4H9PA

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9pA00
3AZMB 1F66C 1P3MC 3NQJB 3AZFC 4JJNC 5B1MD 3X1SA 4YM6A 3W96D 3AZIC 5G49B 5B1LD 3O62D 3RELB 3AZND 5AV5B 3X1UC 1AOIB 5AY8A 3X1TD 1P3KD 5CPKC 1M19C 3WTPB 5AV9A 4KHAB 4XUJB 1P3PA 1ID3B 1P3GC 5JA4B 3C1BA 3B0CW 2BYMB 4J8XC 3NQJA 3TU4B 1TZYB 3B0CT 3NQUB 4M6BA 1KX5B 3KUYC 4LD9D 4Z5TC 3RELD 3MGQB 4Z66C 3W98D 3LELB 3X1TB 2YFVB 5JRGD 4AWLB 3REHC 2PYOB 2RVQD 3R45B 3B6FB 4CAYA 4CAYB 1JFIB 1P3LA 4Z5TA 5BT1C 2NQBC 5GXQB 4H9NA 4KGCC 1H3OA 3AZLA 1HTAA 3WTPA 2FJ7D 1B67A 1U35D 4KUDD 3X1TA 5DNMB 4Z2MH 3WA9A 3C1BC 3W98B 1P3MB 4WU9B 5AV5A 5B31C 3AZLD 1EQZB 3B6GD 3X1UA 3MGRD 5B2ID 4ZBJB 1F66D 1P3LC 1R4VA 2BYMA 2YFWA 5CPIC 5JA4A 3WTPC 3MGRA 5AY8D 3B0DC 3KXBA 5AV8B 4YS3D 3W99D 1ID3C 5B32B 4J8UB 3VH5W 3W98A 3AFAB 1KX4C 5CP6D 5AVBB 5B33C 2HIOC 4QLCA 4WU9D 4ZUXC 3AZLB 3MVDB 3AV2D 1M1AB 1EQZD 5GXQA 4E44A 1WWIA 3WAAC 4Z5TB 1TZYD 1S32C 3AYWB 4J8WC 1P3OB 3B6FA 4XZQD 3LZ0A 3UT9A 4LD9B 3WA9C 3A6NB 3LJAC 3KWQD 3UTAC 3AV1C 3W97A 5BS7A 4Z66D 5B40B 5BO0B 5JRGC 5AV6A 2NQBA 4EO5C 1P3IB 2NZDB 3AZNB 3MGPC 5C3IC 1KX3B 1BH8B 5CP6B 3UTBB 2NQBB 5FUGA 2BYKB 1P3BD 5DNMA 3WKJC 5B2IA 1M18D 5B24B 3KXBC 3AZKC 3MGSA 5GT0C 3REKD 4XUJD 3C1BB 3AZGA 4XZQB 1P3BA 5B31B 1U35A 4H9OA 4R8PC 5GSUC 3REIC 3AZJA 5CPJC 2F8NG 5B1LA 3O62A 2AROC 3REKA 1M1AA 5BNXB 4WU8C 3C1CA 3LZ1C 4HGAC 3AZMC 1F66B 3LELD 3X1SB 5B32A 1KU5A 4J8UA 2FJ7B 1ZLAB 3AZIA 3MNNB 4XZQA 5GT3C 3UT9D 1P3PD 3AZJC 1KX4B 5AVBC 5AVCC 2HIOB 5B32D 4J8UD 4ZUXB 1M1AC 2F8NA 1P3FB 3V9RA 5B2IB 4H9PB 1P3PB 5FUGB 1EQZA 3VH6A 3MGSC 1P3GB 3KSYA 3AV1A 4H9SC 3WA9B 3TU4C 5B32G 1TZYC 3AV1B 1S32D 1AOIA 1P3AD 5AV6C 5JRGA 4NE5A 4J8WD 1HQ3B 4H9NB 5B1LB 3O62B 4EO5B 3MGPA 3AZNC 1P34C 4Z66B 3LZ1A 3UTBC 4H9QB 1P3KB 3MVDD 3WTPE 3AZGB 3REHB 4JJNB 2PYOC 5B2JC 1ZLAA 3AYWD 1P3OD 1M18A 3AZHC 5F99A 1AOIC 5B24D 4QLCC 3LELA 4G91B 3A6ND 3REJD 3MGQA 3W96C 3AZID 4WNNA 2AROA 3REKC 3V9RB 5BNXA 3AZFA 5CPKD 3A6NA 3B0BA 3AZED 5E5AA 1HQ3A 3REHD 5F99C 3KUYB 3W99A 1BFMA 5B31G 4G92B 3X1SD 1P3ID 2NZDD 3MNND 3REJB 5CPIB 5GXQD 3AFAA 4YM6B 3AV2A 3W97C 1M18B 1U35B 5E5AC 5B33A 2F8NK 2F8NH 3C1BD 5B33B 4H9QA 4H9RA 4Z66A 2CV5C 3WAAA 2BYKA 1P3LD 3REJA 4J8WB 1P3KC 3AZGC 5CHLB 1P3FD 5B0YB 2LY8A 5B40A 3NQUA 5AV8D 4YS3B 3W99B 1P3GD 4ZBJC 1H3OB 3W96A 5BNVA 5AVCA 5AV9C 2HUEC 4G91C 3UT9B 1P3FA 1JFIA 4X23C 3AYWA 5C3IB 1P3OA 2F8NB 3W96B 2HIOD 4ZUXD 3B0DB 3AV2C 3AZFB 4Z5TD 3RELC 5DNND 5AY8B 3AZIB 3X1UB 1ULYA 5KDMB 3REIA 3AFAD 3WA9D 5CPKB 5KDMA 4UUZA 3REIB 3VH6W 1M19B 3AZEC 1HQ3D 3REHA 2YFWB 1P3KA 4H9SA 3LZ1B 5BT1D 3WAAD 4KGCD 1P3BB 5GSUA 4R8PA 3AZKD 4KUDC 5JRGB 4YS3A 1KX5D 3MGQC 5B40D 3X1VA 2IO5C 3LZ0C 3X1TC 4WZSB 4J8WA 1KX3D 3KXBB 5G49A 3RELA 3UTAA 5GT0B 3MGPD 4J8VC 4WU8D 2JSSA 4NE3A 3WKJD 4NE6A 2HIOA 3LZ1D 3R45A 1N1JA 4YM6D 3B6FD 5GT0D 5CPJB 4YS3C 1ZLAD 4XUJA 2AROB 5AV9B 3WKJA 1P3MA 2HUEB 4CSRB 5GT3D 3UT9C 4X23B 3W98C 2AROD 4DRAA 1P3MD 5B1MA 3AZMD 3MGRB 4H9OB 5B0YD 3AN2C 3LJAD 3X1UD 1P3PC 2PYOA 3MGSB 3AFAC 3X1VD 5B32C 4J8UC 5B0YA 2F8ND 1P34D 3AZHA 1P3BC 3MVDC 1P3IA 2NZDA 4JJND 1BH9B 5B1MC 3AZLC 5CPJA 5F99B 1WWSA 4WU8A 4KGCA 1N1JB 5B1LC 3O62C 3WAAB 4XUJC 4H9RB 3TU4D 3AZHD 2IO5B 1AOID 4LD9A 5AV6D 3LZ0B 3A6NC 3LJAB 3WTPD 1KX5C 2FJ7A 4J8VA 5B40C 3KWQB 1TAFB 3LZ0D 4J8XD 4QLCB 3B6GA 3KWQA 5CP6C 3WKJB 1P3GA 5F99D 5B24C 5AV8A 2NQBD 5B31A 5AV5C 3LJAA 5AVCD 5B0ZC 3VH6T 4XZQC 5GT3A 5GXQC 4KGCB 2RVQC 4WU8B 5B31D 3AZEA 1BH9A 4NFTA 4WNNB 5CP6A 3AN2A 4KHAA 3MGRC 4J8XB 2L5AA 3AN2B 1F66A 3X1SC 1M18C 3KUYA 5CPID 2FJ7C 3AN2D 1U35C 5AY8C 3MNNC 1Q9CA 1P3LB 3AZJB 1B6WA 3W97D 3B6GC 1P3FC 1P34A 1A7WA 1KX4D 5GSUD 4R8PD 3AZKA 5B33D 5B2IC 3C1CC 5AV8C 1TAFA 2CV5D 4X23D 1KX3A 3VH5A 5BO0A 5AV6B 3W99C 1ID3D 3KWQC 3UTAD 3AZGD 3AV1D 1S32B 1P3AB 2CV5A 5DNMC 3AZJD 1P3AA 4WU9C 1EQZC 1ID3A 3AV2B 3UTAB 1M1AD 5GT0A 3C1CD 3AZHB 5B2JB 3AZFD 3MGSD 5B0ZA 3X1VB 3MVDA 1P3IC 2NZDC 5B0ZB 5AVBA 5DNNC 3C1CB 5AV5D 3REKB 2CWEA 3AZKB 3AZEB 4H9PA 4E45A 3REID 5B0ZD 1M19D 3AZMA 3MGQD 1KX4A 3UTBD 3MNNA 3KXBD 2PYOD 1M19A 5CPKA 4KUDB 4UUZB 5B2JD 4G92C 4X23A 3AYWC 1P3OC 3KUYD 5CPIA 1BH8A 4CSRA 3UTBA 4LD9C 3AZNA 4QLCD 4WU9A 3B6GB 5CPJD 4YM6C 3REJC 4JJNA 1KX5A 5B2JA 1ZLAC 3W97B 4J8VB 5AV9D 1TZYA 5GT3B 5BS7C 3TU4A 5E5AB 3MGPB 1KX3C 5AVCB 5BNVB 3LELC 4J8VD 4AWLC 5B1MB 2CV5B 1S32A 5B24A 1P3AC 3B6FC 5AVBD 1F1EA 4J8XA 2YFVA 4DRBA 5B0YC 5GSUB 4R8PB 5DNMD 4KUDA 1HQ3C 3VH5T 4ZUXA 4WV4B 5DNNA 3X1VC 1P34B 5E5AD 4Z2MG 4HGAB 5DNNB
chains in the Genus database with same CATH superfamily
3AZMB 1F66C 1P3MC 3NQJB 3AZFC 4JJNC 5B1MD 3X1SA 4YM6A 3W96D 3AZIC 5G49B 5B1LD 3O62D 3RELB 3AZND 5AV5B 2J8PA 3X1UC 1AOIB 5AY8A 3X1TD 1P3KD 5CPKC 1M19C 3WTPB 5AV9A 2ZY4A 4KHAB 4XUJB 1P3PA 1ID3B 1P3GC 5JA4B 3C1BA 3B0CW 2BYMB 4J8XC 3A1KA 3NQJA 3TU4B 1TZYB 3B0CT 3NQUB 4M6BA 1KX5B 3KUYC 4LD9D 4Z5TC 3RELD 3MGQB 2ZY5A 4Z66C 3W98D 3LELB 3X1TB 2YFVB 5JRGD 4AWLB 3REHC 2PYOB 2RVQD 2JCHA 3R45B 3B6FB 4CAYA 4CAYB 1JFIB 1P3LA 4Z5TA 5BT1C 2NQBC 5GXQB 4H9NA 4KGCC 1H3OA 3AZLA 1HTAA 3WTPA 2FJ7D 1B67A 1U35D 4KUDD 3X1TA 5DNMB 4Z2MH 3WA9A 3C1BC 3W98B 1P3MB 4WU9B 5AV5A 5B31C 3AZLD 1EQZB 3B6GD 3X1UA 3MGRD 2XD5A 5B2ID 4ZBJB 1F66D 1P3LC 1R4VA 2BYMA 2YFWA 2UWXA 5CPIC 5JA4A 3WTPC 3MGRA 5AY8D 3B0DC 3KXBA 5AV8B 4YS3D 3W99D 1ID3C 5B32B 4J8UB 3VH5W 3W98A 3AFAB 3EPKA 1KX4C 2VQRA 5CP6D 5AVBB 5B33C 2HIOC 4QLCA 4WU9D 4ZUXC 3AZLB 3MVDB 3AV2D 1M1AB 1EQZD 5GXQA 4E44A 1WWIA 3WAAC 4Z5TB 1TZYD 2W8SA 1S32C 3EPHA 3AYWB 4J8WC 1P3OB 3B6FA 4XZQD 3LZ0A 2Y2JA 3UT9A 4LD9B 3WA9C 3A6NB 3LJAC 3KWQD 3UTAC 3AV1C 3W97A 3EPJA 5BS7A 4Z66D 5B40B 3AL0C 5BO0B 5JRGC 5AV6A 2NQBA 4EO5C 1P3IB 2NZDB 3F6TA 3AZNB 3MGPC 5C3IC 1KX3B 1BH8B 5CP6B 3UTBB 2NQBB 5FUGA 2BYKB 1P3BD 5DNMA 3WKJC 5B2IA 1M18D 5B24B 3KXBC 3AZKC 3MGSA 5GT0C 3REKD 4XUJD 3C1BB 3AZGA 4XZQB 1P3BA 5B31B 1U35A 4H9OA 4R8PC 5GSUC 3REIC 3AZJA 5CPJC 2F8NG 5B1LA 3O62A 2AROC 3REKA 1M1AA 5BNXB 4WU8C 3C1CA 2Y2NA 3LZ1C 4HGAC 3AZMC 1F66B 3LELD 3X1SB 2Y2LA 1KU5A 5B32A 4J8UA 2FJ7B 1ZLAB 3AZIA 3MNNB 4XZQA 5GT3C 3UT9D 1P3PD 3AZJC 1KX4B 5AVBC 5AVCC 2HIOB 5B32D 4J8UD 4ZUXB 1M1AC 2F8NA 1P3FB 3V9RA 5B2IB 4H9PB 1P3PB 5FUGB 1EQZA 3VH6A 3MGSC 1P3GB 3KSYA 3AV1A 4H9SC 2Y2GA 3WA9B 3TU4C 3P5JB 5B32G 1TZYC 3AV1B 1S32D 1AOIA 1P3AD 5AV6C 5JRGA 4NE5A 4J8WD 1HQ3B 4H9NB 5B1LB 3O62B 4EO5B 3MGPA 3AZNC 1P34C 4Z66B 3LZ1A 3UTBC 4H9QB 1P3KB 3MVDD 3WTPE 3AZGB 3REHB 4JJNB 2PYOC 5B2JC 1ZLAA 3AYWD 1P3OD 1M18A 3AZHC 5F99A 1AOIC 5B24D 4QLCC 3LELA 4G91B 3A6ND 3REJD 3MGQA 3W96C 3AZID 4WNNA 2AROA 3REKC 3V9RB 5BNXA 3AZFA 5CPKD 3A6NA 3B0BA 3AZED 5E5AA 1HQ3A 3REHD 5F99C 3KUYB 3W99A 1BFMA 5B31G 4G92B 2ZY3A 3X1SD 1P3ID 2NZDD 3MNND 3REJB 5CPIB 5GXQD 3AFAA 4YM6B 3AV2A 3W97C 1M18B 1U35B 5E5AC 5B33A 2F8NK 2F8NH 3C1BD 5B33B 4H9QA 4H9RA 4Z66A 2CV5C 3WAAA 2BYKA 2XD1A 1P3LD 3REJA 4J8WB 1P3KC 3AZGC 5CHLB 1P3FD 5B0YB 2LY8A 5B40A 2Y2HA 3NQUA 5AV8D 4YS3B 3W99B 1P3GD 4ZBJC 1H3OB 3W96A 5AVCA 2Y2IA 5BNVA 5AV9C 2HUEC 4G91C 3UT9B 1P3FA 1JFIA 3EG5B 4X23C 3AYWA 5C3IB 1P3OA 2F8NB 3W96B 2HIOD 4ZUXD 3B0DB 3AV2C 3AZFB 4Z5TD 3RELC 5DNND 5AY8B 3AZIB 3X1UB 1ULYA 5KDMB 3REIA 3AFAD 3WA9D 5CPKB 5KDMA 4UUZA 3REIB 3VH6W 1M19B 2Y2MA 3AZEC 1HQ3D 3REHA 2YFWB 1P3KA 4H9SA 3LZ1B 5BT1D 3WAAD 4KGCD 1P3BB 5GSUA 4R8PA 3AZKD 4KUDC 5JRGB 4YS3A 1KX5D 3MGQC 5B40D 3X1VA 2IO5C 3LZ0C 3X1TC 4WZSB 4J8WA 1KX3D 3KXBB 5G49A 3RELA 3UTAA 5GT0B 3MGPD 4J8VC 4WU8D 2JSSA 2DF4C 4NE3A 3WKJD 4NE6A 2HIOA 3LZ1D 3R45A 1N1JA 4YM6D 3B6FD 5GT0D 5CPJB 4YS3C 1ZLAD 4XUJA 2AROB 5AV9B 3WKJA 1P3MA 2HUEB 4CSRB 5GT3D 3UT9C 4X23B 3W98C 2AROD 4DRAA 1P3MD 5B1MA 4DQYB 3AZMD 3MGRB 4H9OB 5B0YD 3AN2C 1PZRA 3LJAD 2F2AC 3X1UD 1P3PC 1W2EA 4UPKA 2PYOA 3MGSB 3AFAC 3X1VD 5B32C 4J8UC 5B0YA 3FDDA 2F8ND 1P34D 3AZHA 1P3BC 3MVDC 1P3IA 2NZDA 4JJND 1BH9B 5B1MC 3AZLC 5CPJA 5F99B 4WU8A 1WWSA 4KGCA 1N1JB 5B1LC 3O62C 3WAAB 4XUJC 4H9RB 3TU4D 3AZHD 2DQNC 2IO5B 1AOID 4LD9A 5AV6D 2JE5A 3LZ0B 3A6NC 3LJAB 3WTPD 1KX5C 2FJ7A 4J8VA 5B40C 3A1IA 3KWQB 1TAFB 3LZ0D 4J8XD 4QLCB 3B6GA 3KWQA 5CP6C 3WKJB 1P3GA 5F99D 5B24C 5AV8A 2NQBD 5AV5C 5B31A 3H0MC 3LJAA 2Y2KA 3IP4C 5AVCD 2G5HC 5B0ZC 2Y2QA 3VH6T 4XZQC 5GT3A 2ZY2A 5GXQC 4KGCB 2RVQC 2G5IC 4WU8B 5B31D 3AZEA 1BH9A 4NFTA 4WNNB 5CP6A 3AN2A 4KHAA 3MGRC 4J8XB 2L5AA 3AN2B 1F66A 3X1SC 1M18C 3KUYA 5CPID 2FJ7C 3AN2D 1U35C 5AY8C 3MNNC 1Q9CA 1P3LB 3AZJB 1Z2CB 1B6WA 3W97D 3B6GC 1P3FC 4WJ3C 1P34A 1A7WA 1KX4D 5GSUD 4R8PD 3AZKA 5B33D 5B2IC 3C1CC 5AV8C 1TAFA 2CV5D 4X23D 1KX3A 3VH5A 5BO0A 5AV6B 3W99C 1ID3D 3KWQC 3UTAD 3AZGD 3AV1D 1S32B 1P3AB 2CV5A 5DNMC 2RIQA 3AZJD 1P3AA 4WU9C 1EQZC 1ID3A 3AV2B 3UTAB 1M1AD 5GT0A 3C1CD 3AZHB 5B2JB 3AZFD 3MGSD 5B0ZA 3X1VB 3MVDA 3H0RC 1P3IC 5B0ZB 2NZDC 5AVBA 5DNNC 3C1CB 5AV5D 3REKB 2CWEA 3AZKB 3AZEB 4H9PA 4E45A 3REID 1T3UA 5B0ZD 1M19D 2BG1A 3AZMA 3MGQD 1KX4A 3UTBD 3MNNA 3KXBD 2PYOD 1M19A 5CPKA 4KUDB 4UUZB 3KFUG 5B2JD 3H0LC 4G92C 4X23A 3AYWC 2Y2OA 3KUYD 5CPIA 1BH8A 4CSRA 3UTBA 1P3OC 4LD9C 3AZNA 4QLCD 4WU9A 3B6GB 2Y2PA 5CPJD 4YM6C 3REJC 2ZM5A 4JJNA 1KX5A 5B2JA 1ZLAC 3W97B 4J8VB 5AV9D 1TZYA 5GT3B 5BS7C 3TU4A 5E5AB 3MGPB 1KX3C 5AVCB 5BNVB 3LELC 4J8VD 4AWLC 5B1MB 2CV5B 1S32A 5B24A 1P3AC 2FFFB 5AVBD 3B6FC 1F1EA 4J8XA 2YFVA 4DRBA 5B0YC 5GSUB 4R8PB 5DNMD 4KUDA 1HQ3C 3VH5T 4ZUXA 3EPLA 4WV4B 5DNNA 3X1VC 1P34B 5E5AD 4Z2MG 4HGAB 5DNNB
chains in the Genus database with same CATH topology
3AZMB 1F66C 1P3MC 3NQJB 3AZFC 4JJNC 5B1MD 3X1SA 4YM6A 3W96D 3AZIC 5G49B 5B1LD 3O62D 3RELB 3AZND 5AV5B 2J8PA 3X1UC 1AOIB 5AY8A 3X1TD 1P3KD 5CPKC 1M19C 3WTPB 5AV9A 2ZY4A 4KHAB 4XUJB 1P3PA 1ID3B 1P3GC 5JA4B 3C1BA 3B0CW 2BYMB 4J8XC 3A1KA 3NQJA 3TU4B 1TZYB 3B0CT 3NQUB 4M6BA 1KX5B 3KUYC 4LD9D 4Z5TC 3RELD 3MGQB 2ZY5A 4Z66C 3W98D 3LELB 3X1TB 2YFVB 5JRGD 4AWLB 3REHC 2PYOB 2RVQD 2JCHA 3R45B 3B6FB 4CAYA 4CAYB 1JFIB 1P3LA 4Z5TA 5BT1C 2NQBC 5GXQB 4H9NA 4KGCC 1H3OA 3AZLA 1HTAA 3WTPA 2FJ7D 1B67A 1U35D 4KUDD 3X1TA 5DNMB 4Z2MH 3WA9A 3C1BC 3W98B 1P3MB 4WU9B 5AV5A 5B31C 3AZLD 1EQZB 3B6GD 3X1UA 3MGRD 2XD5A 5B2ID 4ZBJB 1F66D 1P3LC 1R4VA 2BYMA 2YFWA 2UWXA 5CPIC 5JA4A 3WTPC 3MGRA 5AY8D 3B0DC 3KXBA 5AV8B 4YS3D 3W99D 1ID3C 5B32B 4J8UB 3VH5W 3W98A 3AFAB 3EPKA 1KX4C 2VQRA 5CP6D 5AVBB 5B33C 2HIOC 4QLCA 4WU9D 4ZUXC 3AZLB 3MVDB 3AV2D 1M1AB 1EQZD 5GXQA 4E44A 1WWIA 3WAAC 4Z5TB 1TZYD 2W8SA 1S32C 3EPHA 3AYWB 4J8WC 1P3OB 3B6FA 4XZQD 3LZ0A 2Y2JA 3UT9A 4LD9B 3WA9C 3A6NB 3LJAC 3KWQD 3UTAC 3AV1C 3W97A 3EPJA 5BS7A 4Z66D 5B40B 3AL0C 5BO0B 5JRGC 5AV6A 2NQBA 4EO5C 1P3IB 2NZDB 3F6TA 3AZNB 3MGPC 5C3IC 1KX3B 1BH8B 5CP6B 3UTBB 2NQBB 5FUGA 2BYKB 1P3BD 5DNMA 3WKJC 5B2IA 1M18D 5B24B 3KXBC 3AZKC 3MGSA 5GT0C 3REKD 4XUJD 3C1BB 3AZGA 4XZQB 1P3BA 5B31B 1U35A 4H9OA 4R8PC 5GSUC 3REIC 3AZJA 5CPJC 2F8NG 5B1LA 3O62A 2AROC 3REKA 1M1AA 5BNXB 4WU8C 3C1CA 2Y2NA 3LZ1C 4HGAC 3AZMC 1F66B 3LELD 3X1SB 2Y2LA 1KU5A 5B32A 4J8UA 2FJ7B 1ZLAB 3AZIA 3MNNB 4XZQA 5GT3C 3UT9D 1P3PD 3AZJC 1KX4B 5AVBC 5AVCC 2HIOB 5B32D 4J8UD 4ZUXB 1M1AC 2F8NA 1P3FB 3V9RA 5B2IB 4H9PB 1P3PB 5FUGB 1EQZA 3VH6A 3MGSC 1P3GB 3KSYA 3AV1A 4H9SC 2Y2GA 3WA9B 3TU4C 3P5JB 5B32G 1TZYC 3AV1B 1S32D 1AOIA 1P3AD 5AV6C 5JRGA 4NE5A 4J8WD 1HQ3B 4H9NB 5B1LB 3O62B 4EO5B 3MGPA 3AZNC 1P34C 4Z66B 3LZ1A 3UTBC 4H9QB 1P3KB 3MVDD 3WTPE 3AZGB 3REHB 4JJNB 2PYOC 5B2JC 1ZLAA 3AYWD 1P3OD 1M18A 3AZHC 5F99A 1AOIC 5B24D 4QLCC 3LELA 4G91B 3A6ND 3REJD 3MGQA 3W96C 3AZID 4WNNA 2AROA 3REKC 3V9RB 5BNXA 3AZFA 5CPKD 3A6NA 3B0BA 3AZED 5E5AA 1HQ3A 3REHD 5F99C 3KUYB 3W99A 1BFMA 5B31G 4G92B 2ZY3A 3X1SD 1P3ID 2NZDD 3MNND 3REJB 5CPIB 5GXQD 3AFAA 4YM6B 3AV2A 3W97C 1M18B 1U35B 5E5AC 5B33A 2F8NK 2F8NH 3C1BD 5B33B 4H9QA 4H9RA 4Z66A 2CV5C 3WAAA 2BYKA 2XD1A 1P3LD 3REJA 4J8WB 1P3KC 3AZGC 5CHLB 1P3FD 5B0YB 2LY8A 5B40A 2Y2HA 3NQUA 5AV8D 4YS3B 3W99B 1P3GD 4ZBJC 1H3OB 3W96A 5AVCA 2Y2IA 5BNVA 5AV9C 2HUEC 4G91C 3UT9B 1P3FA 1JFIA 3EG5B 4X23C 3AYWA 5C3IB 1P3OA 2F8NB 3W96B 2HIOD 4ZUXD 3B0DB 3AV2C 3AZFB 4Z5TD 3RELC 5DNND 5AY8B 3AZIB 3X1UB 1ULYA 5KDMB 3REIA 3AFAD 3WA9D 5CPKB 5KDMA 4UUZA 3REIB 3VH6W 1M19B 2Y2MA 3AZEC 1HQ3D 3REHA 2YFWB 1P3KA 4H9SA 3LZ1B 5BT1D 3WAAD 4KGCD 1P3BB 5GSUA 4R8PA 3AZKD 4KUDC 5JRGB 4YS3A 1KX5D 3MGQC 5B40D 3X1VA 2IO5C 3LZ0C 3X1TC 4WZSB 4J8WA 1KX3D 3KXBB 5G49A 3RELA 3UTAA 5GT0B 3MGPD 4J8VC 4WU8D 2JSSA 2DF4C 4NE3A 3WKJD 4NE6A 2HIOA 3LZ1D 3R45A 1N1JA 4YM6D 3B6FD 5GT0D 5CPJB 4YS3C 1ZLAD 4XUJA 2AROB 5AV9B 3WKJA 1P3MA 2HUEB 4CSRB 5GT3D 3UT9C 4X23B 3W98C 2AROD 4DRAA 1P3MD 5B1MA 4DQYB 3AZMD 3MGRB 4H9OB 5B0YD 3AN2C 1PZRA 3LJAD 2F2AC 3X1UD 1P3PC 1W2EA 4UPKA 2PYOA 3MGSB 3AFAC 3X1VD 5B32C 4J8UC 5B0YA 3FDDA 2F8ND 1P34D 3AZHA 1P3BC 3MVDC 1P3IA 2NZDA 4JJND 1BH9B 5B1MC 3AZLC 5CPJA 5F99B 4WU8A 1WWSA 4KGCA 1N1JB 5B1LC 3O62C 3WAAB 4XUJC 4H9RB 3TU4D 3AZHD 2DQNC 2IO5B 1AOID 4LD9A 5AV6D 2JE5A 3LZ0B 3A6NC 3LJAB 3WTPD 1KX5C 2FJ7A 4J8VA 5B40C 3A1IA 3KWQB 1TAFB 3LZ0D 4J8XD 4QLCB 3B6GA 3KWQA 5CP6C 3WKJB 1P3GA 5F99D 5B24C 5AV8A 2NQBD 5AV5C 5B31A 3H0MC 3LJAA 2Y2KA 3IP4C 5AVCD 2G5HC 5B0ZC 2Y2QA 3VH6T 4XZQC 5GT3A 2ZY2A 5GXQC 4KGCB 2RVQC 2G5IC 4WU8B 5B31D 3AZEA 1BH9A 4NFTA 4WNNB 5CP6A 3AN2A 4KHAA 3MGRC 4J8XB 2L5AA 3AN2B 1F66A 3X1SC 1M18C 3KUYA 5CPID 2FJ7C 3AN2D 1U35C 5AY8C 3MNNC 1Q9CA 1P3LB 3AZJB 1Z2CB 1B6WA 3W97D 3B6GC 1P3FC 4WJ3C 1P34A 1A7WA 1KX4D 5GSUD 4R8PD 3AZKA 5B33D 5B2IC 3C1CC 5AV8C 1TAFA 2CV5D 4X23D 1KX3A 3VH5A 5BO0A 5AV6B 3W99C 1ID3D 3KWQC 3UTAD 3AZGD 3AV1D 1S32B 1P3AB 2CV5A 5DNMC 2RIQA 3AZJD 1P3AA 4WU9C 1EQZC 1ID3A 3AV2B 3UTAB 1M1AD 5GT0A 3C1CD 3AZHB 5B2JB 3AZFD 3MGSD 5B0ZA 3X1VB 3MVDA 3H0RC 1P3IC 5B0ZB 2NZDC 5AVBA 5DNNC 3C1CB 5AV5D 3REKB 2CWEA 3AZKB 3AZEB 4H9PA 4E45A 3REID 1T3UA 5B0ZD 1M19D 2BG1A 3AZMA 3MGQD 1KX4A 3UTBD 3MNNA 3KXBD 2PYOD 1M19A 5CPKA 4KUDB 4UUZB 3KFUG 5B2JD 3H0LC 4G92C 4X23A 3AYWC 2Y2OA 3KUYD 5CPIA 1BH8A 4CSRA 3UTBA 1P3OC 4LD9C 3AZNA 4QLCD 4WU9A 3B6GB 2Y2PA 5CPJD 4YM6C 3REJC 2ZM5A 4JJNA 1KX5A 5B2JA 1ZLAC 3W97B 4J8VB 5AV9D 1TZYA 5GT3B 5BS7C 3TU4A 5E5AB 3MGPB 1KX3C 5AVCB 5BNVB 3LELC 4J8VD 4AWLC 5B1MB 2CV5B 1S32A 5B24A 1P3AC 2FFFB 5AVBD 3B6FC 1F1EA 4J8XA 2YFVA 4DRBA 5B0YC 5GSUB 4R8PB 5DNMD 4KUDA 1HQ3C 3VH5T 4ZUXA 3EPLA 4WV4B 5DNNA 3X1VC 1P34B 5E5AD 4Z2MG 4HGAB 5DNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZM B;  1F66 C;  1P3M C;  3NQJ B;  3AZF C;  4JJN C;  5B1M D;  3X1S A;  4YM6 A;  3W96 D;  3AZI C;  5G49 B;  5B1L D;  3O62 D;  3REL B;  3AZN D;  5AV5 B;  3X1U C;  1AOI B;  5AY8 A;  3X1T D;  1P3K D;  5CPK C;  1M19 C;  3WTP B;  5AV9 A;  4KHA B;  4XUJ B;  1P3P A;  1ID3 B;  1P3G C;  5JA4 B;  3C1B A;  3B0C W;  2BYM B;  4J8X C;  3NQJ A;  3TU4 B;  1TZY B;  3B0C T;  3NQU B;  4M6B A;  1KX5 B;  3KUY C;  4LD9 D;  4Z5T C;  3REL D;  3MGQ B;  4Z66 C;  3W98 D;  3LEL B;  3X1T B;  2YFV B;  5JRG D;  4AWL B;  3REH C;  2PYO B;  2RVQ D;  3R45 B;  3B6F B;  4CAY A;  4CAY B;  1JFI B;  1P3L A;  4Z5T A;  5BT1 C;  2NQB C;  5GXQ B;  4H9N A;  4KGC C;  1H3O A;  3AZL A;  1HTA A;  3WTP A;  2FJ7 D;  1B67 A;  1U35 D;  4KUD D;  3X1T A;  5DNM B;  4Z2M H;  3WA9 A;  3C1B C;  3W98 B;  1P3M B;  4WU9 B;  5AV5 A;  5B31 C;  3AZL D;  1EQZ B;  3B6G D;  3X1U A;  3MGR D;  5B2I D;  4ZBJ B;  1F66 D;  1P3L C;  1R4V A;  2BYM A;  2YFW A;  5CPI C;  5JA4 A;  3WTP C;  3MGR A;  5AY8 D;  3B0D C;  3KXB A;  5AV8 B;  4YS3 D;  3W99 D;  1ID3 C;  5B32 B;  4J8U B;  3VH5 W;  3W98 A;  3AFA B;  1KX4 C;  5CP6 D;  5AVB B;  5B33 C;  2HIO C;  4QLC A;  4WU9 D;  4ZUX C;  3AZL B;  3MVD B;  3AV2 D;  1M1A B;  1EQZ D;  5GXQ A;  4E44 A;  1WWI A;  3WAA C;  4Z5T B;  1TZY D;  1S32 C;  3AYW B;  4J8W C;  1P3O B;  3B6F A;  4XZQ D;  3LZ0 A;  3UT9 A;  4LD9 B;  3WA9 C;  3A6N B;  3LJA C;  3KWQ D;  3UTA C;  3AV1 C;  3W97 A;  5BS7 A;  4Z66 D;  5B40 B;  5BO0 B;  5JRG C;  5AV6 A;  2NQB A;  4EO5 C;  1P3I B;  2NZD B;  3AZN B;  3MGP C;  5C3I C;  1KX3 B;  1BH8 B;  5CP6 B;  3UTB B;  2NQB B;  5FUG A;  2BYK B;  1P3B D;  5DNM A;  3WKJ C;  5B2I A;  1M18 D;  5B24 B;  3KXB C;  3AZK C;  3MGS A;  5GT0 C;  3REK D;  4XUJ D;  3C1B B;  3AZG A;  4XZQ B;  1P3B A;  5B31 B;  1U35 A;  4H9O A;  4R8P C;  5GSU C;  3REI C;  3AZJ A;  5CPJ C;  2F8N G;  5B1L A;  3O62 A;  2ARO C;  3REK A;  1M1A A;  5BNX B;  4WU8 C;  3C1C A;  3LZ1 C;  4HGA C;  3AZM C;  1F66 B;  3LEL D;  3X1S B;  5B32 A;  1KU5 A;  4J8U A;  2FJ7 B;  1ZLA B;  3AZI A;  3MNN B;  4XZQ A;  5GT3 C;  3UT9 D;  1P3P D;  3AZJ C;  1KX4 B;  5AVB C;  5AVC C;  2HIO B;  5B32 D;  4J8U D;  4ZUX B;  1M1A C;  2F8N A;  1P3F B;  3V9R A;  5B2I B;  4H9P B;  1P3P B;  5FUG B;  1EQZ A;  3VH6 A;  3MGS C;  1P3G B;  3KSY A;  3AV1 A;  4H9S C;  3WA9 B;  3TU4 C;  5B32 G;  1TZY C;  3AV1 B;  1S32 D;  1AOI A;  1P3A D;  5AV6 C;  5JRG A;  4NE5 A;  4J8W D;  1HQ3 B;  4H9N B;  5B1L B;  3O62 B;  4EO5 B;  3MGP A;  3AZN C;  1P34 C;  4Z66 B;  3LZ1 A;  3UTB C;  4H9Q B;  1P3K B;  3MVD D;  3WTP E;  3AZG B;  3REH B;  4JJN B;  2PYO C;  5B2J C;  1ZLA A;  3AYW D;  1P3O D;  1M18 A;  3AZH C;  5F99 A;  1AOI C;  5B24 D;  4QLC C;  3LEL A;  4G91 B;  3A6N D;  3REJ D;  3MGQ A;  3W96 C;  3AZI D;  4WNN A;  2ARO A;  3REK C;  3V9R B;  5BNX A;  3AZF A;  5CPK D;  3A6N A;  3B0B A;  3AZE D;  5E5A A;  1HQ3 A;  3REH D;  5F99 C;  3KUY B;  3W99 A;  1BFM A;  5B31 G;  4G92 B;  3X1S D;  1P3I D;  2NZD D;  3MNN D;  3REJ B;  5CPI B;  5GXQ D;  3AFA A;  4YM6 B;  3AV2 A;  3W97 C;  1M18 B;  1U35 B;  5E5A C;  5B33 A;  2F8N K;  2F8N H;  3C1B D;  5B33 B;  4H9Q A;  4H9R A;  4Z66 A;  2CV5 C;  3WAA A;  2BYK A;  1P3L D;  3REJ A;  4J8W B;  1P3K C;  3AZG C;  5CHL B;  1P3F D;  5B0Y B;  2LY8 A;  5B40 A;  3NQU A;  5AV8 D;  4YS3 B;  3W99 B;  1P3G D;  4ZBJ C;  1H3O B;  3W96 A;  5BNV A;  5AVC A;  5AV9 C;  2HUE C;  4G91 C;  3UT9 B;  1P3F A;  1JFI A;  4X23 C;  3AYW A;  5C3I B;  1P3O A;  2F8N B;  3W96 B;  2HIO D;  4ZUX D;  3B0D B;  3AV2 C;  3AZF B;  4Z5T D;  3REL C;  5DNN D;  5AY8 B;  3AZI B;  3X1U B;  1ULY A;  5KDM B;  3REI A;  3AFA D;  3WA9 D;  5CPK B;  5KDM A;  4UUZ A;  3REI B;  3VH6 W;  1M19 B;  3AZE C;  1HQ3 D;  3REH A;  2YFW B;  1P3K A;  4H9S A;  3LZ1 B;  5BT1 D;  3WAA D;  4KGC D;  1P3B B;  5GSU A;  4R8P A;  3AZK D;  4KUD C;  5JRG B;  4YS3 A;  1KX5 D;  3MGQ C;  5B40 D;  3X1V A;  2IO5 C;  3LZ0 C;  3X1T C;  4WZS B;  4J8W A;  1KX3 D;  3KXB B;  5G49 A;  3REL A;  3UTA A;  5GT0 B;  3MGP D;  4J8V C;  4WU8 D;  2JSS A;  4NE3 A;  3WKJ D;  4NE6 A;  2HIO A;  3LZ1 D;  3R45 A;  1N1J A;  4YM6 D;  3B6F D;  5GT0 D;  5CPJ B;  4YS3 C;  1ZLA D;  4XUJ A;  2ARO B;  5AV9 B;  3WKJ A;  1P3M A;  2HUE B;  4CSR B;  5GT3 D;  3UT9 C;  4X23 B;  3W98 C;  2ARO D;  4DRA A;  1P3M D;  5B1M A;  3AZM D;  3MGR B;  4H9O B;  5B0Y D;  3AN2 C;  3LJA D;  3X1U D;  1P3P C;  2PYO A;  3MGS B;  3AFA C;  3X1V D;  5B32 C;  4J8U C;  5B0Y A;  2F8N D;  1P34 D;  3AZH A;  1P3B C;  3MVD C;  1P3I A;  2NZD A;  4JJN D;  1BH9 B;  5B1M C;  3AZL C;  5CPJ A;  5F99 B;  1WWS A;  4WU8 A;  4KGC A;  1N1J B;  5B1L C;  3O62 C;  3WAA B;  4XUJ C;  4H9R B;  3TU4 D;  3AZH D;  2IO5 B;  1AOI D;  4LD9 A;  5AV6 D;  3LZ0 B;  3A6N C;  3LJA B;  3WTP D;  1KX5 C;  2FJ7 A;  4J8V A;  5B40 C;  3KWQ B;  1TAF B;  3LZ0 D;  4J8X D;  4QLC B;  3B6G A;  3KWQ A;  5CP6 C;  3WKJ B;  1P3G A;  5F99 D;  5B24 C;  5AV8 A;  2NQB D;  5B31 A;  5AV5 C;  3LJA A;  5AVC D;  5B0Z C;  3VH6 T;  4XZQ C;  5GT3 A;  5GXQ C;  4KGC B;  2RVQ C;  4WU8 B;  5B31 D;  3AZE A;  1BH9 A;  4NFT A;  4WNN B;  5CP6 A;  3AN2 A;  4KHA A;  3MGR C;  4J8X B;  2L5A A;  3AN2 B;  1F66 A;  3X1S C;  1M18 C;  3KUY A;  5CPI D;  2FJ7 C;  3AN2 D;  1U35 C;  5AY8 C;  3MNN C;  1Q9C A;  1P3L B;  3AZJ B;  1B6W A;  3W97 D;  3B6G C;  1P3F C;  1P34 A;  1A7W A;  1KX4 D;  5GSU D;  4R8P D;  3AZK A;  5B33 D;  5B2I C;  3C1C C;  5AV8 C;  1TAF A;  2CV5 D;  4X23 D;  1KX3 A;  3VH5 A;  5BO0 A;  5AV6 B;  3W99 C;  1ID3 D;  3KWQ C;  3UTA D;  3AZG D;  3AV1 D;  1S32 B;  1P3A B;  2CV5 A;  5DNM C;  3AZJ D;  1P3A A;  4WU9 C;  1EQZ C;  1ID3 A;  3AV2 B;  3UTA B;  1M1A D;  5GT0 A;  3C1C D;  3AZH B;  5B2J B;  3AZF D;  3MGS D;  5B0Z A;  3X1V B;  3MVD A;  1P3I C;  2NZD C;  5B0Z B;  5AVB A;  5DNN C;  3C1C B;  5AV5 D;  3REK B;  2CWE A;  3AZK B;  3AZE B;  4H9P A;  4E45 A;  3REI D;  5B0Z D;  1M19 D;  3AZM A;  3MGQ D;  1KX4 A;  3UTB D;  3MNN A;  3KXB D;  2PYO D;  1M19 A;  5CPK A;  4KUD B;  4UUZ B;  5B2J D;  4G92 C;  4X23 A;  3AYW C;  1P3O C;  3KUY D;  5CPI A;  1BH8 A;  4CSR A;  3UTB A;  4LD9 C;  3AZN A;  4QLC D;  4WU9 A;  3B6G B;  5CPJ D;  4YM6 C;  3REJ C;  4JJN A;  1KX5 A;  5B2J A;  1ZLA C;  3W97 B;  4J8V B;  5AV9 D;  1TZY A;  5GT3 B;  5BS7 C;  3TU4 A;  5E5A B;  3MGP B;  1KX3 C;  5AVC B;  5BNV B;  3LEL C;  4J8V D;  4AWL C;  5B1M B;  2CV5 B;  1S32 A;  5B24 A;  1P3A C;  3B6F C;  5AVB D;  1F1E A;  4J8X A;  2YFV A;  4DRB A;  5B0Y C;  5GSU B;  4R8P B;  5DNM D;  4KUD A;  1HQ3 C;  3VH5 T;  4ZUX A;  4WV4 B;  5DNN A;  3X1V C;  1P34 B;  5E5A D;  4Z2M G;  4HGA B;  5DNN B; 
#chains in the Genus database with same CATH topology
 3AZM B;  1F66 C;  1P3M C;  3NQJ B;  3AZF C;  4JJN C;  5B1M D;  3X1S A;  4YM6 A;  3W96 D;  3AZI C;  5G49 B;  5B1L D;  3O62 D;  3REL B;  3AZN D;  5AV5 B;  2J8P A;  3X1U C;  1AOI B;  5AY8 A;  3X1T D;  1P3K D;  5CPK C;  1M19 C;  3WTP B;  5AV9 A;  2ZY4 A;  4KHA B;  4XUJ B;  1P3P A;  1ID3 B;  1P3G C;  5JA4 B;  3C1B A;  3B0C W;  2BYM B;  4J8X C;  3A1K A;  3NQJ A;  3TU4 B;  1TZY B;  3B0C T;  3NQU B;  4M6B A;  1KX5 B;  3KUY C;  4LD9 D;  4Z5T C;  3REL D;  3MGQ B;  2ZY5 A;  4Z66 C;  3W98 D;  3LEL B;  3X1T B;  2YFV B;  5JRG D;  4AWL B;  3REH C;  2PYO B;  2RVQ D;  2JCH A;  3R45 B;  3B6F B;  4CAY A;  4CAY B;  1JFI B;  1P3L A;  4Z5T A;  5BT1 C;  2NQB C;  5GXQ B;  4H9N A;  4KGC C;  1H3O A;  3AZL A;  1HTA A;  3WTP A;  2FJ7 D;  1B67 A;  1U35 D;  4KUD D;  3X1T A;  5DNM B;  4Z2M H;  3WA9 A;  3C1B C;  3W98 B;  1P3M B;  4WU9 B;  5AV5 A;  5B31 C;  3AZL D;  1EQZ B;  3B6G D;  3X1U A;  3MGR D;  2XD5 A;  5B2I D;  4ZBJ B;  1F66 D;  1P3L C;  1R4V A;  2BYM A;  2YFW A;  2UWX A;  5CPI C;  5JA4 A;  3WTP C;  3MGR A;  5AY8 D;  3B0D C;  3KXB A;  5AV8 B;  4YS3 D;  3W99 D;  1ID3 C;  5B32 B;  4J8U B;  3VH5 W;  3W98 A;  3AFA B;  3EPK A;  1KX4 C;  2VQR A;  5CP6 D;  5AVB B;  5B33 C;  2HIO C;  4QLC A;  4WU9 D;  4ZUX C;  3AZL B;  3MVD B;  3AV2 D;  1M1A B;  1EQZ D;  5GXQ A;  4E44 A;  1WWI A;  3WAA C;  4Z5T B;  1TZY D;  2W8S A;  1S32 C;  3EPH A;  3AYW B;  4J8W C;  1P3O B;  3B6F A;  4XZQ D;  3LZ0 A;  2Y2J A;  3UT9 A;  4LD9 B;  3WA9 C;  3A6N B;  3LJA C;  3KWQ D;  3UTA C;  3AV1 C;  3W97 A;  3EPJ A;  5BS7 A;  4Z66 D;  5B40 B;  3AL0 C;  5BO0 B;  5JRG C;  5AV6 A;  2NQB A;  4EO5 C;  1P3I B;  2NZD B;  3F6T A;  3AZN B;  3MGP C;  5C3I C;  1KX3 B;  1BH8 B;  5CP6 B;  3UTB B;  2NQB B;  5FUG A;  2BYK B;  1P3B D;  5DNM A;  3WKJ C;  5B2I A;  1M18 D;  5B24 B;  3KXB C;  3AZK C;  3MGS A;  5GT0 C;  3REK D;  4XUJ D;  3C1B B;  3AZG A;  4XZQ B;  1P3B A;  5B31 B;  1U35 A;  4H9O A;  4R8P C;  5GSU C;  3REI C;  3AZJ A;  5CPJ C;  2F8N G;  5B1L A;  3O62 A;  2ARO C;  3REK A;  1M1A A;  5BNX B;  4WU8 C;  3C1C A;  2Y2N A;  3LZ1 C;  4HGA C;  3AZM C;  1F66 B;  3LEL D;  3X1S B;  2Y2L A;  1KU5 A;  5B32 A;  4J8U A;  2FJ7 B;  1ZLA B;  3AZI A;  3MNN B;  4XZQ A;  5GT3 C;  3UT9 D;  1P3P D;  3AZJ C;  1KX4 B;  5AVB C;  5AVC C;  2HIO B;  5B32 D;  4J8U D;  4ZUX B;  1M1A C;  2F8N A;  1P3F B;  3V9R A;  5B2I B;  4H9P B;  1P3P B;  5FUG B;  1EQZ A;  3VH6 A;  3MGS C;  1P3G B;  3KSY A;  3AV1 A;  4H9S C;  2Y2G A;  3WA9 B;  3TU4 C;  3P5J B;  5B32 G;  1TZY C;  3AV1 B;  1S32 D;  1AOI A;  1P3A D;  5AV6 C;  5JRG A;  4NE5 A;  4J8W D;  1HQ3 B;  4H9N B;  5B1L B;  3O62 B;  4EO5 B;  3MGP A;  3AZN C;  1P34 C;  4Z66 B;  3LZ1 A;  3UTB C;  4H9Q B;  1P3K B;  3MVD D;  3WTP E;  3AZG B;  3REH B;  4JJN B;  2PYO C;  5B2J C;  1ZLA A;  3AYW D;  1P3O D;  1M18 A;  3AZH C;  5F99 A;  1AOI C;  5B24 D;  4QLC C;  3LEL A;  4G91 B;  3A6N D;  3REJ D;  3MGQ A;  3W96 C;  3AZI D;  4WNN A;  2ARO A;  3REK C;  3V9R B;  5BNX A;  3AZF A;  5CPK D;  3A6N A;  3B0B A;  3AZE D;  5E5A A;  1HQ3 A;  3REH D;  5F99 C;  3KUY B;  3W99 A;  1BFM A;  5B31 G;  4G92 B;  2ZY3 A;  3X1S D;  1P3I D;  2NZD D;  3MNN D;  3REJ B;  5CPI B;  5GXQ D;  3AFA A;  4YM6 B;  3AV2 A;  3W97 C;  1M18 B;  1U35 B;  5E5A C;  5B33 A;  2F8N K;  2F8N H;  3C1B D;  5B33 B;  4H9Q A;  4H9R A;  4Z66 A;  2CV5 C;  3WAA A;  2BYK A;  2XD1 A;  1P3L D;  3REJ A;  4J8W B;  1P3K C;  3AZG C;  5CHL B;  1P3F D;  5B0Y B;  2LY8 A;  5B40 A;  2Y2H A;  3NQU A;  5AV8 D;  4YS3 B;  3W99 B;  1P3G D;  4ZBJ C;  1H3O B;  3W96 A;  5AVC A;  2Y2I A;  5BNV A;  5AV9 C;  2HUE C;  4G91 C;  3UT9 B;  1P3F A;  1JFI A;  3EG5 B;  4X23 C;  3AYW A;  5C3I B;  1P3O A;  2F8N B;  3W96 B;  2HIO D;  4ZUX D;  3B0D B;  3AV2 C;  3AZF B;  4Z5T D;  3REL C;  5DNN D;  5AY8 B;  3AZI B;  3X1U B;  1ULY A;  5KDM B;  3REI A;  3AFA D;  3WA9 D;  5CPK B;  5KDM A;  4UUZ A;  3REI B;  3VH6 W;  1M19 B;  2Y2M A;  3AZE C;  1HQ3 D;  3REH A;  2YFW B;  1P3K A;  4H9S A;  3LZ1 B;  5BT1 D;  3WAA D;  4KGC D;  1P3B B;  5GSU A;  4R8P A;  3AZK D;  4KUD C;  5JRG B;  4YS3 A;  1KX5 D;  3MGQ C;  5B40 D;  3X1V A;  2IO5 C;  3LZ0 C;  3X1T C;  4WZS B;  4J8W A;  1KX3 D;  3KXB B;  5G49 A;  3REL A;  3UTA A;  5GT0 B;  3MGP D;  4J8V C;  4WU8 D;  2JSS A;  2DF4 C;  4NE3 A;  3WKJ D;  4NE6 A;  2HIO A;  3LZ1 D;  3R45 A;  1N1J A;  4YM6 D;  3B6F D;  5GT0 D;  5CPJ B;  4YS3 C;  1ZLA D;  4XUJ A;  2ARO B;  5AV9 B;  3WKJ A;  1P3M A;  2HUE B;  4CSR B;  5GT3 D;  3UT9 C;  4X23 B;  3W98 C;  2ARO D;  4DRA A;  1P3M D;  5B1M A;  4DQY B;  3AZM D;  3MGR B;  4H9O B;  5B0Y D;  3AN2 C;  1PZR A;  3LJA D;  2F2A C;  3X1U D;  1P3P C;  1W2E A;  4UPK A;  2PYO A;  3MGS B;  3AFA C;  3X1V D;  5B32 C;  4J8U C;  5B0Y A;  3FDD A;  2F8N D;  1P34 D;  3AZH A;  1P3B C;  3MVD C;  1P3I A;  2NZD A;  4JJN D;  1BH9 B;  5B1M C;  3AZL C;  5CPJ A;  5F99 B;  4WU8 A;  1WWS A;  4KGC A;  1N1J B;  5B1L C;  3O62 C;  3WAA B;  4XUJ C;  4H9R B;  3TU4 D;  3AZH D;  2DQN C;  2IO5 B;  1AOI D;  4LD9 A;  5AV6 D;  2JE5 A;  3LZ0 B;  3A6N C;  3LJA B;  3WTP D;  1KX5 C;  2FJ7 A;  4J8V A;  5B40 C;  3A1I A;  3KWQ B;  1TAF B;  3LZ0 D;  4J8X D;  4QLC B;  3B6G A;  3KWQ A;  5CP6 C;  3WKJ B;  1P3G A;  5F99 D;  5B24 C;  5AV8 A;  2NQB D;  5AV5 C;  5B31 A;  3H0M C;  3LJA A;  2Y2K A;  3IP4 C;  5AVC D;  2G5H C;  5B0Z C;  2Y2Q A;  3VH6 T;  4XZQ C;  5GT3 A;  2ZY2 A;  5GXQ C;  4KGC B;  2RVQ C;  2G5I C;  4WU8 B;  5B31 D;  3AZE A;  1BH9 A;  4NFT A;  4WNN B;  5CP6 A;  3AN2 A;  4KHA A;  3MGR C;  4J8X B;  2L5A A;  3AN2 B;  1F66 A;  3X1S C;  1M18 C;  3KUY A;  5CPI D;  2FJ7 C;  3AN2 D;  1U35 C;  5AY8 C;  3MNN C;  1Q9C A;  1P3L B;  3AZJ B;  1Z2C B;  1B6W A;  3W97 D;  3B6G C;  1P3F C;  4WJ3 C;  1P34 A;  1A7W A;  1KX4 D;  5GSU D;  4R8P D;  3AZK A;  5B33 D;  5B2I C;  3C1C C;  5AV8 C;  1TAF A;  2CV5 D;  4X23 D;  1KX3 A;  3VH5 A;  5BO0 A;  5AV6 B;  3W99 C;  1ID3 D;  3KWQ C;  3UTA D;  3AZG D;  3AV1 D;  1S32 B;  1P3A B;  2CV5 A;  5DNM C;  2RIQ A;  3AZJ D;  1P3A A;  4WU9 C;  1EQZ C;  1ID3 A;  3AV2 B;  3UTA B;  1M1A D;  5GT0 A;  3C1C D;  3AZH B;  5B2J B;  3AZF D;  3MGS D;  5B0Z A;  3X1V B;  3MVD A;  3H0R C;  1P3I C;  5B0Z B;  2NZD C;  5AVB A;  5DNN C;  3C1C B;  5AV5 D;  3REK B;  2CWE A;  3AZK B;  3AZE B;  4H9P A;  4E45 A;  3REI D;  1T3U A;  5B0Z D;  1M19 D;  2BG1 A;  3AZM A;  3MGQ D;  1KX4 A;  3UTB D;  3MNN A;  3KXB D;  2PYO D;  1M19 A;  5CPK A;  4KUD B;  4UUZ B;  3KFU G;  5B2J D;  3H0L C;  4G92 C;  4X23 A;  3AYW C;  2Y2O A;  3KUY D;  5CPI A;  1BH8 A;  4CSR A;  3UTB A;  1P3O C;  4LD9 C;  3AZN A;  4QLC D;  4WU9 A;  3B6G B;  2Y2P A;  5CPJ D;  4YM6 C;  3REJ C;  2ZM5 A;  4JJN A;  1KX5 A;  5B2J A;  1ZLA C;  3W97 B;  4J8V B;  5AV9 D;  1TZY A;  5GT3 B;  5BS7 C;  3TU4 A;  5E5A B;  3MGP B;  1KX3 C;  5AVC B;  5BNV B;  3LEL C;  4J8V D;  4AWL C;  5B1M B;  2CV5 B;  1S32 A;  5B24 A;  1P3A C;  2FFF B;  5AVB D;  3B6F C;  1F1E A;  4J8X A;  2YFV A;  4DRB A;  5B0Y C;  5GSU B;  4R8P B;  5DNM D;  4KUD A;  1HQ3 C;  3VH5 T;  4ZUX A;  3EPL A;  4WV4 B;  5DNN A;  3X1V C;  1P34 B;  5E5A D;  4Z2M G;  4HGA B;  5DNN B; 
#chains in the Genus database with same CATH homology
 3AZM B;  1F66 C;  1P3M C;  3NQJ B;  3AZF C;  4JJN C;  5B1M D;  3X1S A;  4YM6 A;  3W96 D;  3AZI C;  5G49 B;  5B1L D;  3O62 D;  3REL B;  3AZN D;  5AV5 B;  2J8P A;  3X1U C;  1AOI B;  5AY8 A;  3X1T D;  1P3K D;  5CPK C;  1M19 C;  3WTP B;  5AV9 A;  2ZY4 A;  4KHA B;  4XUJ B;  1P3P A;  1ID3 B;  1P3G C;  5JA4 B;  3C1B A;  3B0C W;  2BYM B;  4J8X C;  3A1K A;  3NQJ A;  3TU4 B;  1TZY B;  3B0C T;  3NQU B;  4M6B A;  1KX5 B;  3KUY C;  4LD9 D;  4Z5T C;  3REL D;  3MGQ B;  2ZY5 A;  4Z66 C;  3W98 D;  3LEL B;  3X1T B;  2YFV B;  5JRG D;  4AWL B;  3REH C;  2PYO B;  2RVQ D;  2JCH A;  3R45 B;  3B6F B;  4CAY A;  4CAY B;  1JFI B;  1P3L A;  4Z5T A;  5BT1 C;  2NQB C;  5GXQ B;  4H9N A;  4KGC C;  1H3O A;  3AZL A;  1HTA A;  3WTP A;  2FJ7 D;  1B67 A;  1U35 D;  4KUD D;  3X1T A;  5DNM B;  4Z2M H;  3WA9 A;  3C1B C;  3W98 B;  1P3M B;  4WU9 B;  5AV5 A;  5B31 C;  3AZL D;  1EQZ B;  3B6G D;  3X1U A;  3MGR D;  2XD5 A;  5B2I D;  4ZBJ B;  1F66 D;  1P3L C;  1R4V A;  2BYM A;  2YFW A;  2UWX A;  5CPI C;  5JA4 A;  3WTP C;  3MGR A;  5AY8 D;  3B0D C;  3KXB A;  5AV8 B;  4YS3 D;  3W99 D;  1ID3 C;  5B32 B;  4J8U B;  3VH5 W;  3W98 A;  3AFA B;  3EPK A;  1KX4 C;  2VQR A;  5CP6 D;  5AVB B;  5B33 C;  2HIO C;  4QLC A;  4WU9 D;  4ZUX C;  3AZL B;  3MVD B;  3AV2 D;  1M1A B;  1EQZ D;  5GXQ A;  4E44 A;  1WWI A;  3WAA C;  4Z5T B;  1TZY D;  2W8S A;  1S32 C;  3EPH A;  3AYW B;  4J8W C;  1P3O B;  3B6F A;  4XZQ D;  3LZ0 A;  2Y2J A;  3UT9 A;  4LD9 B;  3WA9 C;  3A6N B;  3LJA C;  3KWQ D;  3UTA C;  3AV1 C;  3W97 A;  3EPJ A;  5BS7 A;  4Z66 D;  5B40 B;  3AL0 C;  5BO0 B;  5JRG C;  5AV6 A;  2NQB A;  4EO5 C;  1P3I B;  2NZD B;  3F6T A;  3AZN B;  3MGP C;  5C3I C;  1KX3 B;  1BH8 B;  5CP6 B;  3UTB B;  2NQB B;  5FUG A;  2BYK B;  1P3B D;  5DNM A;  3WKJ C;  5B2I A;  1M18 D;  5B24 B;  3KXB C;  3AZK C;  3MGS A;  5GT0 C;  3REK D;  4XUJ D;  3C1B B;  3AZG A;  4XZQ B;  1P3B A;  5B31 B;  1U35 A;  4H9O A;  4R8P C;  5GSU C;  3REI C;  3AZJ A;  5CPJ C;  2F8N G;  5B1L A;  3O62 A;  2ARO C;  3REK A;  1M1A A;  5BNX B;  4WU8 C;  3C1C A;  2Y2N A;  3LZ1 C;  4HGA C;  3AZM C;  1F66 B;  3LEL D;  3X1S B;  2Y2L A;  1KU5 A;  5B32 A;  4J8U A;  2FJ7 B;  1ZLA B;  3AZI A;  3MNN B;  4XZQ A;  5GT3 C;  3UT9 D;  1P3P D;  3AZJ C;  1KX4 B;  5AVB C;  5AVC C;  2HIO B;  5B32 D;  4J8U D;  4ZUX B;  1M1A C;  2F8N A;  1P3F B;  3V9R A;  5B2I B;  4H9P B;  1P3P B;  5FUG B;  1EQZ A;  3VH6 A;  3MGS C;  1P3G B;  3KSY A;  3AV1 A;  4H9S C;  2Y2G A;  3WA9 B;  3TU4 C;  3P5J B;  5B32 G;  1TZY C;  3AV1 B;  1S32 D;  1AOI A;  1P3A D;  5AV6 C;  5JRG A;  4NE5 A;  4J8W D;  1HQ3 B;  4H9N B;  5B1L B;  3O62 B;  4EO5 B;  3MGP A;  3AZN C;  1P34 C;  4Z66 B;  3LZ1 A;  3UTB C;  4H9Q B;  1P3K B;  3MVD D;  3WTP E;  3AZG B;  3REH B;  4JJN B;  2PYO C;  5B2J C;  1ZLA A;  3AYW D;  1P3O D;  1M18 A;  3AZH C;  5F99 A;  1AOI C;  5B24 D;  4QLC C;  3LEL A;  4G91 B;  3A6N D;  3REJ D;  3MGQ A;  3W96 C;  3AZI D;  4WNN A;  2ARO A;  3REK C;  3V9R B;  5BNX A;  3AZF A;  5CPK D;  3A6N A;  3B0B A;  3AZE D;  5E5A A;  1HQ3 A;  3REH D;  5F99 C;  3KUY B;  3W99 A;  1BFM A;  5B31 G;  4G92 B;  2ZY3 A;  3X1S D;  1P3I D;  2NZD D;  3MNN D;  3REJ B;  5CPI B;  5GXQ D;  3AFA A;  4YM6 B;  3AV2 A;  3W97 C;  1M18 B;  1U35 B;  5E5A C;  5B33 A;  2F8N K;  2F8N H;  3C1B D;  5B33 B;  4H9Q A;  4H9R A;  4Z66 A;  2CV5 C;  3WAA A;  2BYK A;  2XD1 A;  1P3L D;  3REJ A;  4J8W B;  1P3K C;  3AZG C;  5CHL B;  1P3F D;  5B0Y B;  2LY8 A;  5B40 A;  2Y2H A;  3NQU A;  5AV8 D;  4YS3 B;  3W99 B;  1P3G D;  4ZBJ C;  1H3O B;  3W96 A;  5AVC A;  2Y2I A;  5BNV A;  5AV9 C;  2HUE C;  4G91 C;  3UT9 B;  1P3F A;  1JFI A;  3EG5 B;  4X23 C;  3AYW A;  5C3I B;  1P3O A;  2F8N B;  3W96 B;  2HIO D;  4ZUX D;  3B0D B;  3AV2 C;  3AZF B;  4Z5T D;  3REL C;  5DNN D;  5AY8 B;  3AZI B;  3X1U B;  1ULY A;  5KDM B;  3REI A;  3AFA D;  3WA9 D;  5CPK B;  5KDM A;  4UUZ A;  3REI B;  3VH6 W;  1M19 B;  2Y2M A;  3AZE C;  1HQ3 D;  3REH A;  2YFW B;  1P3K A;  4H9S A;  3LZ1 B;  5BT1 D;  3WAA D;  4KGC D;  1P3B B;  5GSU A;  4R8P A;  3AZK D;  4KUD C;  5JRG B;  4YS3 A;  1KX5 D;  3MGQ C;  5B40 D;  3X1V A;  2IO5 C;  3LZ0 C;  3X1T C;  4WZS B;  4J8W A;  1KX3 D;  3KXB B;  5G49 A;  3REL A;  3UTA A;  5GT0 B;  3MGP D;  4J8V C;  4WU8 D;  2JSS A;  2DF4 C;  4NE3 A;  3WKJ D;  4NE6 A;  2HIO A;  3LZ1 D;  3R45 A;  1N1J A;  4YM6 D;  3B6F D;  5GT0 D;  5CPJ B;  4YS3 C;  1ZLA D;  4XUJ A;  2ARO B;  5AV9 B;  3WKJ A;  1P3M A;  2HUE B;  4CSR B;  5GT3 D;  3UT9 C;  4X23 B;  3W98 C;  2ARO D;  4DRA A;  1P3M D;  5B1M A;  4DQY B;  3AZM D;  3MGR B;  4H9O B;  5B0Y D;  3AN2 C;  1PZR A;  3LJA D;  2F2A C;  3X1U D;  1P3P C;  1W2E A;  4UPK A;  2PYO A;  3MGS B;  3AFA C;  3X1V D;  5B32 C;  4J8U C;  5B0Y A;  3FDD A;  2F8N D;  1P34 D;  3AZH A;  1P3B C;  3MVD C;  1P3I A;  2NZD A;  4JJN D;  1BH9 B;  5B1M C;  3AZL C;  5CPJ A;  5F99 B;  4WU8 A;  1WWS A;  4KGC A;  1N1J B;  5B1L C;  3O62 C;  3WAA B;  4XUJ C;  4H9R B;  3TU4 D;  3AZH D;  2DQN C;  2IO5 B;  1AOI D;  4LD9 A;  5AV6 D;  2JE5 A;  3LZ0 B;  3A6N C;  3LJA B;  3WTP D;  1KX5 C;  2FJ7 A;  4J8V A;  5B40 C;  3A1I A;  3KWQ B;  1TAF B;  3LZ0 D;  4J8X D;  4QLC B;  3B6G A;  3KWQ A;  5CP6 C;  3WKJ B;  1P3G A;  5F99 D;  5B24 C;  5AV8 A;  2NQB D;  5AV5 C;  5B31 A;  3H0M C;  3LJA A;  2Y2K A;  3IP4 C;  5AVC D;  2G5H C;  5B0Z C;  2Y2Q A;  3VH6 T;  4XZQ C;  5GT3 A;  2ZY2 A;  5GXQ C;  4KGC B;  2RVQ C;  2G5I C;  4WU8 B;  5B31 D;  3AZE A;  1BH9 A;  4NFT A;  4WNN B;  5CP6 A;  3AN2 A;  4KHA A;  3MGR C;  4J8X B;  2L5A A;  3AN2 B;  1F66 A;  3X1S C;  1M18 C;  3KUY A;  5CPI D;  2FJ7 C;  3AN2 D;  1U35 C;  5AY8 C;  3MNN C;  1Q9C A;  1P3L B;  3AZJ B;  1Z2C B;  1B6W A;  3W97 D;  3B6G C;  1P3F C;  4WJ3 C;  1P34 A;  1A7W A;  1KX4 D;  5GSU D;  4R8P D;  3AZK A;  5B33 D;  5B2I C;  3C1C C;  5AV8 C;  1TAF A;  2CV5 D;  4X23 D;  1KX3 A;  3VH5 A;  5BO0 A;  5AV6 B;  3W99 C;  1ID3 D;  3KWQ C;  3UTA D;  3AZG D;  3AV1 D;  1S32 B;  1P3A B;  2CV5 A;  5DNM C;  2RIQ A;  3AZJ D;  1P3A A;  4WU9 C;  1EQZ C;  1ID3 A;  3AV2 B;  3UTA B;  1M1A D;  5GT0 A;  3C1C D;  3AZH B;  5B2J B;  3AZF D;  3MGS D;  5B0Z A;  3X1V B;  3MVD A;  3H0R C;  1P3I C;  5B0Z B;  2NZD C;  5AVB A;  5DNN C;  3C1C B;  5AV5 D;  3REK B;  2CWE A;  3AZK B;  3AZE B;  4H9P A;  4E45 A;  3REI D;  1T3U A;  5B0Z D;  1M19 D;  2BG1 A;  3AZM A;  3MGQ D;  1KX4 A;  3UTB D;  3MNN A;  3KXB D;  2PYO D;  1M19 A;  5CPK A;  4KUD B;  4UUZ B;  3KFU G;  5B2J D;  3H0L C;  4G92 C;  4X23 A;  3AYW C;  2Y2O A;  3KUY D;  5CPI A;  1BH8 A;  4CSR A;  3UTB A;  1P3O C;  4LD9 C;  3AZN A;  4QLC D;  4WU9 A;  3B6G B;  2Y2P A;  5CPJ D;  4YM6 C;  3REJ C;  2ZM5 A;  4JJN A;  1KX5 A;  5B2J A;  1ZLA C;  3W97 B;  4J8V B;  5AV9 D;  1TZY A;  5GT3 B;  5BS7 C;  3TU4 A;  5E5A B;  3MGP B;  1KX3 C;  5AVC B;  5BNV B;  3LEL C;  4J8V D;  4AWL C;  5B1M B;  2CV5 B;  1S32 A;  5B24 A;  1P3A C;  2FFF B;  5AVB D;  3B6F C;  1F1E A;  4J8X A;  2YFV A;  4DRB A;  5B0Y C;  5GSU B;  4R8P B;  5DNM D;  4KUD A;  1HQ3 C;  3VH5 T;  4ZUX A;  3EPL A;  4WV4 B;  5DNN A;  3X1V C;  1P34 B;  5E5A D;  4Z2M G;  4HGA B;  5DNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...