4LD9A

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9A00
4KUDB 3AYWD 1TZYB 1ZLAB 5GXQC 4KHAB 5GT3C 1H3OB 5DNND 2YFVA 1M1AB 3X1VC 3UTBD 2F8ND 2PYOB 1P3MA 4JJNB 3LZ1A 3W98C 3MNNC 5AV8C 5B24B 3A6NC 2F8NG 5AY8C 1JFIB 3UTAD 4WU9D 5BO0B 4KGCB 3REID 4UUZB 4XZQD 5B0ZB 3MVDC 5JRGB 4Z66B 3WTPA 5G49A 3KXBB 5B31A 3O62B 3WKJD 3TU4B 2BYKB 4EO5B 1P3AC 3MGSA 5B32D 4J8XD 4H9SA 5CP6D 3LELA 5B32G 1P3FB 5B2IA 1BH8B 1P3BA 3NQUB 4E44A 4J8VD 3REJD 2NQBB 4R8PD 1KX3B 1P34A 3VH5W 3AFAC 2CWEA 5B40B 3UTBA 2F8NA 3AV2C 1TZYC 5AVCB 4ZUXB 4WU8C 5CPJC 4Z5TC 3MGPB 1P3GA 4NE5A 5B2JB 3MGRD 3RELB 3AZHC 1M1AC 4JJNC 5GXQD 3X1SA 5GT3D 1WWIA 3AYWB 4XZQA 2HIOC 1AOIA 1P3IC 3W98D 3MNND 4H9NB 3A6ND 5B32A 2L5AA 1U35A 3AZNB 3KXBC 3B0DB 1TAFB 5BNXB 3REKA 3UTAB 4WU9B 3AV1D 2BYMA 3R45A 5B33B 3MGQC 5GT0D 4QLCB 3X1UA 4R8PA 3AZIB 1P3LD 5AV6D 1P3FC 1P3OA 3WKJB 5B1LB 3KUYB 3W97C 4DRBA 2NQBC 5B0YB 4CAYA 5CP6B 1KX5A 5B40C 1N1JB 3AZKB 3WA9B 5GSUC 3AFAD 3RELC 2CV5A 4ZBJB 4KUDD 2LY8A 3X1TB 1P3KC 3B6FA 3AV2D 1TZYD 1S32A 5CPJD 4Z5TD 1WWSA 4H9OA 1M1AD 3REHA 1EQZB 3KSYA 3MGRB 3AZJB 2PYOD 4JJND 3KWQC 3C1BC 5B24D 3AV1A 5GXQB 5GT3B 5DNMC 3X1VB 4CSRA 4X23B 5AV6A 1P3LA 4KGCD 4Z66D 3V9RB 5F99C 5B33C 5AV8B 3AZEC 3KXBD 4QLCC 3LELC 3W96C 5AY8B 3O62D 1ID3C 3B0CT 1BFMA 5B1LC 3MVDB 1M18A 4Z2MG 1P3FD 5AV5C 5AVBC 1A7WA 5AV9C 3AZKC 1P3AB 1ZLAA 3W97D 2NQBD 1KX3D 3AZFA 5CPIA 4NE3A 5B40D 4YS3C 2PYOA 4DRAA 5AVCD 4ZUXD 5BS7C 3MGPD 5B24A 1P3PC 5GSUD 3RELD 1EQZC 1JFIA 3W99B 3AFAB 2F8NH 2AROA 4KGCA 4WU8B 3AV2B 4UUZA 5CPJB 5B0ZA 4Z5TB 5JRGA 4H9PB 5B1MC 4J8UC 5CPKC 3AZHB 3AZLB 3O62A 5FUGB 3C1BD 2BYKA 4X23C 1BH9B 3TU4A 3LJAB 4E45A 3AZND 1F66C 2HIOB 1P3IB 5BNVB 3AZGC 2FJ7C 5F99D 5B33D 3AZED 3NQUA 4QLCD 4XUJA 1KX4C 3C1CC 1KX3A 3AZID 3LZ0C 1ID3D 4YM6B 4LD9A 5B1LD 4G91B 4ZUXA 5AVCA 3KUYD 1HQ3B 5C3IC 3MGQB 5B0YD 5B2JA 1M19C 5AVBD 3AZKD 2NZDC 3AYWA 3WA9D 4J8WC 5E5AC 3W97B 3VH6T 5DNNA 3AN2C 3X1TD 3W99C 3NQJB 4YS3D 4H9NA 3UT9C 3B0CW 1EQZD 2YFVB 5GSUB 3AZJD 3AZLC 3WAAC 5JA4B 1TAFA 5BNXA 1P3KB 3UTAA 4WU9A 3LJAC 3REIA 4NFTA 5B1MD 5KDMA 2YFWB 4J8UD 5CPKD 3X1VD 3AZIA 4X23D 3VH5A 3KWQB 3WKJA 3C1BB 5AV8D 3KUYA 5G49B 5AY8D 5B0YA 4J8XA 5DNMB 5CP6A 3B6GC 3AZGD 1N1JA 4YM6C 3MGSB 3MVDD 4G91C 1KX4D 5F99B 1HQ3C 3AZEB 4J8VA 3LZ0D 3WA9A 3LELB 3REJA 3W96B 3AZMC 3X1TA 1P3AD 1P3BB 1ID3B 2IO5B 4WNNB 5BT1C 1M19D 1P34B 4NE6A 3MGRA 3AZJA 5AV5B 5AVBB 5AV9B 4J8WD 1P3GB 5GT3A 5GXQA 2HUEC 3W99D 3X1VA 1P3MC 4YS3B 4WU8D 3LZ1C 3UT9D 3W98A 3MNNA 3V9RA 3A6NA 1P3PB 3AZLD 3AZHD 3WAAD 5AY8A 3LJAD 4H9QB 3MVDA 2HIOD 3WTPC 5B1MB 5GT0A 4J8UB 5CPKB 1P3ID 5B31C 3REKB 3VH6W 4LD9C 1P3AA 3MGSC 1HTAA 4H9SC 1F66B 4HGAB 3X1UB 4YM6D 1P3OB 5B2IC 1P3BC 3AZGB 2FJ7B 2IO5C 1HQ3D 3MGQD 1KX4B 3C1CB 4CAYB 1P34C 1KX5B 3LZ0B 3AZMD 3AFAA 4KUDA 3UTBC 4WU8A 1TZYA 3AV2A 1F1EA 5CPJA 1P3GC 4Z5TA 5BT1D 5C3IB 4KHAA 1H3OA 3AZHA 1M19B 1M1AA 1BH9A 4JJNA 3X1SC 2NZDB 4G92B 4XZQC 3WTPE 5E5AB 4J8WB 2HIOA 1AOIC 3AN2B 1P3MD 1P3IA 1P3KD 3LZ1D 1Q9CA 5BO0A 3UT9B 5B32C 1U35C 4Z66A 3KXBA 3WAAB 3KWQD 3REKC 3WTPD 3MGQA 4HGAC 5DNMD 3X1UC 4R8PC 1P3OC 3MGSD 1P3FA 1BH8A 3W97A 3LELD 3W96D 2NQBA 1KX5C 3B6GB 3NQJA 1P3BD 4H9RB 5B40A 3MGPA 1P34D 3AZFB 5CPIB 2CV5C 5GSUA 3RELA 5AV5D 5JA4A 3AZMB 5AV9D 1S32C 1P3KA 3B6FC 1P3GD 4G92C 2YFWA 3REHC 1B67A 2AROB 3KWQA 3X1SD 3C1BA 3AV1C 1P3PD 1AOID 5GT0C 2HUEB 1KU5A 1R4VA 3AZNA 5DNMA 1P3LC 5AV6C 1P3MB 3LZ1B 1U35D 2RVQC 5F99A 5B33A 3AZEA 4QLCA 3W96A 3REKD 1ID3A 4WNNA 2F8NK 5B1LA 4XUJB 1M18C 1F66D 3WTPB 3X1UD 1P3OD 5B31B 4KUDC 2FJ7D 4LD9B 5AV5A 5AVBA 5AV9A 3AZKA 1ZLAC 3B0BA 3C1CD 5CPIC 3AZFC 1KX5D 2PYOC 5B2IB 4YS3A 5CHLB 5BS7A 1B6WA 5B24C 1ULYA 2CV5D 1P3PA 5DNNB 1EQZA 4WV4B 3B6FD 1S32D 2AROC 3UTBB 2F8NB 4KGCC 2NZDD 4WZSB 4H9QA 5B0ZC 5E5AD 5JRGC 4Z66C 3REHD 3AN2D 5B1MA 4J8UA 5CPKA 3O62C 3TU4C 4X23A 4EO5C 3X1SB 3REIB 5KDMB 4XZQB 5AV8A 1F66A 1AOIB 4AWLB 3AZGA 2FJ7A 2RVQD 4XUJC 5B32B 1KX4A 3C1CA 1U35B 1KX3C 4J8XB 3LZ0A 4Z2MH 2BYMB 4ZUXC 3R45B 5AVCC 1M18D 3MGPC 4J8VB 4M6BA 5B2JC 3REJB 3B6GD 4R8PB 1M19A 1ZLAD 3AYWC 2NZDA 3AZFD 5CPID 4J8WA 5E5AA 5DNNC 3AN2A 3W99A 3VH6A 3UT9A 4H9PA 3AZNC 3B0DC 2CV5B 2AROD 3AZLA 3WAAA 5FUGA 3B6FB 3UTAC 1S32B 4WU9C 5B0ZD 3W98B 5JRGD 3MNNB 3LJAA 3REIC 4H9OB 3VH5T 3A6NB 2JSSA 3REHB 3TU4D 3AZIC 5BNVA 3WKJC 4AWLC 3AV1B 3KUYC 5GT0B 5B0YC 4J8XC 5CP6C 3B6GA 4H9RA 4CSRB 5AV6B 1P3LB 4YM6A 4XUJD 1HQ3A 4J8VC 3WA9C 3REJC 5B31D 4ZBJC 4LD9D 3X1TC 3AZMA 5B31G 1M18B 5B2JD 3MGRC 3AZJC 5B2ID
chains in the Genus database with same CATH superfamily
4KUDB 3AYWD 1TZYB 1ZLAB 5GXQC 4KHAB 5GT3C 1H3OB 5DNND 2YFVA 1M1AB 3X1VC 3UTBD 2F8ND 2PYOB 1P3MA 4JJNB 3LZ1A 3W98C 3MNNC 5AV8C 5B24B 3A6NC 2F8NG 5AY8C 1JFIB 3UTAD 4WU9D 5BO0B 4KGCB 3REID 4UUZB 4XZQD 5B0ZB 3MVDC 3EPLA 5JRGB 4Z66B 3WTPA 5G49A 3KXBB 3EG5B 5B31A 3O62B 3WKJD 3TU4B 2BYKB 4EO5B 1P3AC 3MGSA 5B32D 1W2EA 4J8XD 4H9SA 5CP6D 3LELA 5B32G 1P3FB 5B2IA 1BH8B 1P3BA 3NQUB 4E44A 4J8VD 3REJD 2NQBB 4R8PD 1KX3B 1P34A 3VH5W 3AFAC 2CWEA 5B40B 3UTBA 2F8NA 2F2AC 3AV2C 1TZYC 4ZUXB 5AVCB 4WU8C 5CPJC 4Z5TC 3MGPB 1P3GA 3H0LC 4NE5A 5B2JB 3MGRD 3RELB 3AZHC 1M1AC 3H0MC 4JJNC 5GXQD 3X1SA 5GT3D 1WWIA 3AYWB 4XZQA 2HIOC 1AOIA 1P3IC 3W98D 3MNND 4H9NB 3A6ND 5B32A 2L5AA 1U35A 3AZNB 3KXBC 3B0DB 1TAFB 5BNXB 3REKA 2Y2PA 3UTAB 4WU9B 3AV1D 2BYMA 3R45A 5B33B 2G5HC 3MGQC 5GT0D 4QLCB 3X1UA 4R8PA 3AZIB 1P3LD 5AV6D 1P3FC 1P3OA 3WKJB 5B1LB 3KUYB 3W97C 4DRBA 2NQBC 2UWXA 5B0YB 4CAYA 2Y2MA 5CP6B 1KX5A 5B40C 1N1JB 2Y2LA 3AZKB 3WA9B 5GSUC 3AFAD 3RELC 2CV5A 4ZBJB 4KUDD 2LY8A 3X1TB 1P3KC 3B6FA 3AV2D 1TZYD 1S32A 5CPJD 4Z5TD 1WWSA 4H9OA 1M1AD 3REHA 1EQZB 3KSYA 3MGRB 3AZJB 2PYOD 4JJND 3KWQC 3C1BC 5B24D 4UPKA 3AV1A 5GXQB 5GT3B 5DNMC 2Y2KA 3X1VB 4CSRA 4X23B 5AV6A 1P3LA 4KGCD 4WJ3C 4Z66D 3V9RB 5F99C 5B33C 5AV8B 3AZEC 3KXBD 4QLCC 3LELC 3W96C 5AY8B 3O62D 1ID3C 3B0CT 1BFMA 5B1LC 3MVDB 2Y2GA 1M18A 4Z2MG 1P3FD 5AV5C 5AVBC 1A7WA 5AV9C 3H0RC 1Z2CB 3AZKC 1P3AB 1ZLAA 3W97D 3P5JB 2NQBD 1KX3D 3AZFA 5CPIA 4NE3A 5B40D 4YS3C 2PYOA 4DRAA 4ZUXD 5AVCD 5BS7C 3MGPD 5B24A 1P3PC 5GSUD 3RELD 1EQZC 1JFIA 2ZM5A 3W99B 3AFAB 2F8NH 2AROA 4KGCA 4WU8B 3AV2B 4UUZA 5CPJB 2JCHA 5B0ZA 4Z5TB 4H9PB 5JRGA 5B1MC 4J8UC 5CPKC 3AZHB 3AZLB 3O62A 5FUGB 3C1BD 2BYKA 4X23C 1BH9B 3TU4A 3LJAB 4E45A 3AZND 1F66C 2HIOB 3F6TA 1P3IB 5BNVB 3AZGC 2FJ7C 5F99D 5B33D 3AZED 3NQUA 4QLCD 4XUJA 2Y2JA 1KX4C 3C1CC 1KX3A 3AZID 3LZ0C 1ID3D 4YM6B 4LD9A 5B1LD 4G91B 4ZUXA 5AVCA 3KUYD 1HQ3B 5C3IC 3MGQB 2VQRA 5B0YD 5B2JA 1M19C 5AVBD 3AZKD 2NZDC 3AYWA 3WA9D 4J8WC 5E5AC 3W97B 3VH6T 5DNNA 2Y2IA 3AN2C 3X1TD 3W99C 3NQJB 4YS3D 4H9NA 3UT9C 3B0CW 1EQZD 2YFVB 5GSUB 3AZJD 3AZLC 3WAAC 5JA4B 1TAFA 5BNXA 1P3KB 3UTAA 4WU9A 3LJAC 3REIA 4NFTA 5B1MD 5KDMA 2YFWB 4J8UD 5CPKD 3X1VD 3AL0C 3AZIA 4X23D 3VH5A 3KWQB 3WKJA 3C1BB 5AV8D 3KUYA 5G49B 5AY8D 5B0YA 4J8XA 5DNMB 5CP6A 3B6GC 3AZGD 1N1JA 4YM6C 3MGSB 3MVDD 4G91C 1KX4D 5F99B 1HQ3C 3AZEB 4J8VA 3LZ0D 3WA9A 3LELB 3REJA 3W96B 3AZMC 3X1TA 1P3AD 1P3BB 1ID3B 2IO5B 4WNNB 5BT1C 1M19D 1P34B 4NE6A 2Y2NA 3MGRA 3AZJA 5AV5B 5AVBB 5AV9B 4J8WD 1P3GB 5GT3A 5GXQA 2HUEC 3W99D 3X1VA 3EPHA 1P3MC 4YS3B 4WU8D 3LZ1C 3UT9D 3W98A 2XD1A 3V9RA 3MNNA 3A6NA 1P3PB 3IP4C 3AZLD 3AZHD 3WAAD 5AY8A 3LJAD 3KFUG 4H9QB 3MVDA 2HIOD 3WTPC 5B1MB 5GT0A 4J8UB 5CPKB 1P3ID 5B31C 3REKB 3VH6W 4LD9C 2XD5A 1P3AA 3MGSC 1HTAA 4H9SC 1F66B 4HGAB 3X1UB 4YM6D 1P3OB 5B2IC 1P3BC 3AZGB 2FJ7B 2IO5C 1HQ3D 3MGQD 1KX4B 3C1CB 4CAYB 2G5IC 1P34C 1KX5B 3LZ0B 3AZMD 3AFAA 4KUDA 3UTBC 4WU8A 1TZYA 3AV2A 1F1EA 5CPJA 1P3GC 4Z5TA 5BT1D 5C3IB 4KHAA 1H3OA 3AZHA 1M19B 1M1AA 1BH9A 4JJNA 3X1SC 2NZDB 4G92B 4XZQC 3WTPE 5E5AB 4J8WB 2HIOA 1AOIC 3AN2B 1P3MD 1P3IA 1P3KD 3LZ1D 1Q9CA 5BO0A 3UT9B 5B32C 1U35C 2FFFB 1T3UA 4Z66A 3KXBA 3WAAB 3KWQD 3FDDA 3REKC 2Y2HA 3WTPD 3MGQA 4HGAC 5DNMD 3X1UC 4R8PC 1P3OC 3MGSD 1P3FA 1BH8A 3W97A 3LELD 3W96D 2NQBA 1KX5C 3B6GB 3NQJA 1P3BD 4H9RB 5B40A 2DQNC 3MGPA 1P34D 3AZFB 5CPIB 2CV5C 5GSUA 3RELA 2RIQA 5AV5D 5JA4A 3AZMB 5AV9D 1S32C 1P3KA 3B6FC 1P3GD 3EPJA 4G92C 2YFWA 3REHC 1B67A 2AROB 3KWQA 3X1SD 3C1BA 3AV1C 1P3PD 1AOID 5GT0C 2HUEB 1KU5A 1R4VA 3AZNA 5DNMA 2ZY4A 1P3LC 5AV6C 1P3MB 1PZRA 3LZ1B 1U35D 2RVQC 5F99A 5B33A 3AZEA 4QLCA 3W96A 3REKD 1ID3A 2JE5A 4WNNA 2F8NK 5B1LA 4XUJB 1M18C 1F66D 3WTPB 3X1UD 1P3OD 5B31B 4KUDC 2FJ7D 4LD9B 5AV5A 5AVBA 5AV9A 3AZKA 1ZLAC 3B0BA 3C1CD 5CPIC 3AZFC 1KX5D 2PYOC 5B2IB 4YS3A 5CHLB 5BS7A 1B6WA 5B24C 1ULYA 2CV5D 1P3PA 5DNNB 1EQZA 4WV4B 3B6FD 1S32D 2AROC 2ZY2A 4DQYB 3UTBB 2F8NB 4KGCC 2NZDD 4WZSB 4H9QA 5B0ZC 5E5AD 5JRGC 4Z66C 3REHD 3AN2D 5B1MA 4J8UA 5CPKA 3O62C 3TU4C 4X23A 4EO5C 3X1SB 3REIB 5KDMB 4XZQB 5AV8A 1F66A 2BG1A 1AOIB 2ZY5A 4AWLB 3AZGA 2FJ7A 2RVQD 4XUJC 5B32B 1KX4A 3C1CA 1U35B 1KX3C 4J8XB 3LZ0A 2Y2QA 4Z2MH 2BYMB 4ZUXC 3R45B 5AVCC 1M18D 3MGPC 4J8VB 4M6BA 5B2JC 3REJB 3B6GD 4R8PB 1M19A 1ZLAD 2Y2OA 3AYWC 2NZDA 3A1IA 3AZFD 5CPID 4J8WA 5E5AA 2DF4C 5DNNC 3AN2A 3W99A 3VH6A 3A1KA 3UT9A 2J8PA 4H9PA 3AZNC 3B0DC 2CV5B 2AROD 3AZLA 3WAAA 5FUGA 3B6FB 3UTAC 1S32B 4WU9C 5B0ZD 3W98B 5JRGD 3MNNB 3LJAA 3EPKA 4H9OB 3VH5T 3A6NB 3REIC 2JSSA 3REHB 3TU4D 3AZIC 5BNVA 3WKJC 4AWLC 3AV1B 3KUYC 5GT0B 5B0YC 4J8XC 5CP6C 3B6GA 4H9RA 4CSRB 5AV6B 1P3LB 4YM6A 4XUJD 1HQ3A 4J8VC 3WA9C 3REJC 5B31D 4ZBJC 4LD9D 3X1TC 2W8SA 3AZMA 5B31G 1M18B 5B2JD 2ZY3A 3MGRC 3AZJC 5B2ID
chains in the Genus database with same CATH topology
4KUDB 3AYWD 1TZYB 1ZLAB 5GXQC 4KHAB 5GT3C 1H3OB 5DNND 2YFVA 1M1AB 3X1VC 3UTBD 2F8ND 2PYOB 1P3MA 4JJNB 3LZ1A 3W98C 3MNNC 5AV8C 5B24B 3A6NC 2F8NG 5AY8C 1JFIB 3UTAD 4WU9D 5BO0B 4KGCB 3REID 4UUZB 4XZQD 5B0ZB 3MVDC 3EPLA 5JRGB 4Z66B 3WTPA 5G49A 3KXBB 3EG5B 5B31A 3O62B 3WKJD 3TU4B 2BYKB 4EO5B 1P3AC 3MGSA 5B32D 1W2EA 4J8XD 4H9SA 5CP6D 3LELA 5B32G 1P3FB 5B2IA 1BH8B 1P3BA 3NQUB 4E44A 4J8VD 3REJD 2NQBB 4R8PD 1KX3B 1P34A 3VH5W 3AFAC 2CWEA 5B40B 3UTBA 2F8NA 2F2AC 3AV2C 1TZYC 4ZUXB 5AVCB 4WU8C 5CPJC 4Z5TC 3MGPB 1P3GA 3H0LC 4NE5A 5B2JB 3MGRD 3RELB 3AZHC 1M1AC 3H0MC 4JJNC 5GXQD 3X1SA 5GT3D 1WWIA 3AYWB 4XZQA 2HIOC 1AOIA 1P3IC 3W98D 3MNND 4H9NB 3A6ND 5B32A 2L5AA 1U35A 3AZNB 3KXBC 3B0DB 1TAFB 5BNXB 3REKA 2Y2PA 3UTAB 4WU9B 3AV1D 2BYMA 3R45A 5B33B 2G5HC 3MGQC 5GT0D 4QLCB 3X1UA 4R8PA 3AZIB 1P3LD 5AV6D 1P3FC 1P3OA 3WKJB 5B1LB 3KUYB 3W97C 4DRBA 2NQBC 2UWXA 5B0YB 4CAYA 2Y2MA 5CP6B 1KX5A 5B40C 1N1JB 2Y2LA 3AZKB 3WA9B 5GSUC 3AFAD 3RELC 2CV5A 4ZBJB 4KUDD 2LY8A 3X1TB 1P3KC 3B6FA 3AV2D 1TZYD 1S32A 5CPJD 4Z5TD 1WWSA 4H9OA 1M1AD 3REHA 1EQZB 3KSYA 3MGRB 3AZJB 2PYOD 4JJND 3KWQC 3C1BC 5B24D 4UPKA 3AV1A 5GXQB 5GT3B 5DNMC 2Y2KA 3X1VB 4CSRA 4X23B 5AV6A 1P3LA 4KGCD 4WJ3C 4Z66D 3V9RB 5F99C 5B33C 5AV8B 3AZEC 3KXBD 4QLCC 3LELC 3W96C 5AY8B 3O62D 1ID3C 3B0CT 1BFMA 5B1LC 3MVDB 2Y2GA 1M18A 4Z2MG 1P3FD 5AV5C 5AVBC 1A7WA 5AV9C 3H0RC 1Z2CB 3AZKC 1P3AB 1ZLAA 3W97D 3P5JB 2NQBD 1KX3D 3AZFA 5CPIA 4NE3A 5B40D 4YS3C 2PYOA 4DRAA 4ZUXD 5AVCD 5BS7C 3MGPD 5B24A 1P3PC 5GSUD 3RELD 1EQZC 1JFIA 2ZM5A 3W99B 3AFAB 2F8NH 2AROA 4KGCA 4WU8B 3AV2B 4UUZA 5CPJB 2JCHA 5B0ZA 4Z5TB 4H9PB 5JRGA 5B1MC 4J8UC 5CPKC 3AZHB 3AZLB 3O62A 5FUGB 3C1BD 2BYKA 4X23C 1BH9B 3TU4A 3LJAB 4E45A 3AZND 1F66C 2HIOB 3F6TA 1P3IB 5BNVB 3AZGC 2FJ7C 5F99D 5B33D 3AZED 3NQUA 4QLCD 4XUJA 2Y2JA 1KX4C 3C1CC 1KX3A 3AZID 3LZ0C 1ID3D 4YM6B 4LD9A 5B1LD 4G91B 4ZUXA 5AVCA 3KUYD 1HQ3B 5C3IC 3MGQB 2VQRA 5B0YD 5B2JA 1M19C 5AVBD 3AZKD 2NZDC 3AYWA 3WA9D 4J8WC 5E5AC 3W97B 3VH6T 5DNNA 2Y2IA 3AN2C 3X1TD 3W99C 3NQJB 4YS3D 4H9NA 3UT9C 3B0CW 1EQZD 2YFVB 5GSUB 3AZJD 3AZLC 3WAAC 5JA4B 1TAFA 5BNXA 1P3KB 3UTAA 4WU9A 3LJAC 3REIA 4NFTA 5B1MD 5KDMA 2YFWB 4J8UD 5CPKD 3X1VD 3AL0C 3AZIA 4X23D 3VH5A 3KWQB 3WKJA 3C1BB 5AV8D 3KUYA 5G49B 5AY8D 5B0YA 4J8XA 5DNMB 5CP6A 3B6GC 3AZGD 1N1JA 4YM6C 3MGSB 3MVDD 4G91C 1KX4D 5F99B 1HQ3C 3AZEB 4J8VA 3LZ0D 3WA9A 3LELB 3REJA 3W96B 3AZMC 3X1TA 1P3AD 1P3BB 1ID3B 2IO5B 4WNNB 5BT1C 1M19D 1P34B 4NE6A 2Y2NA 3MGRA 3AZJA 5AV5B 5AVBB 5AV9B 4J8WD 1P3GB 5GT3A 5GXQA 2HUEC 3W99D 3X1VA 3EPHA 1P3MC 4YS3B 4WU8D 3LZ1C 3UT9D 3W98A 2XD1A 3V9RA 3MNNA 3A6NA 1P3PB 3IP4C 3AZLD 3AZHD 3WAAD 5AY8A 3LJAD 3KFUG 4H9QB 3MVDA 2HIOD 3WTPC 5B1MB 5GT0A 4J8UB 5CPKB 1P3ID 5B31C 3REKB 3VH6W 4LD9C 2XD5A 1P3AA 3MGSC 1HTAA 4H9SC 1F66B 4HGAB 3X1UB 4YM6D 1P3OB 5B2IC 1P3BC 3AZGB 2FJ7B 2IO5C 1HQ3D 3MGQD 1KX4B 3C1CB 4CAYB 2G5IC 1P34C 1KX5B 3LZ0B 3AZMD 3AFAA 4KUDA 3UTBC 4WU8A 1TZYA 3AV2A 1F1EA 5CPJA 1P3GC 4Z5TA 5BT1D 5C3IB 4KHAA 1H3OA 3AZHA 1M19B 1M1AA 1BH9A 4JJNA 3X1SC 2NZDB 4G92B 4XZQC 3WTPE 5E5AB 4J8WB 2HIOA 1AOIC 3AN2B 1P3MD 1P3IA 1P3KD 3LZ1D 1Q9CA 5BO0A 3UT9B 5B32C 1U35C 2FFFB 1T3UA 4Z66A 3KXBA 3WAAB 3KWQD 3FDDA 3REKC 2Y2HA 3WTPD 3MGQA 4HGAC 5DNMD 3X1UC 4R8PC 1P3OC 3MGSD 1P3FA 1BH8A 3W97A 3LELD 3W96D 2NQBA 1KX5C 3B6GB 3NQJA 1P3BD 4H9RB 5B40A 2DQNC 3MGPA 1P34D 3AZFB 5CPIB 2CV5C 5GSUA 3RELA 2RIQA 5AV5D 5JA4A 3AZMB 5AV9D 1S32C 1P3KA 3B6FC 1P3GD 3EPJA 4G92C 2YFWA 3REHC 1B67A 2AROB 3KWQA 3X1SD 3C1BA 3AV1C 1P3PD 1AOID 5GT0C 2HUEB 1KU5A 1R4VA 3AZNA 5DNMA 2ZY4A 1P3LC 5AV6C 1P3MB 1PZRA 3LZ1B 1U35D 2RVQC 5F99A 5B33A 3AZEA 4QLCA 3W96A 3REKD 1ID3A 2JE5A 4WNNA 2F8NK 5B1LA 4XUJB 1M18C 1F66D 3WTPB 3X1UD 1P3OD 5B31B 4KUDC 2FJ7D 4LD9B 5AV5A 5AVBA 5AV9A 3AZKA 1ZLAC 3B0BA 3C1CD 5CPIC 3AZFC 1KX5D 2PYOC 5B2IB 4YS3A 5CHLB 5BS7A 1B6WA 5B24C 1ULYA 2CV5D 1P3PA 5DNNB 1EQZA 4WV4B 3B6FD 1S32D 2AROC 2ZY2A 4DQYB 3UTBB 2F8NB 4KGCC 2NZDD 4WZSB 4H9QA 5B0ZC 5E5AD 5JRGC 4Z66C 3REHD 3AN2D 5B1MA 4J8UA 5CPKA 3O62C 3TU4C 4X23A 4EO5C 3X1SB 3REIB 5KDMB 4XZQB 5AV8A 1F66A 2BG1A 1AOIB 2ZY5A 4AWLB 3AZGA 2FJ7A 2RVQD 4XUJC 5B32B 1KX4A 3C1CA 1U35B 1KX3C 4J8XB 3LZ0A 2Y2QA 4Z2MH 2BYMB 4ZUXC 3R45B 5AVCC 1M18D 3MGPC 4J8VB 4M6BA 5B2JC 3REJB 3B6GD 4R8PB 1M19A 1ZLAD 2Y2OA 3AYWC 2NZDA 3A1IA 3AZFD 5CPID 4J8WA 5E5AA 2DF4C 5DNNC 3AN2A 3W99A 3VH6A 3A1KA 3UT9A 2J8PA 4H9PA 3AZNC 3B0DC 2CV5B 2AROD 3AZLA 3WAAA 5FUGA 3B6FB 3UTAC 1S32B 4WU9C 5B0ZD 3W98B 5JRGD 3MNNB 3LJAA 3EPKA 4H9OB 3VH5T 3A6NB 3REIC 2JSSA 3REHB 3TU4D 3AZIC 5BNVA 3WKJC 4AWLC 3AV1B 3KUYC 5GT0B 5B0YC 4J8XC 5CP6C 3B6GA 4H9RA 4CSRB 5AV6B 1P3LB 4YM6A 4XUJD 1HQ3A 4J8VC 3WA9C 3REJC 5B31D 4ZBJC 4LD9D 3X1TC 2W8SA 3AZMA 5B31G 1M18B 5B2JD 2ZY3A 3MGRC 3AZJC 5B2ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD B;  3AYW D;  1TZY B;  1ZLA B;  5GXQ C;  4KHA B;  5GT3 C;  1H3O B;  5DNN D;  2YFV A;  1M1A B;  3X1V C;  3UTB D;  2F8N D;  2PYO B;  1P3M A;  4JJN B;  3LZ1 A;  3W98 C;  3MNN C;  5AV8 C;  5B24 B;  3A6N C;  2F8N G;  5AY8 C;  1JFI B;  3UTA D;  4WU9 D;  5BO0 B;  4KGC B;  3REI D;  4UUZ B;  4XZQ D;  5B0Z B;  3MVD C;  5JRG B;  4Z66 B;  3WTP A;  5G49 A;  3KXB B;  5B31 A;  3O62 B;  3WKJ D;  3TU4 B;  2BYK B;  4EO5 B;  1P3A C;  3MGS A;  5B32 D;  4J8X D;  4H9S A;  5CP6 D;  3LEL A;  5B32 G;  1P3F B;  5B2I A;  1BH8 B;  1P3B A;  3NQU B;  4E44 A;  4J8V D;  3REJ D;  2NQB B;  4R8P D;  1KX3 B;  1P34 A;  3VH5 W;  3AFA C;  2CWE A;  5B40 B;  3UTB A;  2F8N A;  3AV2 C;  1TZY C;  5AVC B;  4ZUX B;  4WU8 C;  5CPJ C;  4Z5T C;  3MGP B;  1P3G A;  4NE5 A;  5B2J B;  3MGR D;  3REL B;  3AZH C;  1M1A C;  4JJN C;  5GXQ D;  3X1S A;  5GT3 D;  1WWI A;  3AYW B;  4XZQ A;  2HIO C;  1AOI A;  1P3I C;  3W98 D;  3MNN D;  4H9N B;  3A6N D;  5B32 A;  2L5A A;  1U35 A;  3AZN B;  3KXB C;  3B0D B;  1TAF B;  5BNX B;  3REK A;  3UTA B;  4WU9 B;  3AV1 D;  2BYM A;  3R45 A;  5B33 B;  3MGQ C;  5GT0 D;  4QLC B;  3X1U A;  4R8P A;  3AZI B;  1P3L D;  5AV6 D;  1P3F C;  1P3O A;  3WKJ B;  5B1L B;  3KUY B;  3W97 C;  4DRB A;  2NQB C;  5B0Y B;  4CAY A;  5CP6 B;  1KX5 A;  5B40 C;  1N1J B;  3AZK B;  3WA9 B;  5GSU C;  3AFA D;  3REL C;  2CV5 A;  4ZBJ B;  4KUD D;  2LY8 A;  3X1T B;  1P3K C;  3B6F A;  3AV2 D;  1TZY D;  1S32 A;  5CPJ D;  4Z5T D;  1WWS A;  4H9O A;  1M1A D;  3REH A;  1EQZ B;  3KSY A;  3MGR B;  3AZJ B;  2PYO D;  4JJN D;  3KWQ C;  3C1B C;  5B24 D;  3AV1 A;  5GXQ B;  5GT3 B;  5DNM C;  3X1V B;  4CSR A;  4X23 B;  5AV6 A;  1P3L A;  4KGC D;  4Z66 D;  3V9R B;  5F99 C;  5B33 C;  5AV8 B;  3AZE C;  3KXB D;  4QLC C;  3LEL C;  3W96 C;  5AY8 B;  3O62 D;  1ID3 C;  3B0C T;  1BFM A;  5B1L C;  3MVD B;  1M18 A;  4Z2M G;  1P3F D;  5AV5 C;  5AVB C;  1A7W A;  5AV9 C;  3AZK C;  1P3A B;  1ZLA A;  3W97 D;  2NQB D;  1KX3 D;  3AZF A;  5CPI A;  4NE3 A;  5B40 D;  4YS3 C;  2PYO A;  4DRA A;  5AVC D;  4ZUX D;  5BS7 C;  3MGP D;  5B24 A;  1P3P C;  5GSU D;  3REL D;  1EQZ C;  1JFI A;  3W99 B;  3AFA B;  2F8N H;  2ARO A;  4KGC A;  4WU8 B;  3AV2 B;  4UUZ A;  5CPJ B;  5B0Z A;  4Z5T B;  5JRG A;  4H9P B;  5B1M C;  4J8U C;  5CPK C;  3AZH B;  3AZL B;  3O62 A;  5FUG B;  3C1B D;  2BYK A;  4X23 C;  1BH9 B;  3TU4 A;  3LJA B;  4E45 A;  3AZN D;  1F66 C;  2HIO B;  1P3I B;  5BNV B;  3AZG C;  2FJ7 C;  5F99 D;  5B33 D;  3AZE D;  3NQU A;  4QLC D;  4XUJ A;  1KX4 C;  3C1C C;  1KX3 A;  3AZI D;  3LZ0 C;  1ID3 D;  4YM6 B;  4LD9 A;  5B1L D;  4G91 B;  4ZUX A;  5AVC A;  3KUY D;  1HQ3 B;  5C3I C;  3MGQ B;  5B0Y D;  5B2J A;  1M19 C;  5AVB D;  3AZK D;  2NZD C;  3AYW A;  3WA9 D;  4J8W C;  5E5A C;  3W97 B;  3VH6 T;  5DNN A;  3AN2 C;  3X1T D;  3W99 C;  3NQJ B;  4YS3 D;  4H9N A;  3UT9 C;  3B0C W;  1EQZ D;  2YFV B;  5GSU B;  3AZJ D;  3AZL C;  3WAA C;  5JA4 B;  1TAF A;  5BNX A;  1P3K B;  3UTA A;  4WU9 A;  3LJA C;  3REI A;  4NFT A;  5B1M D;  5KDM A;  2YFW B;  4J8U D;  5CPK D;  3X1V D;  3AZI A;  4X23 D;  3VH5 A;  3KWQ B;  3WKJ A;  3C1B B;  5AV8 D;  3KUY A;  5G49 B;  5AY8 D;  5B0Y A;  4J8X A;  5DNM B;  5CP6 A;  3B6G C;  3AZG D;  1N1J A;  4YM6 C;  3MGS B;  3MVD D;  4G91 C;  1KX4 D;  5F99 B;  1HQ3 C;  3AZE B;  4J8V A;  3LZ0 D;  3WA9 A;  3LEL B;  3REJ A;  3W96 B;  3AZM C;  3X1T A;  1P3A D;  1P3B B;  1ID3 B;  2IO5 B;  4WNN B;  5BT1 C;  1M19 D;  1P34 B;  4NE6 A;  3MGR A;  3AZJ A;  5AV5 B;  5AVB B;  5AV9 B;  4J8W D;  1P3G B;  5GT3 A;  5GXQ A;  2HUE C;  3W99 D;  3X1V A;  1P3M C;  4YS3 B;  4WU8 D;  3LZ1 C;  3UT9 D;  3W98 A;  3MNN A;  3V9R A;  3A6N A;  1P3P B;  3AZL D;  3AZH D;  3WAA D;  5AY8 A;  3LJA D;  4H9Q B;  3MVD A;  2HIO D;  3WTP C;  5B1M B;  5GT0 A;  4J8U B;  5CPK B;  1P3I D;  5B31 C;  3REK B;  3VH6 W;  4LD9 C;  1P3A A;  3MGS C;  1HTA A;  4H9S C;  1F66 B;  4HGA B;  3X1U B;  4YM6 D;  1P3O B;  5B2I C;  1P3B C;  3AZG B;  2FJ7 B;  2IO5 C;  1HQ3 D;  3MGQ D;  1KX4 B;  3C1C B;  4CAY B;  1P34 C;  1KX5 B;  3LZ0 B;  3AZM D;  3AFA A;  4KUD A;  3UTB C;  4WU8 A;  1TZY A;  3AV2 A;  1F1E A;  5CPJ A;  1P3G C;  4Z5T A;  5BT1 D;  5C3I B;  4KHA A;  1H3O A;  3AZH A;  1M19 B;  1M1A A;  1BH9 A;  4JJN A;  3X1S C;  2NZD B;  4G92 B;  4XZQ C;  3WTP E;  5E5A B;  4J8W B;  2HIO A;  1AOI C;  3AN2 B;  1P3M D;  1P3I A;  1P3K D;  3LZ1 D;  1Q9C A;  5BO0 A;  3UT9 B;  5B32 C;  1U35 C;  4Z66 A;  3KXB A;  3WAA B;  3KWQ D;  3REK C;  3WTP D;  3MGQ A;  4HGA C;  5DNM D;  3X1U C;  4R8P C;  1P3O C;  3MGS D;  1P3F A;  1BH8 A;  3W97 A;  3LEL D;  3W96 D;  2NQB A;  1KX5 C;  3B6G B;  3NQJ A;  1P3B D;  4H9R B;  5B40 A;  3MGP A;  1P34 D;  3AZF B;  5CPI B;  2CV5 C;  5GSU A;  3REL A;  5AV5 D;  5JA4 A;  3AZM B;  5AV9 D;  1S32 C;  1P3K A;  3B6F C;  1P3G D;  4G92 C;  2YFW A;  3REH C;  1B67 A;  2ARO B;  3KWQ A;  3X1S D;  3C1B A;  3AV1 C;  1P3P D;  1AOI D;  5GT0 C;  2HUE B;  1KU5 A;  1R4V A;  3AZN A;  5DNM A;  1P3L C;  5AV6 C;  1P3M B;  3LZ1 B;  1U35 D;  2RVQ C;  5F99 A;  5B33 A;  3AZE A;  4QLC A;  3W96 A;  3REK D;  1ID3 A;  4WNN A;  2F8N K;  5B1L A;  4XUJ B;  1M18 C;  1F66 D;  3WTP B;  3X1U D;  1P3O D;  5B31 B;  4KUD C;  2FJ7 D;  4LD9 B;  5AV5 A;  5AVB A;  5AV9 A;  3AZK A;  1ZLA C;  3B0B A;  3C1C D;  5CPI C;  3AZF C;  1KX5 D;  2PYO C;  5B2I B;  4YS3 A;  5CHL B;  5BS7 A;  1B6W A;  5B24 C;  1ULY A;  2CV5 D;  1P3P A;  5DNN B;  1EQZ A;  4WV4 B;  3B6F D;  1S32 D;  2ARO C;  3UTB B;  2F8N B;  4KGC C;  2NZD D;  4WZS B;  4H9Q A;  5B0Z C;  5E5A D;  5JRG C;  4Z66 C;  3REH D;  3AN2 D;  5B1M A;  4J8U A;  5CPK A;  3O62 C;  3TU4 C;  4X23 A;  4EO5 C;  3X1S B;  3REI B;  5KDM B;  4XZQ B;  5AV8 A;  1F66 A;  1AOI B;  4AWL B;  3AZG A;  2FJ7 A;  2RVQ D;  4XUJ C;  5B32 B;  1KX4 A;  3C1C A;  1U35 B;  1KX3 C;  4J8X B;  3LZ0 A;  4Z2M H;  2BYM B;  4ZUX C;  3R45 B;  5AVC C;  1M18 D;  3MGP C;  4J8V B;  4M6B A;  5B2J C;  3REJ B;  3B6G D;  4R8P B;  1M19 A;  1ZLA D;  3AYW C;  2NZD A;  3AZF D;  5CPI D;  4J8W A;  5E5A A;  5DNN C;  3AN2 A;  3W99 A;  3VH6 A;  3UT9 A;  4H9P A;  3AZN C;  3B0D C;  2CV5 B;  2ARO D;  3AZL A;  3WAA A;  5FUG A;  3B6F B;  3UTA C;  1S32 B;  4WU9 C;  5B0Z D;  3W98 B;  5JRG D;  3MNN B;  3LJA A;  3REI C;  4H9O B;  3VH5 T;  3A6N B;  2JSS A;  3REH B;  3TU4 D;  3AZI C;  5BNV A;  3WKJ C;  4AWL C;  3AV1 B;  3KUY C;  5GT0 B;  5B0Y C;  4J8X C;  5CP6 C;  3B6G A;  4H9R A;  4CSR B;  5AV6 B;  1P3L B;  4YM6 A;  4XUJ D;  1HQ3 A;  4J8V C;  3WA9 C;  3REJ C;  5B31 D;  4ZBJ C;  4LD9 D;  3X1T C;  3AZM A;  5B31 G;  1M18 B;  5B2J D;  3MGR C;  3AZJ C;  5B2I D; 
#chains in the Genus database with same CATH topology
 4KUD B;  3AYW D;  1TZY B;  1ZLA B;  5GXQ C;  4KHA B;  5GT3 C;  1H3O B;  5DNN D;  2YFV A;  1M1A B;  3X1V C;  3UTB D;  2F8N D;  2PYO B;  1P3M A;  4JJN B;  3LZ1 A;  3W98 C;  3MNN C;  5AV8 C;  5B24 B;  3A6N C;  2F8N G;  5AY8 C;  1JFI B;  3UTA D;  4WU9 D;  5BO0 B;  4KGC B;  3REI D;  4UUZ B;  4XZQ D;  5B0Z B;  3MVD C;  3EPL A;  5JRG B;  4Z66 B;  3WTP A;  5G49 A;  3KXB B;  3EG5 B;  5B31 A;  3O62 B;  3WKJ D;  3TU4 B;  2BYK B;  4EO5 B;  1P3A C;  3MGS A;  5B32 D;  1W2E A;  4J8X D;  4H9S A;  5CP6 D;  3LEL A;  5B32 G;  1P3F B;  5B2I A;  1BH8 B;  1P3B A;  3NQU B;  4E44 A;  4J8V D;  3REJ D;  2NQB B;  4R8P D;  1KX3 B;  1P34 A;  3VH5 W;  3AFA C;  2CWE A;  5B40 B;  3UTB A;  2F8N A;  2F2A C;  3AV2 C;  1TZY C;  4ZUX B;  5AVC B;  4WU8 C;  5CPJ C;  4Z5T C;  3MGP B;  1P3G A;  3H0L C;  4NE5 A;  5B2J B;  3MGR D;  3REL B;  3AZH C;  1M1A C;  3H0M C;  4JJN C;  5GXQ D;  3X1S A;  5GT3 D;  1WWI A;  3AYW B;  4XZQ A;  2HIO C;  1AOI A;  1P3I C;  3W98 D;  3MNN D;  4H9N B;  3A6N D;  5B32 A;  2L5A A;  1U35 A;  3AZN B;  3KXB C;  3B0D B;  1TAF B;  5BNX B;  3REK A;  2Y2P A;  3UTA B;  4WU9 B;  3AV1 D;  2BYM A;  3R45 A;  5B33 B;  2G5H C;  3MGQ C;  5GT0 D;  4QLC B;  3X1U A;  4R8P A;  3AZI B;  1P3L D;  5AV6 D;  1P3F C;  1P3O A;  3WKJ B;  5B1L B;  3KUY B;  3W97 C;  4DRB A;  2NQB C;  2UWX A;  5B0Y B;  4CAY A;  2Y2M A;  5CP6 B;  1KX5 A;  5B40 C;  1N1J B;  2Y2L A;  3AZK B;  3WA9 B;  5GSU C;  3AFA D;  3REL C;  2CV5 A;  4ZBJ B;  4KUD D;  2LY8 A;  3X1T B;  1P3K C;  3B6F A;  3AV2 D;  1TZY D;  1S32 A;  5CPJ D;  4Z5T D;  1WWS A;  4H9O A;  1M1A D;  3REH A;  1EQZ B;  3KSY A;  3MGR B;  3AZJ B;  2PYO D;  4JJN D;  3KWQ C;  3C1B C;  5B24 D;  4UPK A;  3AV1 A;  5GXQ B;  5GT3 B;  5DNM C;  2Y2K A;  3X1V B;  4CSR A;  4X23 B;  5AV6 A;  1P3L A;  4KGC D;  4WJ3 C;  4Z66 D;  3V9R B;  5F99 C;  5B33 C;  5AV8 B;  3AZE C;  3KXB D;  4QLC C;  3LEL C;  3W96 C;  5AY8 B;  3O62 D;  1ID3 C;  3B0C T;  1BFM A;  5B1L C;  3MVD B;  2Y2G A;  1M18 A;  4Z2M G;  1P3F D;  5AV5 C;  5AVB C;  1A7W A;  5AV9 C;  3H0R C;  1Z2C B;  3AZK C;  1P3A B;  1ZLA A;  3W97 D;  3P5J B;  2NQB D;  1KX3 D;  3AZF A;  5CPI A;  4NE3 A;  5B40 D;  4YS3 C;  2PYO A;  4DRA A;  4ZUX D;  5AVC D;  5BS7 C;  3MGP D;  5B24 A;  1P3P C;  5GSU D;  3REL D;  1EQZ C;  1JFI A;  2ZM5 A;  3W99 B;  3AFA B;  2F8N H;  2ARO A;  4KGC A;  4WU8 B;  3AV2 B;  4UUZ A;  5CPJ B;  2JCH A;  5B0Z A;  4Z5T B;  4H9P B;  5JRG A;  5B1M C;  4J8U C;  5CPK C;  3AZH B;  3AZL B;  3O62 A;  5FUG B;  3C1B D;  2BYK A;  4X23 C;  1BH9 B;  3TU4 A;  3LJA B;  4E45 A;  3AZN D;  1F66 C;  2HIO B;  3F6T A;  1P3I B;  5BNV B;  3AZG C;  2FJ7 C;  5F99 D;  5B33 D;  3AZE D;  3NQU A;  4QLC D;  4XUJ A;  2Y2J A;  1KX4 C;  3C1C C;  1KX3 A;  3AZI D;  3LZ0 C;  1ID3 D;  4YM6 B;  4LD9 A;  5B1L D;  4G91 B;  4ZUX A;  5AVC A;  3KUY D;  1HQ3 B;  5C3I C;  3MGQ B;  2VQR A;  5B0Y D;  5B2J A;  1M19 C;  5AVB D;  3AZK D;  2NZD C;  3AYW A;  3WA9 D;  4J8W C;  5E5A C;  3W97 B;  3VH6 T;  5DNN A;  2Y2I A;  3AN2 C;  3X1T D;  3W99 C;  3NQJ B;  4YS3 D;  4H9N A;  3UT9 C;  3B0C W;  1EQZ D;  2YFV B;  5GSU B;  3AZJ D;  3AZL C;  3WAA C;  5JA4 B;  1TAF A;  5BNX A;  1P3K B;  3UTA A;  4WU9 A;  3LJA C;  3REI A;  4NFT A;  5B1M D;  5KDM A;  2YFW B;  4J8U D;  5CPK D;  3X1V D;  3AL0 C;  3AZI A;  4X23 D;  3VH5 A;  3KWQ B;  3WKJ A;  3C1B B;  5AV8 D;  3KUY A;  5G49 B;  5AY8 D;  5B0Y A;  4J8X A;  5DNM B;  5CP6 A;  3B6G C;  3AZG D;  1N1J A;  4YM6 C;  3MGS B;  3MVD D;  4G91 C;  1KX4 D;  5F99 B;  1HQ3 C;  3AZE B;  4J8V A;  3LZ0 D;  3WA9 A;  3LEL B;  3REJ A;  3W96 B;  3AZM C;  3X1T A;  1P3A D;  1P3B B;  1ID3 B;  2IO5 B;  4WNN B;  5BT1 C;  1M19 D;  1P34 B;  4NE6 A;  2Y2N A;  3MGR A;  3AZJ A;  5AV5 B;  5AVB B;  5AV9 B;  4J8W D;  1P3G B;  5GT3 A;  5GXQ A;  2HUE C;  3W99 D;  3X1V A;  3EPH A;  1P3M C;  4YS3 B;  4WU8 D;  3LZ1 C;  3UT9 D;  3W98 A;  2XD1 A;  3V9R A;  3MNN A;  3A6N A;  1P3P B;  3IP4 C;  3AZL D;  3AZH D;  3WAA D;  5AY8 A;  3LJA D;  3KFU G;  4H9Q B;  3MVD A;  2HIO D;  3WTP C;  5B1M B;  5GT0 A;  4J8U B;  5CPK B;  1P3I D;  5B31 C;  3REK B;  3VH6 W;  4LD9 C;  2XD5 A;  1P3A A;  3MGS C;  1HTA A;  4H9S C;  1F66 B;  4HGA B;  3X1U B;  4YM6 D;  1P3O B;  5B2I C;  1P3B C;  3AZG B;  2FJ7 B;  2IO5 C;  1HQ3 D;  3MGQ D;  1KX4 B;  3C1C B;  4CAY B;  2G5I C;  1P34 C;  1KX5 B;  3LZ0 B;  3AZM D;  3AFA A;  4KUD A;  3UTB C;  4WU8 A;  1TZY A;  3AV2 A;  1F1E A;  5CPJ A;  1P3G C;  4Z5T A;  5BT1 D;  5C3I B;  4KHA A;  1H3O A;  3AZH A;  1M19 B;  1M1A A;  1BH9 A;  4JJN A;  3X1S C;  2NZD B;  4G92 B;  4XZQ C;  3WTP E;  5E5A B;  4J8W B;  2HIO A;  1AOI C;  3AN2 B;  1P3M D;  1P3I A;  1P3K D;  3LZ1 D;  1Q9C A;  5BO0 A;  3UT9 B;  5B32 C;  1U35 C;  2FFF B;  1T3U A;  4Z66 A;  3KXB A;  3WAA B;  3KWQ D;  3FDD A;  3REK C;  2Y2H A;  3WTP D;  3MGQ A;  4HGA C;  5DNM D;  3X1U C;  4R8P C;  1P3O C;  3MGS D;  1P3F A;  1BH8 A;  3W97 A;  3LEL D;  3W96 D;  2NQB A;  1KX5 C;  3B6G B;  3NQJ A;  1P3B D;  4H9R B;  5B40 A;  2DQN C;  3MGP A;  1P34 D;  3AZF B;  5CPI B;  2CV5 C;  5GSU A;  3REL A;  2RIQ A;  5AV5 D;  5JA4 A;  3AZM B;  5AV9 D;  1S32 C;  1P3K A;  3B6F C;  1P3G D;  3EPJ A;  4G92 C;  2YFW A;  3REH C;  1B67 A;  2ARO B;  3KWQ A;  3X1S D;  3C1B A;  3AV1 C;  1P3P D;  1AOI D;  5GT0 C;  2HUE B;  1KU5 A;  1R4V A;  3AZN A;  5DNM A;  2ZY4 A;  1P3L C;  5AV6 C;  1P3M B;  1PZR A;  3LZ1 B;  1U35 D;  2RVQ C;  5F99 A;  5B33 A;  3AZE A;  4QLC A;  3W96 A;  3REK D;  1ID3 A;  2JE5 A;  4WNN A;  2F8N K;  5B1L A;  4XUJ B;  1M18 C;  1F66 D;  3WTP B;  3X1U D;  1P3O D;  5B31 B;  4KUD C;  2FJ7 D;  4LD9 B;  5AV5 A;  5AVB A;  5AV9 A;  3AZK A;  1ZLA C;  3B0B A;  3C1C D;  5CPI C;  3AZF C;  1KX5 D;  2PYO C;  5B2I B;  4YS3 A;  5CHL B;  5BS7 A;  1B6W A;  5B24 C;  1ULY A;  2CV5 D;  1P3P A;  5DNN B;  1EQZ A;  4WV4 B;  3B6F D;  1S32 D;  2ARO C;  2ZY2 A;  4DQY B;  3UTB B;  2F8N B;  4KGC C;  2NZD D;  4WZS B;  4H9Q A;  5B0Z C;  5E5A D;  5JRG C;  4Z66 C;  3REH D;  3AN2 D;  5B1M A;  4J8U A;  5CPK A;  3O62 C;  3TU4 C;  4X23 A;  4EO5 C;  3X1S B;  3REI B;  5KDM B;  4XZQ B;  5AV8 A;  1F66 A;  2BG1 A;  1AOI B;  2ZY5 A;  4AWL B;  3AZG A;  2FJ7 A;  2RVQ D;  4XUJ C;  5B32 B;  1KX4 A;  3C1C A;  1U35 B;  1KX3 C;  4J8X B;  3LZ0 A;  2Y2Q A;  4Z2M H;  2BYM B;  4ZUX C;  3R45 B;  5AVC C;  1M18 D;  3MGP C;  4J8V B;  4M6B A;  5B2J C;  3REJ B;  3B6G D;  4R8P B;  1M19 A;  1ZLA D;  2Y2O A;  3AYW C;  2NZD A;  3A1I A;  3AZF D;  5CPI D;  4J8W A;  5E5A A;  2DF4 C;  5DNN C;  3AN2 A;  3W99 A;  3VH6 A;  3A1K A;  3UT9 A;  2J8P A;  4H9P A;  3AZN C;  3B0D C;  2CV5 B;  2ARO D;  3AZL A;  3WAA A;  5FUG A;  3B6F B;  3UTA C;  1S32 B;  4WU9 C;  5B0Z D;  3W98 B;  5JRG D;  3MNN B;  3LJA A;  3EPK A;  4H9O B;  3VH5 T;  3A6N B;  3REI C;  2JSS A;  3REH B;  3TU4 D;  3AZI C;  5BNV A;  3WKJ C;  4AWL C;  3AV1 B;  3KUY C;  5GT0 B;  5B0Y C;  4J8X C;  5CP6 C;  3B6G A;  4H9R A;  4CSR B;  5AV6 B;  1P3L B;  4YM6 A;  4XUJ D;  1HQ3 A;  4J8V C;  3WA9 C;  3REJ C;  5B31 D;  4ZBJ C;  4LD9 D;  3X1T C;  2W8S A;  3AZM A;  5B31 G;  1M18 B;  5B2J D;  2ZY3 A;  3MGR C;  3AZJ C;  5B2I D; 
#chains in the Genus database with same CATH homology
 4KUD B;  3AYW D;  1TZY B;  1ZLA B;  5GXQ C;  4KHA B;  5GT3 C;  1H3O B;  5DNN D;  2YFV A;  1M1A B;  3X1V C;  3UTB D;  2F8N D;  2PYO B;  1P3M A;  4JJN B;  3LZ1 A;  3W98 C;  3MNN C;  5AV8 C;  5B24 B;  3A6N C;  2F8N G;  5AY8 C;  1JFI B;  3UTA D;  4WU9 D;  5BO0 B;  4KGC B;  3REI D;  4UUZ B;  4XZQ D;  5B0Z B;  3MVD C;  3EPL A;  5JRG B;  4Z66 B;  3WTP A;  5G49 A;  3KXB B;  3EG5 B;  5B31 A;  3O62 B;  3WKJ D;  3TU4 B;  2BYK B;  4EO5 B;  1P3A C;  3MGS A;  5B32 D;  1W2E A;  4J8X D;  4H9S A;  5CP6 D;  3LEL A;  5B32 G;  1P3F B;  5B2I A;  1BH8 B;  1P3B A;  3NQU B;  4E44 A;  4J8V D;  3REJ D;  2NQB B;  4R8P D;  1KX3 B;  1P34 A;  3VH5 W;  3AFA C;  2CWE A;  5B40 B;  3UTB A;  2F8N A;  2F2A C;  3AV2 C;  1TZY C;  4ZUX B;  5AVC B;  4WU8 C;  5CPJ C;  4Z5T C;  3MGP B;  1P3G A;  3H0L C;  4NE5 A;  5B2J B;  3MGR D;  3REL B;  3AZH C;  1M1A C;  3H0M C;  4JJN C;  5GXQ D;  3X1S A;  5GT3 D;  1WWI A;  3AYW B;  4XZQ A;  2HIO C;  1AOI A;  1P3I C;  3W98 D;  3MNN D;  4H9N B;  3A6N D;  5B32 A;  2L5A A;  1U35 A;  3AZN B;  3KXB C;  3B0D B;  1TAF B;  5BNX B;  3REK A;  2Y2P A;  3UTA B;  4WU9 B;  3AV1 D;  2BYM A;  3R45 A;  5B33 B;  2G5H C;  3MGQ C;  5GT0 D;  4QLC B;  3X1U A;  4R8P A;  3AZI B;  1P3L D;  5AV6 D;  1P3F C;  1P3O A;  3WKJ B;  5B1L B;  3KUY B;  3W97 C;  4DRB A;  2NQB C;  2UWX A;  5B0Y B;  4CAY A;  2Y2M A;  5CP6 B;  1KX5 A;  5B40 C;  1N1J B;  2Y2L A;  3AZK B;  3WA9 B;  5GSU C;  3AFA D;  3REL C;  2CV5 A;  4ZBJ B;  4KUD D;  2LY8 A;  3X1T B;  1P3K C;  3B6F A;  3AV2 D;  1TZY D;  1S32 A;  5CPJ D;  4Z5T D;  1WWS A;  4H9O A;  1M1A D;  3REH A;  1EQZ B;  3KSY A;  3MGR B;  3AZJ B;  2PYO D;  4JJN D;  3KWQ C;  3C1B C;  5B24 D;  4UPK A;  3AV1 A;  5GXQ B;  5GT3 B;  5DNM C;  2Y2K A;  3X1V B;  4CSR A;  4X23 B;  5AV6 A;  1P3L A;  4KGC D;  4WJ3 C;  4Z66 D;  3V9R B;  5F99 C;  5B33 C;  5AV8 B;  3AZE C;  3KXB D;  4QLC C;  3LEL C;  3W96 C;  5AY8 B;  3O62 D;  1ID3 C;  3B0C T;  1BFM A;  5B1L C;  3MVD B;  2Y2G A;  1M18 A;  4Z2M G;  1P3F D;  5AV5 C;  5AVB C;  1A7W A;  5AV9 C;  3H0R C;  1Z2C B;  3AZK C;  1P3A B;  1ZLA A;  3W97 D;  3P5J B;  2NQB D;  1KX3 D;  3AZF A;  5CPI A;  4NE3 A;  5B40 D;  4YS3 C;  2PYO A;  4DRA A;  4ZUX D;  5AVC D;  5BS7 C;  3MGP D;  5B24 A;  1P3P C;  5GSU D;  3REL D;  1EQZ C;  1JFI A;  2ZM5 A;  3W99 B;  3AFA B;  2F8N H;  2ARO A;  4KGC A;  4WU8 B;  3AV2 B;  4UUZ A;  5CPJ B;  2JCH A;  5B0Z A;  4Z5T B;  4H9P B;  5JRG A;  5B1M C;  4J8U C;  5CPK C;  3AZH B;  3AZL B;  3O62 A;  5FUG B;  3C1B D;  2BYK A;  4X23 C;  1BH9 B;  3TU4 A;  3LJA B;  4E45 A;  3AZN D;  1F66 C;  2HIO B;  3F6T A;  1P3I B;  5BNV B;  3AZG C;  2FJ7 C;  5F99 D;  5B33 D;  3AZE D;  3NQU A;  4QLC D;  4XUJ A;  2Y2J A;  1KX4 C;  3C1C C;  1KX3 A;  3AZI D;  3LZ0 C;  1ID3 D;  4YM6 B;  4LD9 A;  5B1L D;  4G91 B;  4ZUX A;  5AVC A;  3KUY D;  1HQ3 B;  5C3I C;  3MGQ B;  2VQR A;  5B0Y D;  5B2J A;  1M19 C;  5AVB D;  3AZK D;  2NZD C;  3AYW A;  3WA9 D;  4J8W C;  5E5A C;  3W97 B;  3VH6 T;  5DNN A;  2Y2I A;  3AN2 C;  3X1T D;  3W99 C;  3NQJ B;  4YS3 D;  4H9N A;  3UT9 C;  3B0C W;  1EQZ D;  2YFV B;  5GSU B;  3AZJ D;  3AZL C;  3WAA C;  5JA4 B;  1TAF A;  5BNX A;  1P3K B;  3UTA A;  4WU9 A;  3LJA C;  3REI A;  4NFT A;  5B1M D;  5KDM A;  2YFW B;  4J8U D;  5CPK D;  3X1V D;  3AL0 C;  3AZI A;  4X23 D;  3VH5 A;  3KWQ B;  3WKJ A;  3C1B B;  5AV8 D;  3KUY A;  5G49 B;  5AY8 D;  5B0Y A;  4J8X A;  5DNM B;  5CP6 A;  3B6G C;  3AZG D;  1N1J A;  4YM6 C;  3MGS B;  3MVD D;  4G91 C;  1KX4 D;  5F99 B;  1HQ3 C;  3AZE B;  4J8V A;  3LZ0 D;  3WA9 A;  3LEL B;  3REJ A;  3W96 B;  3AZM C;  3X1T A;  1P3A D;  1P3B B;  1ID3 B;  2IO5 B;  4WNN B;  5BT1 C;  1M19 D;  1P34 B;  4NE6 A;  2Y2N A;  3MGR A;  3AZJ A;  5AV5 B;  5AVB B;  5AV9 B;  4J8W D;  1P3G B;  5GT3 A;  5GXQ A;  2HUE C;  3W99 D;  3X1V A;  3EPH A;  1P3M C;  4YS3 B;  4WU8 D;  3LZ1 C;  3UT9 D;  3W98 A;  2XD1 A;  3V9R A;  3MNN A;  3A6N A;  1P3P B;  3IP4 C;  3AZL D;  3AZH D;  3WAA D;  5AY8 A;  3LJA D;  3KFU G;  4H9Q B;  3MVD A;  2HIO D;  3WTP C;  5B1M B;  5GT0 A;  4J8U B;  5CPK B;  1P3I D;  5B31 C;  3REK B;  3VH6 W;  4LD9 C;  2XD5 A;  1P3A A;  3MGS C;  1HTA A;  4H9S C;  1F66 B;  4HGA B;  3X1U B;  4YM6 D;  1P3O B;  5B2I C;  1P3B C;  3AZG B;  2FJ7 B;  2IO5 C;  1HQ3 D;  3MGQ D;  1KX4 B;  3C1C B;  4CAY B;  2G5I C;  1P34 C;  1KX5 B;  3LZ0 B;  3AZM D;  3AFA A;  4KUD A;  3UTB C;  4WU8 A;  1TZY A;  3AV2 A;  1F1E A;  5CPJ A;  1P3G C;  4Z5T A;  5BT1 D;  5C3I B;  4KHA A;  1H3O A;  3AZH A;  1M19 B;  1M1A A;  1BH9 A;  4JJN A;  3X1S C;  2NZD B;  4G92 B;  4XZQ C;  3WTP E;  5E5A B;  4J8W B;  2HIO A;  1AOI C;  3AN2 B;  1P3M D;  1P3I A;  1P3K D;  3LZ1 D;  1Q9C A;  5BO0 A;  3UT9 B;  5B32 C;  1U35 C;  2FFF B;  1T3U A;  4Z66 A;  3KXB A;  3WAA B;  3KWQ D;  3FDD A;  3REK C;  2Y2H A;  3WTP D;  3MGQ A;  4HGA C;  5DNM D;  3X1U C;  4R8P C;  1P3O C;  3MGS D;  1P3F A;  1BH8 A;  3W97 A;  3LEL D;  3W96 D;  2NQB A;  1KX5 C;  3B6G B;  3NQJ A;  1P3B D;  4H9R B;  5B40 A;  2DQN C;  3MGP A;  1P34 D;  3AZF B;  5CPI B;  2CV5 C;  5GSU A;  3REL A;  2RIQ A;  5AV5 D;  5JA4 A;  3AZM B;  5AV9 D;  1S32 C;  1P3K A;  3B6F C;  1P3G D;  3EPJ A;  4G92 C;  2YFW A;  3REH C;  1B67 A;  2ARO B;  3KWQ A;  3X1S D;  3C1B A;  3AV1 C;  1P3P D;  1AOI D;  5GT0 C;  2HUE B;  1KU5 A;  1R4V A;  3AZN A;  5DNM A;  2ZY4 A;  1P3L C;  5AV6 C;  1P3M B;  1PZR A;  3LZ1 B;  1U35 D;  2RVQ C;  5F99 A;  5B33 A;  3AZE A;  4QLC A;  3W96 A;  3REK D;  1ID3 A;  2JE5 A;  4WNN A;  2F8N K;  5B1L A;  4XUJ B;  1M18 C;  1F66 D;  3WTP B;  3X1U D;  1P3O D;  5B31 B;  4KUD C;  2FJ7 D;  4LD9 B;  5AV5 A;  5AVB A;  5AV9 A;  3AZK A;  1ZLA C;  3B0B A;  3C1C D;  5CPI C;  3AZF C;  1KX5 D;  2PYO C;  5B2I B;  4YS3 A;  5CHL B;  5BS7 A;  1B6W A;  5B24 C;  1ULY A;  2CV5 D;  1P3P A;  5DNN B;  1EQZ A;  4WV4 B;  3B6F D;  1S32 D;  2ARO C;  2ZY2 A;  4DQY B;  3UTB B;  2F8N B;  4KGC C;  2NZD D;  4WZS B;  4H9Q A;  5B0Z C;  5E5A D;  5JRG C;  4Z66 C;  3REH D;  3AN2 D;  5B1M A;  4J8U A;  5CPK A;  3O62 C;  3TU4 C;  4X23 A;  4EO5 C;  3X1S B;  3REI B;  5KDM B;  4XZQ B;  5AV8 A;  1F66 A;  2BG1 A;  1AOI B;  2ZY5 A;  4AWL B;  3AZG A;  2FJ7 A;  2RVQ D;  4XUJ C;  5B32 B;  1KX4 A;  3C1C A;  1U35 B;  1KX3 C;  4J8X B;  3LZ0 A;  2Y2Q A;  4Z2M H;  2BYM B;  4ZUX C;  3R45 B;  5AVC C;  1M18 D;  3MGP C;  4J8V B;  4M6B A;  5B2J C;  3REJ B;  3B6G D;  4R8P B;  1M19 A;  1ZLA D;  2Y2O A;  3AYW C;  2NZD A;  3A1I A;  3AZF D;  5CPI D;  4J8W A;  5E5A A;  2DF4 C;  5DNN C;  3AN2 A;  3W99 A;  3VH6 A;  3A1K A;  3UT9 A;  2J8P A;  4H9P A;  3AZN C;  3B0D C;  2CV5 B;  2ARO D;  3AZL A;  3WAA A;  5FUG A;  3B6F B;  3UTA C;  1S32 B;  4WU9 C;  5B0Z D;  3W98 B;  5JRG D;  3MNN B;  3LJA A;  3EPK A;  4H9O B;  3VH5 T;  3A6N B;  3REI C;  2JSS A;  3REH B;  3TU4 D;  3AZI C;  5BNV A;  3WKJ C;  4AWL C;  3AV1 B;  3KUY C;  5GT0 B;  5B0Y C;  4J8X C;  5CP6 C;  3B6G A;  4H9R A;  4CSR B;  5AV6 B;  1P3L B;  4YM6 A;  4XUJ D;  1HQ3 A;  4J8V C;  3WA9 C;  3REJ C;  5B31 D;  4ZBJ C;  4LD9 D;  3X1T C;  2W8S A;  3AZM A;  5B31 G;  1M18 B;  5B2J D;  2ZY3 A;  3MGR C;  3AZJ C;  5B2I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...