;  4Z5T B;  3AFA C;  2JSS A;  1M1A B;  1P3G B;  3UTA C;  5B1L A;  5B32 D;  1P3M D;  3VH5 T;  5DNN A;  5CPJ B;  4JJN C;  2HIO A;  2Y2H A;  2HUE C;  3KUY C;  1P34 C;  1P3B C;  5C3I B;  5B2I C;  3AN2 D;  1P3G D;  4X23 B;  3C1C A;  1H3O B;  1KX5 C;  5B0Y C;  2CV5 D;  3WKJ D;  2Y2L A;  1R4V A;  5BT1 D;  4WU8 A;  5GSU B;  1EQZ B;  3UTA A;  3REK D;  4KHA B;  4JJN A;  4H9R B;  3KUY A;  1P34 A;  1P3B A;  2DQN C;  5B2I A;  5GSU D;  5B1M A;  4HGA B;  1KX5 A;  5B0Y A;  2BYK B;  4UUZ B;  3LEL C;  1HQ3 C;  1TZY B;  4M6B A;  5B24 C;  3R45 A;  3AZK D;  5AY8 C;  2ARO B;  3AZM C;  3AZN B;  5DNM B;  4J8X B;  2LY8 A;  1TZY D;  1ULY A;  3LZ0 B;  1KX3 D;  4AWL B;  1ZLA D;  3UT9 B;  4G92 C;  2ARO D;  3LEL A;  1P3A D;  2PYO B;  2Y2G A;  1HQ3 A;  4H9Q B;  5B24 A;  4J8X D;  5AY8 A;  5AV6 B;  3LZ0 D;  3W99 C;  3AZM A;  1P3O B;  5B2J C;  3X1V B;  5JRG C;  3AZH D;  5AV6 D;  2IO5 C;  1WWI A;  1P3O D;  5F99 D;  4Z66 D;  4H9S C;  3REH C;  4QLC D;  3MGP B;  3AZJ C;  4Z2M G;  5CP6 C;  3AZF B;  3W97 B;  3W99 A;  3VH6 A;  3A1K A;  5B1L D;  5B2J A;  5DNN D;  5JRG A;  3VH5 W;  3MGP D;  2HIO D;  1JFI B;  5BNX B;  4J8U B;  4H9S A;  5B33 B;  3AZL A;  5B0Z B;  2Y2O A;  3LJA B;  1P3I C;  3AZJ A;  3REI B;  1P3F B;  1P3P A;  4WJ3 C;  5CP6 A;  4H9O B;  4WU8 D;  3B0C W;  3H0M C;  4J8U D;  4LD9 D;  4XZQ C;  3AZI C;  3LJA D;  1ID3 B;  3REI D;  1KX4 B;  4DQY B;  5B1M D;  2L5A A;  4EO5 B;  1M18 C;  1P3I A;  5AV5 D;  1P3K C;  4KUD B;  3REJ B;  2F2A C;  2NQB B;  1KX4 D;  3NQU A;  4XZQ A;  1P3L B;  3AZI A;  5CPJ C;  1F66 D;  1BH8 B;  3O62 C;  4KGC B;  4KUD D;  1TAF B;  2NQB D;  2NZD B;  4X23 C;  1M18 A;  5G49 A;  1P3L D;  3X1S C;  5AVB C;  1M19 B;  3LEL D;  3C1B B;  3MGR A;  3AZG C;  1U35 B;  3X1U B;  1EQZ C;  1HQ3 D;  3AZE C;  2F8N G;  3MNN B;  5CPJ A;  3V9R A;  3WTP C;  4YM6 B;  3AZM D;  3O62 A;  4NE6 A;  5E5A B;  3X1T C;  4R8P B;  1U35 D;  3X1U D;  4HGA C;  3UTB B;  5AVC C;  3X1S A;  5AVB A;  5B31 G;  3AZG A;  2YFW A;  1S32 B;  5E5A D;  4J8V C;  4H9N A;  4R8P D;  3WAA C;  3AZE A;  3FDD A;  5CPK B;  3WTP A;  5B32 G;  5DNM C;  5GXQ B;  2G5I C;  3X1T A;  2FJ7 C;  3KSY A;  2Y2I A;  4AWL C;  5AVC A;  1P3M B;  5CPK D;  3KWQ C;  3TU4 B;  3MVD B;  3AZL D;  3AV1 B;  5GXQ D;  4J8V A;  4WNN B;  2F8N K;  3WAA A;  3AZJ D;  1P3P D;  3AN2 B;  2Y2M A;  5CP6 D;  5AV8 D;  1BH9 B;  3B6F C;  3WKJ B;  3W98 C;  3MGQ D;  2CV5 B;  5DNM A;  3TU4 D;  3MVD D;  5JA4 B;  5GT0 B;  2FJ7 A;  3AV1 D;  1AOI D;  4ZUX B;  3MGS D;  3REK B;  4CSR B;  3A6N C;  3KWQ A;  4H9Q A;  3AFA A;  1P3I D;  3B0C T;  5GT0 D;  4J8W B;  3REL C;  4ZUX D;  3AZF C;  3B6F A;  3B0D B;  3W98 A;  3AZI D;  3AZK B;  5KDM A;  4J8W D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...