4H9PA

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9pA00
3AFAD 5GSUD 3B6GA 3X1VC 1P34A 1N1JA 3X1VB 3LZ0C 1S32D 3LZ0B 4QLCC 3AV1C 3MNND 1ID3A 5AV8C 3AV1B 3UT9D 1H3OA 1P3LC 5B1MD 3AZKD 5AV8B 4H9OA 3AZFA 1P3LB 3UTBC 4Z66C 3AV2D 4H9QA 4KHAB 3UTBB 4Z66B 4ZUXA 5C3IC 5B32D 5BS7C 3X1SD 5C3IB 3B6FD 3AZJA 4J8WD 1M19A 3AZLD 3LJAC 5DNND 4X23C 1M1AD 3LJAB 4X23B 1KX5D 3AZED 5B0ZA 1M18D 3AZHC 5AVBC 3W99C 5AV5C 4LD9C 1P3GA 3AZHB 1KX3A 1KX4A 5AVBB 5AV5B 3W99B 4CAYA 4E45A 3AZNA 3W97A 1ZLAA 1P3OD 3WA9A 5GT0D 2PYOD 3WTPD 1EQZA 5BO0A 2YFVA 3A6NC 3NQJB 4Z2MG 5CP6A 1F66D 3X1TC 4XUJC 1F1EA 3B0DC 3X1TB 4KUDD 4J8VC 5JA4A 4XUJB 3B0DB 4J8XD 4J8VB 2FJ7D 4WU8C 5B40D 2CV5C 1ULYA 3W96A 5AV6C 5AY8D 3VH5T 1P3FC 2CV5B 5AV6B 1P3FB 5CPJC 4NE5A 3O62B 5CPJB 3AV1A 3C1CB 5AV8A 1P3LA 1P3AC 4KHAA 3TU4C 1P3PD 3UTBA 4Z66A 3TU4B 3X1UC 3WTPE 3X1UB 5BS7A 5AVCD 2IO5C 2IO5B 5CPID 1KU5A 4X23A 3REHD 1TZYA 4YM6D 3REKD 4G92C 2HIOD 3AZHA 4G92B 1B67A 5AVBA 5AV9C 3KXBA 1P3IC 4JJNC 3W99A 4KGCD 5AV9B 1P3IB 4JJNB 5KDMB 5DNMC 3VH5W 2NQBD 3NQUA 5GXQD 1P3BC 5DNMB 3KUYD 1HQ3D 5BNVB 3RELC 3NQJA 3RELB 4Z5TC 2YFWB 3LELA 4Z5TB 5B33C 3X1TA 5B33B 3WAAD 1P3KC 4H9NB 1P3KB 5AV6A 1P3FA 3W98D 3MGSC 3O62A 5CPJA 1HTAA 3MGSB 3C1CA 1AOID 1P34D 4YS3A 3AFAC 2L5AA 3AFAB 1U35C 5G49B 5GSUC 3X1UA 1U35B 5GSUB 3AZFD 1S32C 4ZUXD 1S32B 3MNNC 3AYWD 4HGAC 3MNNB 4M6BA 3REIC 4HGAB 3KWQD 3VH6T 3AZJD 3AV2C 3REIB 1M19D 5AV9A 3AV2B 5E5AA 5JRGC 3MGRC 4QLCB 1P3MC 3B6FC 5JRGB 3MGRB 3REJA 1P3MB 3B6FB 1P3GD 1WWIA 4J8WC 1KX3D 5BNVA 1KX4D 5DNNC 3AZND 4J8WB 4E44A 3W97D 3RELA 5CPKD 5DNNB 4WU9C 3AZEC 2YFWA 1KX5C 1EQZD 1M18C 4WU9B 4Z5TA 3AZEB 1KX5B 4WNNB 1M18B 5BT1C 5B33A 3WKJC 3WKJB 1P3OC 3AZGC 2PYOC 5CP6D 1P3OB 3WTPC 3AZGB 4H9NA 1P3KA 2PYOB 3WTPB 5B2IA 4H9RB 5GT3A 4G91C 5B1LD 3MGSA 4G91B 5BNXB 4LD9B 3VH6W 3W96D 1F66C 3AFAA 1F66B 2JSSA 4ZBJC 5G49A 4NFTA 4J8XC 3UTAD 4ZBJB 3AV1D 1U35A 2F8NH 4J8UC 2FJ7C 4J8XB 3R45B 4J8UB 5B40C 2FJ7B 3A6NB 5B40B 4Z66D 5B0YD 3AZID 2AROC 2AROB 1JFIB 3MNNA 2F8NB 2NZDD 3REIA 3X1VA 1P3PC 4WU8B 3AV2A 3B0CT 1P3PB 1Q9CA 1TZYD 5B2JD 3LZ0A 3MVDD 2CWEA 4QLCA 5JRGA 3MGRA 1P3MA 3B6FA 5AVCC 3AZHD 3V9RB 3W99D 5AVBD 5AVCB 3KXBD 5CPIC 4J8WA 2LY8A 1P3AB 5DNNA 3REHC 5CPIB 4YM6C 3REHB 3REKC 4WU9A 4YM6B 4WNNA 2HIOC 1M18A 3REKB 2HIOB 3WKJA 4KGCC 3C1BC 4KGCB 3LJAA 3AZGA 2NQBC 3C1BB 2PYOA 4NE6A 3AN2D 2NQBB 3LELD 3X1TD 3MGQC 5F99D 3KUYC 3MGQB 1HQ3C 3KUYB 3AZMD 5AV5A 4LD9A 1HQ3B 2RVQD 3KSYA 1TAFB 3MGPD 5AV6D 1P3FD 2BYKB 4EO5C 3O62D 1P3BB 4EO5B 3C1CD 3WAAC 4J8XA 4XZQD 3R45A 4J8UA 4R8PD 2FJ7A 4YS3D 3A6NA 5B40A 5B24D 3W98C 3LZ1D 3W98B 2AROA 1JFIA 4XUJA 1AOIC 4J8VA 1AOIB 2F8NA 5B31C 4WU8A 5B31B 2CV5A 3B6GD 1H3OB 4H9SC 1A7WA 3V9RA 1P3AA 3TU4A 5E5AD 3REHA 3AYWC 1ID3D 3AYWB 3REJD 3REKA 3KWQC 3AZJC 1BH9B 2HIOA 1M19C 3KWQB 3AZJB 3RELD 1M19B 4KGCA 3C1BA 2BYMB 3UT9C 4Z5TD 5B1MC 3AZKC 3UT9B 5B33D 3MGQA 5B1MB 3AZKB 1HQ3A 3W97C 5CPKC 1P3IA 1TAFA 4JJNA 3W97B 5KDMA 5B32C 5CPKB 3X1SC 1P3KD 3VH5A 5B2ID 4NE3A 2BYKA 5B32B 5DNMA 5B0ZD 3X1SB 5GT3D 1P3BA 3MGSD 3AZLC 1M1AC 1ZLAD 4UUZB 5CP6C 3AZLB 1M1AB 3WA9D 5CP6B 4DRAA 3W98A 1BH8B 5B1LC 1U35D 5FUGB 5JA4B 5B1LB 1AOIA 3W96C 5GT0C 3W96B 2HUEC 5B31A 5GT0B 2HUEB 4WV4B 3UTAC 3UTAB 3REID 3X1VD 3B0BA 4H9SA 5B0YC 3AZIC 3LZ0D 5B0YB 3AZIB 4KUDC 4QLCD 2F8NG 3AYWA 5JRGD 3MGRD 5GSUA 1P3MD 4KUDB 5AV8D 2NZDC 1BH9A 1P3LD 2NZDB 3KWQA 5AY8C 3UTBD 1S32A 1TZYC 5B2JC 5AY8B 3MVDC 1TZYB 5B2JB 2BYMA 3MVDB 4WU9D 3UT9A 1BFMA 5B1MA 3AZKA 3KXBC 5BT1D 3WKJD 3KXBB 3LJAD 4X23D 3AZGD 5CPKA 5B32A 3NQUB 3X1SA 5AV5D 4LD9D 4UUZA 4Z2MH 3AZLA 1M1AA 3AN2C 3LELC 5F99C 3AN2B 3AZEA 1BH8A 1KX5A 3LELB 5FUGA 5F99B 3AZMC 5B1LA 2RVQC 4CSRB 4J8UD 3AZMB 3A6ND 3MGPC 1P3OA 5GXQC 3MGPB 5GT0A 3WTPA 5GXQB 3O62C 2AROD 4H9RA 3C1CC 4XUJD 3UTAA 4J8VD 4XZQC 5BNXA 4R8PC 2F8ND 4YS3C 4XZQB 4R8PB 3VH6A 4WU8D 4YS3B 5B24C 5CHLB 2CV5D 3B0CW 5B0YA 5B24B 3LZ1C 3AZIA 1F66A 1B6WA 5CPJD 3LZ1B 4H9PB 4KUDA 5B31G 3WAAB 2NZDA 1P3AD 5AY8A 3TU4D 5B2JA 3X1UD 3B6GC 3MVDA 3B6GB 1P34C 1P34B 1N1JB 1P3PA 5E5AC 4AWLC 3C1BD 5E5AB 4AWLB 1ID3C 3REJC 1ID3B 3REJB 3MGQD 3AZFC 4H9OB 3AZFB 5AVCA 5AV9D 4ZUXC 4H9QB 1P3ID 4JJND 5CPIA 4ZUXB 2F8NK 5DNMD 3AN2A 4YM6A 1P3BD 5F99A 4CSRA 3AZMA 5B32G 5B2IC 4WZSB 3MGPA 5B0ZC 2NQBA 5GXQA 5B2IB 5GT3C 5B0ZB 1R4VA 1P3GC 5GT3B 1KX3C 1KX4C 3KUYA 1P3GB 3AZNC 1KX3B 4DRBA 1KX4B 4XZQA 1ZLAC 4R8PA 3WA9C 4CAYB 3AZNB 1ZLAB 5B31D 3WA9B 5B24A 1WWSA 1EQZC 3LZ1A 1EQZB 5BO0B 4H9PA 2YFVB 3WAAA
chains in the Genus database with same CATH superfamily
3AFAD 5GSUD 3B6GA 2FFFB 2ZY4A 3X1VC 1P34A 3F6TA 1N1JA 3X1VB 3LZ0C 1S32D 3LZ0B 4QLCC 3AV1C 3MNND 1ID3A 5AV8C 3AV1B 3UT9D 1H3OA 1P3LC 5B1MD 3AZKD 2JE5A 5AV8B 4H9OA 3AZFA 1P3LB 3UTBC 4Z66C 3AV2D 4H9QA 4KHAB 3EG5B 3UTBB 4Z66B 4ZUXA 5C3IC 5B32D 5BS7C 3X1SD 5C3IB 3B6FD 2DQNC 3AZJA 4J8WD 1M19A 3AZLD 3LJAC 5DNND 4X23C 1M1AD 3LJAB 4X23B 2Y2MA 1KX5D 3AZED 5B0ZA 4WJ3C 1M18D 3AZHC 5AVBC 3W99C 5AV5C 4LD9C 1P3GA 3AZHB 2Y2QA 1KX3A 5AVBB 5AV5B 1KX4A 3W99B 4CAYA 4E45A 3AZNA 3W97A 1ZLAA 1P3OD 3WA9A 5GT0D 2PYOD 3WTPD 1EQZA 5BO0A 2YFVA 3A6NC 3NQJB 4Z2MG 2Y2JA 5CP6A 1F66D 3X1TC 4XUJC 1F1EA 3B0DC 3X1TB 4KUDD 4J8VC 5JA4A 4XUJB 3B0DB 4J8XD 4J8VB 2Y2HA 2FJ7D 4WU8C 5B40D 2CV5C 1ULYA 3W96A 5AV6C 5AY8D 3VH5T 1P3FC 2CV5B 5AV6B 1P3FB 5CPJC 4NE5A 3O62B 5CPJB 3AV1A 3C1CB 5AV8A 1P3LA 1P3AC 4KHAA 3TU4C 1P3PD 2DF4C 4Z66A 3UTBA 3TU4B 3X1UC 3WTPE 3X1UB 5BS7A 5AVCD 2IO5C 2IO5B 5CPID 1KU5A 4X23A 3REHD 1TZYA 4YM6D 3REKD 4G92C 2HIOD 3AZHA 4G92B 1B67A 5AVBA 5AV9C 3KXBA 1P3IC 4JJNC 3W99A 4KGCD 5AV9B 1P3IB 4JJNB 2Y2PA 5KDMB 5DNMC 3VH5W 2NQBD 3NQUA 5GXQD 1P3BC 5DNMB 3KUYD 1HQ3D 5BNVB 3RELC 3NQJA 3RELB 4Z5TC 2YFWB 3LELA 4Z5TB 5B33C 3X1TA 5B33B 3WAAD 1P3KC 4H9NB 1P3KB 5AV6A 1P3FA 3W98D 3MGSC 3O62A 5CPJA 1HTAA 3MGSB 3C1CA 1AOID 1P34D 4YS3A 3AFAC 2L5AA 3AFAB 1U35C 5G49B 5GSUC 3X1UA 1U35B 5GSUB 3AZFD 1S32C 4ZUXD 1S32B 3MNNC 3AYWD 4HGAC 3MNNB 4M6BA 3REIC 4HGAB 3KWQD 3VH6T 3AZJD 3AV2C 3REIB 1M19D 5AV9A 3AV2B 5E5AA 5JRGC 3MGRC 4QLCB 1P3MC 3B6FC 5JRGB 3MGRB 3REJA 1P3MB 3B6FB 1P3GD 1WWIA 4J8WC 1KX3D 5BNVA 1KX4D 5DNNC 3AZND 4J8WB 4E44A 3W97D 3RELA 5CPKD 5DNNB 4WU9C 3AZEC 2YFWA 3EPKA 1KX5C 1EQZD 1M18C 4WU9B 4Z5TA 3AZEB 1KX5B 4WNNB 1M18B 4DQYB 5BT1C 5B33A 3WKJC 3WKJB 1P3OC 3AZGC 2PYOC 5CP6D 1P3OB 3WTPC 3AZGB 4H9NA 1P3KA 2PYOB 3WTPB 5B2IA 4H9RB 5GT3A 4G91C 5B1LD 3MGSA 3H0LC 4G91B 5BNXB 4LD9B 2Y2KA 2VQRA 3VH6W 3W96D 3EPHA 1F66C 3AFAA 1F66B 2JSSA 4ZBJC 5G49A 4NFTA 4J8XC 3UTAD 4ZBJB 3AV1D 1U35A 2F8NH 4J8UC 2FJ7C 4J8XB 3R45B 4J8UB 5B40C 2FJ7B 3A6NB 5B40B 3A1IA 4Z66D 5B0YD 2F2AC 3AZID 2AROC 2AROB 1JFIB 3MNNA 2Y2OA 2F8NB 2NZDD 3REIA 3X1VA 1P3PC 4WU8B 3AV2A 3B0CT 1P3PB 1Q9CA 1TZYD 5B2JD 3LZ0A 3MVDD 2CWEA 4QLCA 5JRGA 3MGRA 1P3MA 3B6FA 2G5IC 5AVCC 3AZHD 3V9RB 3W99D 5AVBD 5AVCB 3KXBD 2RIQA 5CPIC 4J8WA 2LY8A 1P3AB 5DNNA 3REHC 5CPIB 4YM6C 3REHB 3REKC 4WU9A 4YM6B 4WNNA 2HIOC 1M18A 3REKB 2HIOB 2J8PA 3WKJA 4KGCC 3C1BC 4KGCB 3LJAA 3AZGA 2NQBC 3C1BB 2PYOA 4NE6A 3AN2D 2NQBB 3LELD 3X1TD 3MGQC 5F99D 3KUYC 2BG1A 3MGQB 1HQ3C 3KUYB 3AZMD 5AV5A 4LD9A 1HQ3B 2RVQD 3KSYA 1TAFB 2ZY2A 3MGPD 5AV6D 1P3FD 2BYKB 4EO5C 1PZRA 3O62D 1P3BB 4EO5B 3C1CD 3WAAC 4J8XA 4XZQD 3R45A 4J8UA 4R8PD 2FJ7A 4YS3D 3A6NA 5B40A 5B24D 3W98C 3LZ1D 3W98B 2AROA 1JFIA 4XUJA 1AOIC 4J8VA 1AOIB 2F8NA 5B31C 4WU8A 5B31B 2CV5A 3B6GD 1H3OB 4H9SC 1A7WA 3V9RA 3H0RC 1P3AA 3P5JB 3TU4A 5E5AD 3REHA 3AYWC 1ID3D 3AYWB 3REJD 3REKA 3KWQC 3AZJC 1BH9B 2HIOA 1M19C 3KWQB 3AZJB 3RELD 1M19B 4KGCA 3C1BA 2BYMB 3UT9C 4Z5TD 5B1MC 3AZKC 3UT9B 5B33D 3MGQA 5B1MB 3AZKB 1HQ3A 3W97C 5CPKC 1P3IA 1TAFA 4JJNA 3W97B 5KDMA 5B32C 5CPKB 3X1SC 1P3KD 3VH5A 5B2ID 4NE3A 2BYKA 5B32B 5DNMA 5B0ZD 3X1SB 5GT3D 1P3BA 3MGSD 3AZLC 1M1AC 1ZLAD 4UUZB 5CP6C 3AZLB 1M1AB 3WA9D 5CP6B 4DRAA 3W98A 1BH8B 5B1LC 1U35D 2XD1A 4UPKA 5FUGB 3EPJA 5JA4B 5B1LB 1AOIA 3W96C 5GT0C 3W96B 2HUEC 5B31A 5GT0B 2HUEB 1T3UA 4WV4B 3UTAC 3UTAB 3REID 3X1VD 2ZM5A 3B0BA 4H9SA 5B0YC 3AZIC 2XD5A 3LZ0D 5B0YB 3AZIB 4KUDC 4QLCD 2F8NG 3AYWA 5JRGD 3MGRD 5GSUA 1P3MD 4KUDB 5AV8D 3AL0C 2NZDC 1BH9A 1P3LD 2NZDB 3KWQA 5AY8C 3UTBD 1S32A 1TZYC 5B2JC 5AY8B 3MVDC 1TZYB 5B2JB 2BYMA 3MVDB 4WU9D 3UT9A 1BFMA 5B1MA 3AZKA 3KXBC 5BT1D 3WKJD 3EPLA 3KXBB 3LJAD 4X23D 3AZGD 5CPKA 5B32A 3NQUB 3X1SA 2W8SA 5AV5D 4LD9D 4UUZA 4Z2MH 3AZLA 1M1AA 3AN2C 3LELC 5F99C 3AN2B 3AZEA 1BH8A 1KX5A 2Y2NA 3H0MC 3LELB 5FUGA 5F99B 3AZMC 5B1LA 2RVQC 4CSRB 4J8UD 3AZMB 3A6ND 3MGPC 3A1KA 1P3OA 5GXQC 3MGPB 5GT0A 3WTPA 5GXQB 3O62C 2AROD 4H9RA 3C1CC 4XUJD 3UTAA 4J8VD 4XZQC 5BNXA 4R8PC 2F8ND 4YS3C 4XZQB 4R8PB 3VH6A 4WU8D 4YS3B 2ZY5A 5CHLB 5B24C 2CV5D 3B0CW 5B0YA 5B24B 2JCHA 2Y2LA 3LZ1C 3AZIA 1F66A 1B6WA 5CPJD 3LZ1B 4H9PB 4KUDA 1Z2CB 5B31G 3WAAB 2NZDA 1P3AD 5AY8A 3TU4D 5B2JA 3X1UD 3B6GC 3MVDA 2UWXA 3B6GB 1P34C 2Y2IA 1P34B 1N1JB 1P3PA 5E5AC 4AWLC 3C1BD 5E5AB 4AWLB 1ID3C 3REJC 1ID3B 1W2EA 3REJB 3MGQD 3AZFC 4H9OB 3AZFB 5AVCA 5AV9D 4ZUXC 4H9QB 1P3ID 4JJND 5CPIA 4ZUXB 2F8NK 5DNMD 3AN2A 4YM6A 1P3BD 5F99A 3KFUG 4CSRA 3AZMA 5B32G 3FDDA 5B2IC 4WZSB 3MGPA 5B0ZC 2NQBA 5GXQA 5B2IB 5GT3C 2Y2GA 5B0ZB 1R4VA 1P3GC 5GT3B 1KX3C 1KX4C 3KUYA 1P3GB 3AZNC 1KX3B 4DRBA 1KX4B 4XZQA 1ZLAC 4R8PA 3WA9C 4CAYB 3AZNB 1ZLAB 5B31D 3WA9B 5B24A 1WWSA 1EQZC 3LZ1A 1EQZB 5BO0B 3IP4C 4H9PA 2YFVB 2G5HC 3WAAA 2ZY3A
chains in the Genus database with same CATH topology
3AFAD 5GSUD 3B6GA 2FFFB 2ZY4A 3X1VC 1P34A 3F6TA 1N1JA 3X1VB 3LZ0C 1S32D 3LZ0B 4QLCC 3AV1C 3MNND 1ID3A 5AV8C 3AV1B 3UT9D 1H3OA 1P3LC 5B1MD 3AZKD 2JE5A 5AV8B 4H9OA 3AZFA 1P3LB 3UTBC 4Z66C 3AV2D 4H9QA 4KHAB 3EG5B 3UTBB 4Z66B 4ZUXA 5C3IC 5B32D 5BS7C 3X1SD 5C3IB 3B6FD 2DQNC 3AZJA 4J8WD 1M19A 3AZLD 3LJAC 5DNND 4X23C 1M1AD 3LJAB 4X23B 2Y2MA 1KX5D 3AZED 5B0ZA 4WJ3C 1M18D 3AZHC 5AVBC 3W99C 5AV5C 4LD9C 1P3GA 3AZHB 2Y2QA 1KX3A 5AVBB 5AV5B 1KX4A 3W99B 4CAYA 4E45A 3AZNA 3W97A 1ZLAA 1P3OD 3WA9A 5GT0D 2PYOD 3WTPD 1EQZA 5BO0A 2YFVA 3A6NC 3NQJB 4Z2MG 2Y2JA 5CP6A 1F66D 3X1TC 4XUJC 1F1EA 3B0DC 3X1TB 4KUDD 4J8VC 5JA4A 4XUJB 3B0DB 4J8XD 4J8VB 2Y2HA 2FJ7D 4WU8C 5B40D 2CV5C 1ULYA 3W96A 5AV6C 5AY8D 3VH5T 1P3FC 2CV5B 5AV6B 1P3FB 5CPJC 4NE5A 3O62B 5CPJB 3AV1A 3C1CB 5AV8A 1P3LA 1P3AC 4KHAA 3TU4C 1P3PD 2DF4C 4Z66A 3UTBA 3TU4B 3X1UC 3WTPE 3X1UB 5BS7A 5AVCD 2IO5C 2IO5B 5CPID 1KU5A 4X23A 3REHD 1TZYA 4YM6D 3REKD 4G92C 2HIOD 3AZHA 4G92B 1B67A 5AVBA 5AV9C 3KXBA 1P3IC 4JJNC 3W99A 4KGCD 5AV9B 1P3IB 4JJNB 2Y2PA 5KDMB 5DNMC 3VH5W 2NQBD 3NQUA 5GXQD 1P3BC 5DNMB 3KUYD 1HQ3D 5BNVB 3RELC 3NQJA 3RELB 4Z5TC 2YFWB 3LELA 4Z5TB 5B33C 3X1TA 5B33B 3WAAD 1P3KC 4H9NB 1P3KB 5AV6A 1P3FA 3W98D 3MGSC 3O62A 5CPJA 1HTAA 3MGSB 3C1CA 1AOID 1P34D 4YS3A 3AFAC 2L5AA 3AFAB 1U35C 5G49B 5GSUC 3X1UA 1U35B 5GSUB 3AZFD 1S32C 4ZUXD 1S32B 3MNNC 3AYWD 4HGAC 3MNNB 4M6BA 3REIC 4HGAB 3KWQD 3VH6T 3AZJD 3AV2C 3REIB 1M19D 5AV9A 3AV2B 5E5AA 5JRGC 3MGRC 4QLCB 1P3MC 3B6FC 5JRGB 3MGRB 3REJA 1P3MB 3B6FB 1P3GD 1WWIA 4J8WC 1KX3D 5BNVA 1KX4D 5DNNC 3AZND 4J8WB 4E44A 3W97D 3RELA 5CPKD 5DNNB 4WU9C 3AZEC 2YFWA 3EPKA 1KX5C 1EQZD 1M18C 4WU9B 4Z5TA 3AZEB 1KX5B 4WNNB 1M18B 4DQYB 5BT1C 5B33A 3WKJC 3WKJB 1P3OC 3AZGC 2PYOC 5CP6D 1P3OB 3WTPC 3AZGB 4H9NA 1P3KA 2PYOB 3WTPB 5B2IA 4H9RB 5GT3A 4G91C 5B1LD 3MGSA 3H0LC 4G91B 5BNXB 4LD9B 2Y2KA 2VQRA 3VH6W 3W96D 3EPHA 1F66C 3AFAA 1F66B 2JSSA 4ZBJC 5G49A 4NFTA 4J8XC 3UTAD 4ZBJB 3AV1D 1U35A 2F8NH 4J8UC 2FJ7C 4J8XB 3R45B 4J8UB 5B40C 2FJ7B 3A6NB 5B40B 3A1IA 4Z66D 5B0YD 2F2AC 3AZID 2AROC 2AROB 1JFIB 3MNNA 2Y2OA 2F8NB 2NZDD 3REIA 3X1VA 1P3PC 4WU8B 3AV2A 3B0CT 1P3PB 1Q9CA 1TZYD 5B2JD 3LZ0A 3MVDD 2CWEA 4QLCA 5JRGA 3MGRA 1P3MA 3B6FA 2G5IC 5AVCC 3AZHD 3V9RB 3W99D 5AVBD 5AVCB 3KXBD 2RIQA 5CPIC 4J8WA 2LY8A 1P3AB 5DNNA 3REHC 5CPIB 4YM6C 3REHB 3REKC 4WU9A 4YM6B 4WNNA 2HIOC 1M18A 3REKB 2HIOB 2J8PA 3WKJA 4KGCC 3C1BC 4KGCB 3LJAA 3AZGA 2NQBC 3C1BB 2PYOA 4NE6A 3AN2D 2NQBB 3LELD 3X1TD 3MGQC 5F99D 3KUYC 2BG1A 3MGQB 1HQ3C 3KUYB 3AZMD 5AV5A 4LD9A 1HQ3B 2RVQD 3KSYA 1TAFB 2ZY2A 3MGPD 5AV6D 1P3FD 2BYKB 4EO5C 1PZRA 3O62D 1P3BB 4EO5B 3C1CD 3WAAC 4J8XA 4XZQD 3R45A 4J8UA 4R8PD 2FJ7A 4YS3D 3A6NA 5B40A 5B24D 3W98C 3LZ1D 3W98B 2AROA 1JFIA 4XUJA 1AOIC 4J8VA 1AOIB 2F8NA 5B31C 4WU8A 5B31B 2CV5A 3B6GD 1H3OB 4H9SC 1A7WA 3V9RA 3H0RC 1P3AA 3P5JB 3TU4A 5E5AD 3REHA 3AYWC 1ID3D 3AYWB 3REJD 3REKA 3KWQC 3AZJC 1BH9B 2HIOA 1M19C 3KWQB 3AZJB 3RELD 1M19B 4KGCA 3C1BA 2BYMB 3UT9C 4Z5TD 5B1MC 3AZKC 3UT9B 5B33D 3MGQA 5B1MB 3AZKB 1HQ3A 3W97C 5CPKC 1P3IA 1TAFA 4JJNA 3W97B 5KDMA 5B32C 5CPKB 3X1SC 1P3KD 3VH5A 5B2ID 4NE3A 2BYKA 5B32B 5DNMA 5B0ZD 3X1SB 5GT3D 1P3BA 3MGSD 3AZLC 1M1AC 1ZLAD 4UUZB 5CP6C 3AZLB 1M1AB 3WA9D 5CP6B 4DRAA 3W98A 1BH8B 5B1LC 1U35D 2XD1A 4UPKA 5FUGB 3EPJA 5JA4B 5B1LB 1AOIA 3W96C 5GT0C 3W96B 2HUEC 5B31A 5GT0B 2HUEB 1T3UA 4WV4B 3UTAC 3UTAB 3REID 3X1VD 2ZM5A 3B0BA 4H9SA 5B0YC 3AZIC 2XD5A 3LZ0D 5B0YB 3AZIB 4KUDC 4QLCD 2F8NG 3AYWA 5JRGD 3MGRD 5GSUA 1P3MD 4KUDB 5AV8D 3AL0C 2NZDC 1BH9A 1P3LD 2NZDB 3KWQA 5AY8C 3UTBD 1S32A 1TZYC 5B2JC 5AY8B 3MVDC 1TZYB 5B2JB 2BYMA 3MVDB 4WU9D 3UT9A 1BFMA 5B1MA 3AZKA 3KXBC 5BT1D 3WKJD 3EPLA 3KXBB 3LJAD 4X23D 3AZGD 5CPKA 5B32A 3NQUB 3X1SA 2W8SA 5AV5D 4LD9D 4UUZA 4Z2MH 3AZLA 1M1AA 3AN2C 3LELC 5F99C 3AN2B 3AZEA 1BH8A 1KX5A 2Y2NA 3H0MC 3LELB 5FUGA 5F99B 3AZMC 5B1LA 2RVQC 4CSRB 4J8UD 3AZMB 3A6ND 3MGPC 3A1KA 1P3OA 5GXQC 3MGPB 5GT0A 3WTPA 5GXQB 3O62C 2AROD 4H9RA 3C1CC 4XUJD 3UTAA 4J8VD 4XZQC 5BNXA 4R8PC 2F8ND 4YS3C 4XZQB 4R8PB 3VH6A 4WU8D 4YS3B 2ZY5A 5CHLB 5B24C 2CV5D 3B0CW 5B0YA 5B24B 2JCHA 2Y2LA 3LZ1C 3AZIA 1F66A 1B6WA 5CPJD 3LZ1B 4H9PB 4KUDA 1Z2CB 5B31G 3WAAB 2NZDA 1P3AD 5AY8A 3TU4D 5B2JA 3X1UD 3B6GC 3MVDA 2UWXA 3B6GB 1P34C 2Y2IA 1P34B 1N1JB 1P3PA 5E5AC 4AWLC 3C1BD 5E5AB 4AWLB 1ID3C 3REJC 1ID3B 1W2EA 3REJB 3MGQD 3AZFC 4H9OB 3AZFB 5AVCA 5AV9D 4ZUXC 4H9QB 1P3ID 4JJND 5CPIA 4ZUXB 2F8NK 5DNMD 3AN2A 4YM6A 1P3BD 5F99A 3KFUG 4CSRA 3AZMA 5B32G 3FDDA 5B2IC 4WZSB 3MGPA 5B0ZC 2NQBA 5GXQA 5B2IB 5GT3C 2Y2GA 5B0ZB 1R4VA 1P3GC 5GT3B 1KX3C 1KX4C 3KUYA 1P3GB 3AZNC 1KX3B 4DRBA 1KX4B 4XZQA 1ZLAC 4R8PA 3WA9C 4CAYB 3AZNB 1ZLAB 5B31D 3WA9B 5B24A 1WWSA 1EQZC 3LZ1A 1EQZB 5BO0B 3IP4C 4H9PA 2YFVB 2G5HC 3WAAA 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA D;  5GSU D;  3B6G A;  3X1V C;  1P34 A;  1N1J A;  3X1V B;  3LZ0 C;  1S32 D;  3LZ0 B;  4QLC C;  3AV1 C;  3MNN D;  1ID3 A;  5AV8 C;  3AV1 B;  3UT9 D;  1H3O A;  1P3L C;  5B1M D;  3AZK D;  5AV8 B;  4H9O A;  3AZF A;  1P3L B;  3UTB C;  4Z66 C;  3AV2 D;  4H9Q A;  4KHA B;  3UTB B;  4Z66 B;  4ZUX A;  5C3I C;  5B32 D;  5BS7 C;  3X1S D;  5C3I B;  3B6F D;  3AZJ A;  4J8W D;  1M19 A;  3AZL D;  3LJA C;  5DNN D;  4X23 C;  1M1A D;  3LJA B;  4X23 B;  1KX5 D;  3AZE D;  5B0Z A;  1M18 D;  3AZH C;  5AVB C;  3W99 C;  5AV5 C;  4LD9 C;  1P3G A;  3AZH B;  1KX3 A;  1KX4 A;  5AVB B;  5AV5 B;  3W99 B;  4CAY A;  4E45 A;  3AZN A;  3W97 A;  1ZLA A;  1P3O D;  3WA9 A;  5GT0 D;  2PYO D;  3WTP D;  1EQZ A;  5BO0 A;  2YFV A;  3A6N C;  3NQJ B;  4Z2M G;  5CP6 A;  1F66 D;  3X1T C;  4XUJ C;  1F1E A;  3B0D C;  3X1T B;  4KUD D;  4J8V C;  5JA4 A;  4XUJ B;  3B0D B;  4J8X D;  4J8V B;  2FJ7 D;  4WU8 C;  5B40 D;  2CV5 C;  1ULY A;  3W96 A;  5AV6 C;  5AY8 D;  3VH5 T;  1P3F C;  2CV5 B;  5AV6 B;  1P3F B;  5CPJ C;  4NE5 A;  3O62 B;  5CPJ B;  3AV1 A;  3C1C B;  5AV8 A;  1P3L A;  1P3A C;  4KHA A;  3TU4 C;  1P3P D;  3UTB A;  4Z66 A;  3TU4 B;  3X1U C;  3WTP E;  3X1U B;  5BS7 A;  5AVC D;  2IO5 C;  2IO5 B;  5CPI D;  1KU5 A;  4X23 A;  3REH D;  1TZY A;  4YM6 D;  3REK D;  4G92 C;  2HIO D;  3AZH A;  4G92 B;  1B67 A;  5AVB A;  5AV9 C;  3KXB A;  1P3I C;  4JJN C;  3W99 A;  4KGC D;  5AV9 B;  1P3I B;  4JJN B;  5KDM B;  5DNM C;  3VH5 W;  2NQB D;  3NQU A;  5GXQ D;  1P3B C;  5DNM B;  3KUY D;  1HQ3 D;  5BNV B;  3REL C;  3NQJ A;  3REL B;  4Z5T C;  2YFW B;  3LEL A;  4Z5T B;  5B33 C;  3X1T A;  5B33 B;  3WAA D;  1P3K C;  4H9N B;  1P3K B;  5AV6 A;  1P3F A;  3W98 D;  3MGS C;  3O62 A;  5CPJ A;  1HTA A;  3MGS B;  3C1C A;  1AOI D;  1P34 D;  4YS3 A;  3AFA C;  2L5A A;  3AFA B;  1U35 C;  5G49 B;  5GSU C;  3X1U A;  1U35 B;  5GSU B;  3AZF D;  1S32 C;  4ZUX D;  1S32 B;  3MNN C;  3AYW D;  4HGA C;  3MNN B;  4M6B A;  3REI C;  4HGA B;  3KWQ D;  3VH6 T;  3AZJ D;  3AV2 C;  3REI B;  1M19 D;  5AV9 A;  3AV2 B;  5E5A A;  5JRG C;  3MGR C;  4QLC B;  1P3M C;  3B6F C;  5JRG B;  3MGR B;  3REJ A;  1P3M B;  3B6F B;  1P3G D;  1WWI A;  4J8W C;  1KX3 D;  5BNV A;  1KX4 D;  5DNN C;  3AZN D;  4J8W B;  4E44 A;  3W97 D;  3REL A;  5CPK D;  5DNN B;  4WU9 C;  3AZE C;  2YFW A;  1KX5 C;  1EQZ D;  1M18 C;  4WU9 B;  4Z5T A;  3AZE B;  1KX5 B;  4WNN B;  1M18 B;  5BT1 C;  5B33 A;  3WKJ C;  3WKJ B;  1P3O C;  3AZG C;  2PYO C;  5CP6 D;  1P3O B;  3WTP C;  3AZG B;  4H9N A;  1P3K A;  2PYO B;  3WTP B;  5B2I A;  4H9R B;  5GT3 A;  4G91 C;  5B1L D;  3MGS A;  4G91 B;  5BNX B;  4LD9 B;  3VH6 W;  3W96 D;  1F66 C;  3AFA A;  1F66 B;  2JSS A;  4ZBJ C;  5G49 A;  4NFT A;  4J8X C;  3UTA D;  4ZBJ B;  3AV1 D;  1U35 A;  2F8N H;  4J8U C;  2FJ7 C;  4J8X B;  3R45 B;  4J8U B;  5B40 C;  2FJ7 B;  3A6N B;  5B40 B;  4Z66 D;  5B0Y D;  3AZI D;  2ARO C;  2ARO B;  1JFI B;  3MNN A;  2F8N B;  2NZD D;  3REI A;  3X1V A;  1P3P C;  4WU8 B;  3AV2 A;  3B0C T;  1P3P B;  1Q9C A;  1TZY D;  5B2J D;  3LZ0 A;  3MVD D;  2CWE A;  4QLC A;  5JRG A;  3MGR A;  1P3M A;  3B6F A;  5AVC C;  3AZH D;  3V9R B;  3W99 D;  5AVB D;  5AVC B;  3KXB D;  5CPI C;  4J8W A;  2LY8 A;  1P3A B;  5DNN A;  3REH C;  5CPI B;  4YM6 C;  3REH B;  3REK C;  4WU9 A;  4YM6 B;  4WNN A;  2HIO C;  1M18 A;  3REK B;  2HIO B;  3WKJ A;  4KGC C;  3C1B C;  4KGC B;  3LJA A;  3AZG A;  2NQB C;  3C1B B;  2PYO A;  4NE6 A;  3AN2 D;  2NQB B;  3LEL D;  3X1T D;  3MGQ C;  5F99 D;  3KUY C;  3MGQ B;  1HQ3 C;  3KUY B;  3AZM D;  5AV5 A;  4LD9 A;  1HQ3 B;  2RVQ D;  3KSY A;  1TAF B;  3MGP D;  5AV6 D;  1P3F D;  2BYK B;  4EO5 C;  3O62 D;  1P3B B;  4EO5 B;  3C1C D;  3WAA C;  4J8X A;  4XZQ D;  3R45 A;  4J8U A;  4R8P D;  2FJ7 A;  4YS3 D;  3A6N A;  5B40 A;  5B24 D;  3W98 C;  3LZ1 D;  3W98 B;  2ARO A;  1JFI A;  4XUJ A;  1AOI C;  4J8V A;  1AOI B;  2F8N A;  5B31 C;  4WU8 A;  5B31 B;  2CV5 A;  3B6G D;  1H3O B;  4H9S C;  1A7W A;  3V9R A;  1P3A A;  3TU4 A;  5E5A D;  3REH A;  3AYW C;  1ID3 D;  3AYW B;  3REJ D;  3REK A;  3KWQ C;  3AZJ C;  1BH9 B;  2HIO A;  1M19 C;  3KWQ B;  3AZJ B;  3REL D;  1M19 B;  4KGC A;  3C1B A;  2BYM B;  3UT9 C;  4Z5T D;  5B1M C;  3AZK C;  3UT9 B;  5B33 D;  3MGQ A;  5B1M B;  3AZK B;  1HQ3 A;  3W97 C;  5CPK C;  1P3I A;  1TAF A;  4JJN A;  3W97 B;  5KDM A;  5B32 C;  5CPK B;  3X1S C;  1P3K D;  3VH5 A;  5B2I D;  4NE3 A;  2BYK A;  5B32 B;  5DNM A;  5B0Z D;  3X1S B;  5GT3 D;  1P3B A;  3MGS D;  3AZL C;  1M1A C;  1ZLA D;  4UUZ B;  5CP6 C;  3AZL B;  1M1A B;  3WA9 D;  5CP6 B;  4DRA A;  3W98 A;  1BH8 B;  5B1L C;  1U35 D;  5FUG B;  5JA4 B;  5B1L B;  1AOI A;  3W96 C;  5GT0 C;  3W96 B;  2HUE C;  5B31 A;  5GT0 B;  2HUE B;  4WV4 B;  3UTA C;  3UTA B;  3REI D;  3X1V D;  3B0B A;  4H9S A;  5B0Y C;  3AZI C;  3LZ0 D;  5B0Y B;  3AZI B;  4KUD C;  4QLC D;  2F8N G;  3AYW A;  5JRG D;  3MGR D;  5GSU A;  1P3M D;  4KUD B;  5AV8 D;  2NZD C;  1BH9 A;  1P3L D;  2NZD B;  3KWQ A;  5AY8 C;  3UTB D;  1S32 A;  1TZY C;  5B2J C;  5AY8 B;  3MVD C;  1TZY B;  5B2J B;  2BYM A;  3MVD B;  4WU9 D;  3UT9 A;  1BFM A;  5B1M A;  3AZK A;  3KXB C;  5BT1 D;  3WKJ D;  3KXB B;  3LJA D;  4X23 D;  3AZG D;  5CPK A;  5B32 A;  3NQU B;  3X1S A;  5AV5 D;  4LD9 D;  4UUZ A;  4Z2M H;  3AZL A;  1M1A A;  3AN2 C;  3LEL C;  5F99 C;  3AN2 B;  3AZE A;  1BH8 A;  1KX5 A;  3LEL B;  5FUG A;  5F99 B;  3AZM C;  5B1L A;  2RVQ C;  4CSR B;  4J8U D;  3AZM B;  3A6N D;  3MGP C;  1P3O A;  5GXQ C;  3MGP B;  5GT0 A;  3WTP A;  5GXQ B;  3O62 C;  2ARO D;  4H9R A;  3C1C C;  4XUJ D;  3UTA A;  4J8V D;  4XZQ C;  5BNX A;  4R8P C;  2F8N D;  4YS3 C;  4XZQ B;  4R8P B;  3VH6 A;  4WU8 D;  4YS3 B;  5B24 C;  5CHL B;  2CV5 D;  3B0C W;  5B0Y A;  5B24 B;  3LZ1 C;  3AZI A;  1F66 A;  1B6W A;  5CPJ D;  3LZ1 B;  4H9P B;  4KUD A;  5B31 G;  3WAA B;  2NZD A;  1P3A D;  5AY8 A;  3TU4 D;  5B2J A;  3X1U D;  3B6G C;  3MVD A;  3B6G B;  1P34 C;  1P34 B;  1N1J B;  1P3P A;  5E5A C;  4AWL C;  3C1B D;  5E5A B;  4AWL B;  1ID3 C;  3REJ C;  1ID3 B;  3REJ B;  3MGQ D;  3AZF C;  4H9O B;  3AZF B;  5AVC A;  5AV9 D;  4ZUX C;  4H9Q B;  1P3I D;  4JJN D;  5CPI A;  4ZUX B;  2F8N K;  5DNM D;  3AN2 A;  4YM6 A;  1P3B D;  5F99 A;  4CSR A;  3AZM A;  5B32 G;  5B2I C;  4WZS B;  3MGP A;  5B0Z C;  2NQB A;  5GXQ A;  5B2I B;  5GT3 C;  5B0Z B;  1R4V A;  1P3G C;  5GT3 B;  1KX3 C;  1KX4 C;  3KUY A;  1P3G B;  3AZN C;  1KX3 B;  4DRB A;  1KX4 B;  4XZQ A;  1ZLA C;  4R8P A;  3WA9 C;  4CAY B;  3AZN B;  1ZLA B;  5B31 D;  3WA9 B;  5B24 A;  1WWS A;  1EQZ C;  3LZ1 A;  1EQZ B;  5BO0 B;  4H9P A;  2YFV B;  3WAA A; 
#chains in the Genus database with same CATH topology
 3AFA D;  5GSU D;  3B6G A;  2FFF B;  2ZY4 A;  3X1V C;  1P34 A;  3F6T A;  1N1J A;  3X1V B;  3LZ0 C;  1S32 D;  3LZ0 B;  4QLC C;  3AV1 C;  3MNN D;  1ID3 A;  5AV8 C;  3AV1 B;  3UT9 D;  1H3O A;  1P3L C;  5B1M D;  3AZK D;  2JE5 A;  5AV8 B;  4H9O A;  3AZF A;  1P3L B;  3UTB C;  4Z66 C;  3AV2 D;  4H9Q A;  4KHA B;  3EG5 B;  3UTB B;  4Z66 B;  4ZUX A;  5C3I C;  5B32 D;  5BS7 C;  3X1S D;  5C3I B;  3B6F D;  2DQN C;  3AZJ A;  4J8W D;  1M19 A;  3AZL D;  3LJA C;  5DNN D;  4X23 C;  1M1A D;  3LJA B;  4X23 B;  2Y2M A;  1KX5 D;  3AZE D;  5B0Z A;  4WJ3 C;  1M18 D;  3AZH C;  5AVB C;  3W99 C;  5AV5 C;  4LD9 C;  1P3G A;  3AZH B;  2Y2Q A;  1KX3 A;  5AVB B;  5AV5 B;  1KX4 A;  3W99 B;  4CAY A;  4E45 A;  3AZN A;  3W97 A;  1ZLA A;  1P3O D;  3WA9 A;  5GT0 D;  2PYO D;  3WTP D;  1EQZ A;  5BO0 A;  2YFV A;  3A6N C;  3NQJ B;  4Z2M G;  2Y2J A;  5CP6 A;  1F66 D;  3X1T C;  4XUJ C;  1F1E A;  3B0D C;  3X1T B;  4KUD D;  4J8V C;  5JA4 A;  4XUJ B;  3B0D B;  4J8X D;  4J8V B;  2Y2H A;  2FJ7 D;  4WU8 C;  5B40 D;  2CV5 C;  1ULY A;  3W96 A;  5AV6 C;  5AY8 D;  3VH5 T;  1P3F C;  2CV5 B;  5AV6 B;  1P3F B;  5CPJ C;  4NE5 A;  3O62 B;  5CPJ B;  3AV1 A;  3C1C B;  5AV8 A;  1P3L A;  1P3A C;  4KHA A;  3TU4 C;  1P3P D;  2DF4 C;  4Z66 A;  3UTB A;  3TU4 B;  3X1U C;  3WTP E;  3X1U B;  5BS7 A;  5AVC D;  2IO5 C;  2IO5 B;  5CPI D;  1KU5 A;  4X23 A;  3REH D;  1TZY A;  4YM6 D;  3REK D;  4G92 C;  2HIO D;  3AZH A;  4G92 B;  1B67 A;  5AVB A;  5AV9 C;  3KXB A;  1P3I C;  4JJN C;  3W99 A;  4KGC D;  5AV9 B;  1P3I B;  4JJN B;  2Y2P A;  5KDM B;  5DNM C;  3VH5 W;  2NQB D;  3NQU A;  5GXQ D;  1P3B C;  5DNM B;  3KUY D;  1HQ3 D;  5BNV B;  3REL C;  3NQJ A;  3REL B;  4Z5T C;  2YFW B;  3LEL A;  4Z5T B;  5B33 C;  3X1T A;  5B33 B;  3WAA D;  1P3K C;  4H9N B;  1P3K B;  5AV6 A;  1P3F A;  3W98 D;  3MGS C;  3O62 A;  5CPJ A;  1HTA A;  3MGS B;  3C1C A;  1AOI D;  1P34 D;  4YS3 A;  3AFA C;  2L5A A;  3AFA B;  1U35 C;  5G49 B;  5GSU C;  3X1U A;  1U35 B;  5GSU B;  3AZF D;  1S32 C;  4ZUX D;  1S32 B;  3MNN C;  3AYW D;  4HGA C;  3MNN B;  4M6B A;  3REI C;  4HGA B;  3KWQ D;  3VH6 T;  3AZJ D;  3AV2 C;  3REI B;  1M19 D;  5AV9 A;  3AV2 B;  5E5A A;  5JRG C;  3MGR C;  4QLC B;  1P3M C;  3B6F C;  5JRG B;  3MGR B;  3REJ A;  1P3M B;  3B6F B;  1P3G D;  1WWI A;  4J8W C;  1KX3 D;  5BNV A;  1KX4 D;  5DNN C;  3AZN D;  4J8W B;  4E44 A;  3W97 D;  3REL A;  5CPK D;  5DNN B;  4WU9 C;  3AZE C;  2YFW A;  3EPK A;  1KX5 C;  1EQZ D;  1M18 C;  4WU9 B;  4Z5T A;  3AZE B;  1KX5 B;  4WNN B;  1M18 B;  4DQY B;  5BT1 C;  5B33 A;  3WKJ C;  3WKJ B;  1P3O C;  3AZG C;  2PYO C;  5CP6 D;  1P3O B;  3WTP C;  3AZG B;  4H9N A;  1P3K A;  2PYO B;  3WTP B;  5B2I A;  4H9R B;  5GT3 A;  4G91 C;  5B1L D;  3MGS A;  3H0L C;  4G91 B;  5BNX B;  4LD9 B;  2Y2K A;  2VQR A;  3VH6 W;  3W96 D;  3EPH A;  1F66 C;  3AFA A;  1F66 B;  2JSS A;  4ZBJ C;  5G49 A;  4NFT A;  4J8X C;  3UTA D;  4ZBJ B;  3AV1 D;  1U35 A;  2F8N H;  4J8U C;  2FJ7 C;  4J8X B;  3R45 B;  4J8U B;  5B40 C;  2FJ7 B;  3A6N B;  5B40 B;  3A1I A;  4Z66 D;  5B0Y D;  2F2A C;  3AZI D;  2ARO C;  2ARO B;  1JFI B;  3MNN A;  2Y2O A;  2F8N B;  2NZD D;  3REI A;  3X1V A;  1P3P C;  4WU8 B;  3AV2 A;  3B0C T;  1P3P B;  1Q9C A;  1TZY D;  5B2J D;  3LZ0 A;  3MVD D;  2CWE A;  4QLC A;  5JRG A;  3MGR A;  1P3M A;  3B6F A;  2G5I C;  5AVC C;  3AZH D;  3V9R B;  3W99 D;  5AVB D;  5AVC B;  3KXB D;  2RIQ A;  5CPI C;  4J8W A;  2LY8 A;  1P3A B;  5DNN A;  3REH C;  5CPI B;  4YM6 C;  3REH B;  3REK C;  4WU9 A;  4YM6 B;  4WNN A;  2HIO C;  1M18 A;  3REK B;  2HIO B;  2J8P A;  3WKJ A;  4KGC C;  3C1B C;  4KGC B;  3LJA A;  3AZG A;  2NQB C;  3C1B B;  2PYO A;  4NE6 A;  3AN2 D;  2NQB B;  3LEL D;  3X1T D;  3MGQ C;  5F99 D;  3KUY C;  2BG1 A;  3MGQ B;  1HQ3 C;  3KUY B;  3AZM D;  5AV5 A;  4LD9 A;  1HQ3 B;  2RVQ D;  3KSY A;  1TAF B;  2ZY2 A;  3MGP D;  5AV6 D;  1P3F D;  2BYK B;  4EO5 C;  1PZR A;  3O62 D;  1P3B B;  4EO5 B;  3C1C D;  3WAA C;  4J8X A;  4XZQ D;  3R45 A;  4J8U A;  4R8P D;  2FJ7 A;  4YS3 D;  3A6N A;  5B40 A;  5B24 D;  3W98 C;  3LZ1 D;  3W98 B;  2ARO A;  1JFI A;  4XUJ A;  1AOI C;  4J8V A;  1AOI B;  2F8N A;  5B31 C;  4WU8 A;  5B31 B;  2CV5 A;  3B6G D;  1H3O B;  4H9S C;  1A7W A;  3V9R A;  3H0R C;  1P3A A;  3P5J B;  3TU4 A;  5E5A D;  3REH A;  3AYW C;  1ID3 D;  3AYW B;  3REJ D;  3REK A;  3KWQ C;  3AZJ C;  1BH9 B;  2HIO A;  1M19 C;  3KWQ B;  3AZJ B;  3REL D;  1M19 B;  4KGC A;  3C1B A;  2BYM B;  3UT9 C;  4Z5T D;  5B1M C;  3AZK C;  3UT9 B;  5B33 D;  3MGQ A;  5B1M B;  3AZK B;  1HQ3 A;  3W97 C;  5CPK C;  1P3I A;  1TAF A;  4JJN A;  3W97 B;  5KDM A;  5B32 C;  5CPK B;  3X1S C;  1P3K D;  3VH5 A;  5B2I D;  4NE3 A;  2BYK A;  5B32 B;  5DNM A;  5B0Z D;  3X1S B;  5GT3 D;  1P3B A;  3MGS D;  3AZL C;  1M1A C;  1ZLA D;  4UUZ B;  5CP6 C;  3AZL B;  1M1A B;  3WA9 D;  5CP6 B;  4DRA A;  3W98 A;  1BH8 B;  5B1L C;  1U35 D;  2XD1 A;  4UPK A;  5FUG B;  3EPJ A;  5JA4 B;  5B1L B;  1AOI A;  3W96 C;  5GT0 C;  3W96 B;  2HUE C;  5B31 A;  5GT0 B;  2HUE B;  1T3U A;  4WV4 B;  3UTA C;  3UTA B;  3REI D;  3X1V D;  2ZM5 A;  3B0B A;  4H9S A;  5B0Y C;  3AZI C;  2XD5 A;  3LZ0 D;  5B0Y B;  3AZI B;  4KUD C;  4QLC D;  2F8N G;  3AYW A;  5JRG D;  3MGR D;  5GSU A;  1P3M D;  4KUD B;  5AV8 D;  3AL0 C;  2NZD C;  1BH9 A;  1P3L D;  2NZD B;  3KWQ A;  5AY8 C;  3UTB D;  1S32 A;  1TZY C;  5B2J C;  5AY8 B;  3MVD C;  1TZY B;  5B2J B;  2BYM A;  3MVD B;  4WU9 D;  3UT9 A;  1BFM A;  5B1M A;  3AZK A;  3KXB C;  5BT1 D;  3WKJ D;  3EPL A;  3KXB B;  3LJA D;  4X23 D;  3AZG D;  5CPK A;  5B32 A;  3NQU B;  3X1S A;  2W8S A;  5AV5 D;  4LD9 D;  4UUZ A;  4Z2M H;  3AZL A;  1M1A A;  3AN2 C;  3LEL C;  5F99 C;  3AN2 B;  3AZE A;  1BH8 A;  1KX5 A;  2Y2N A;  3H0M C;  3LEL B;  5FUG A;  5F99 B;  3AZM C;  5B1L A;  2RVQ C;  4CSR B;  4J8U D;  3AZM B;  3A6N D;  3MGP C;  3A1K A;  1P3O A;  5GXQ C;  3MGP B;  5GT0 A;  3WTP A;  5GXQ B;  3O62 C;  2ARO D;  4H9R A;  3C1C C;  4XUJ D;  3UTA A;  4J8V D;  4XZQ C;  5BNX A;  4R8P C;  2F8N D;  4YS3 C;  4XZQ B;  4R8P B;  3VH6 A;  4WU8 D;  4YS3 B;  2ZY5 A;  5CHL B;  5B24 C;  2CV5 D;  3B0C W;  5B0Y A;  5B24 B;  2JCH A;  2Y2L A;  3LZ1 C;  3AZI A;  1F66 A;  1B6W A;  5CPJ D;  3LZ1 B;  4H9P B;  4KUD A;  1Z2C B;  5B31 G;  3WAA B;  2NZD A;  1P3A D;  5AY8 A;  3TU4 D;  5B2J A;  3X1U D;  3B6G C;  3MVD A;  2UWX A;  3B6G B;  1P34 C;  2Y2I A;  1P34 B;  1N1J B;  1P3P A;  5E5A C;  4AWL C;  3C1B D;  5E5A B;  4AWL B;  1ID3 C;  3REJ C;  1ID3 B;  1W2E A;  3REJ B;  3MGQ D;  3AZF C;  4H9O B;  3AZF B;  5AVC A;  5AV9 D;  4ZUX C;  4H9Q B;  1P3I D;  4JJN D;  5CPI A;  4ZUX B;  2F8N K;  5DNM D;  3AN2 A;  4YM6 A;  1P3B D;  5F99 A;  3KFU G;  4CSR A;  3AZM A;  5B32 G;  3FDD A;  5B2I C;  4WZS B;  3MGP A;  5B0Z C;  2NQB A;  5GXQ A;  5B2I B;  5GT3 C;  2Y2G A;  5B0Z B;  1R4V A;  1P3G C;  5GT3 B;  1KX3 C;  1KX4 C;  3KUY A;  1P3G B;  3AZN C;  1KX3 B;  4DRB A;  1KX4 B;  4XZQ A;  1ZLA C;  4R8P A;  3WA9 C;  4CAY B;  3AZN B;  1ZLA B;  5B31 D;  3WA9 B;  5B24 A;  1WWS A;  1EQZ C;  3LZ1 A;  1EQZ B;  5BO0 B;  3IP4 C;  4H9P A;  2YFV B;  2G5H C;  3WAA A;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 3AFA D;  5GSU D;  3B6G A;  2FFF B;  2ZY4 A;  3X1V C;  1P34 A;  3F6T A;  1N1J A;  3X1V B;  3LZ0 C;  1S32 D;  3LZ0 B;  4QLC C;  3AV1 C;  3MNN D;  1ID3 A;  5AV8 C;  3AV1 B;  3UT9 D;  1H3O A;  1P3L C;  5B1M D;  3AZK D;  2JE5 A;  5AV8 B;  4H9O A;  3AZF A;  1P3L B;  3UTB C;  4Z66 C;  3AV2 D;  4H9Q A;  4KHA B;  3EG5 B;  3UTB B;  4Z66 B;  4ZUX A;  5C3I C;  5B32 D;  5BS7 C;  3X1S D;  5C3I B;  3B6F D;  2DQN C;  3AZJ A;  4J8W D;  1M19 A;  3AZL D;  3LJA C;  5DNN D;  4X23 C;  1M1A D;  3LJA B;  4X23 B;  2Y2M A;  1KX5 D;  3AZE D;  5B0Z A;  4WJ3 C;  1M18 D;  3AZH C;  5AVB C;  3W99 C;  5AV5 C;  4LD9 C;  1P3G A;  3AZH B;  2Y2Q A;  1KX3 A;  5AVB B;  5AV5 B;  1KX4 A;  3W99 B;  4CAY A;  4E45 A;  3AZN A;  3W97 A;  1ZLA A;  1P3O D;  3WA9 A;  5GT0 D;  2PYO D;  3WTP D;  1EQZ A;  5BO0 A;  2YFV A;  3A6N C;  3NQJ B;  4Z2M G;  2Y2J A;  5CP6 A;  1F66 D;  3X1T C;  4XUJ C;  1F1E A;  3B0D C;  3X1T B;  4KUD D;  4J8V C;  5JA4 A;  4XUJ B;  3B0D B;  4J8X D;  4J8V B;  2Y2H A;  2FJ7 D;  4WU8 C;  5B40 D;  2CV5 C;  1ULY A;  3W96 A;  5AV6 C;  5AY8 D;  3VH5 T;  1P3F C;  2CV5 B;  5AV6 B;  1P3F B;  5CPJ C;  4NE5 A;  3O62 B;  5CPJ B;  3AV1 A;  3C1C B;  5AV8 A;  1P3L A;  1P3A C;  4KHA A;  3TU4 C;  1P3P D;  2DF4 C;  4Z66 A;  3UTB A;  3TU4 B;  3X1U C;  3WTP E;  3X1U B;  5BS7 A;  5AVC D;  2IO5 C;  2IO5 B;  5CPI D;  1KU5 A;  4X23 A;  3REH D;  1TZY A;  4YM6 D;  3REK D;  4G92 C;  2HIO D;  3AZH A;  4G92 B;  1B67 A;  5AVB A;  5AV9 C;  3KXB A;  1P3I C;  4JJN C;  3W99 A;  4KGC D;  5AV9 B;  1P3I B;  4JJN B;  2Y2P A;  5KDM B;  5DNM C;  3VH5 W;  2NQB D;  3NQU A;  5GXQ D;  1P3B C;  5DNM B;  3KUY D;  1HQ3 D;  5BNV B;  3REL C;  3NQJ A;  3REL B;  4Z5T C;  2YFW B;  3LEL A;  4Z5T B;  5B33 C;  3X1T A;  5B33 B;  3WAA D;  1P3K C;  4H9N B;  1P3K B;  5AV6 A;  1P3F A;  3W98 D;  3MGS C;  3O62 A;  5CPJ A;  1HTA A;  3MGS B;  3C1C A;  1AOI D;  1P34 D;  4YS3 A;  3AFA C;  2L5A A;  3AFA B;  1U35 C;  5G49 B;  5GSU C;  3X1U A;  1U35 B;  5GSU B;  3AZF D;  1S32 C;  4ZUX D;  1S32 B;  3MNN C;  3AYW D;  4HGA C;  3MNN B;  4M6B A;  3REI C;  4HGA B;  3KWQ D;  3VH6 T;  3AZJ D;  3AV2 C;  3REI B;  1M19 D;  5AV9 A;  3AV2 B;  5E5A A;  5JRG C;  3MGR C;  4QLC B;  1P3M C;  3B6F C;  5JRG B;  3MGR B;  3REJ A;  1P3M B;  3B6F B;  1P3G D;  1WWI A;  4J8W C;  1KX3 D;  5BNV A;  1KX4 D;  5DNN C;  3AZN D;  4J8W B;  4E44 A;  3W97 D;  3REL A;  5CPK D;  5DNN B;  4WU9 C;  3AZE C;  2YFW A;  3EPK A;  1KX5 C;  1EQZ D;  1M18 C;  4WU9 B;  4Z5T A;  3AZE B;  1KX5 B;  4WNN B;  1M18 B;  4DQY B;  5BT1 C;  5B33 A;  3WKJ C;  3WKJ B;  1P3O C;  3AZG C;  2PYO C;  5CP6 D;  1P3O B;  3WTP C;  3AZG B;  4H9N A;  1P3K A;  2PYO B;  3WTP B;  5B2I A;  4H9R B;  5GT3 A;  4G91 C;  5B1L D;  3MGS A;  3H0L C;  4G91 B;  5BNX B;  4LD9 B;  2Y2K A;  2VQR A;  3VH6 W;  3W96 D;  3EPH A;  1F66 C;  3AFA A;  1F66 B;  2JSS A;  4ZBJ C;  5G49 A;  4NFT A;  4J8X C;  3UTA D;  4ZBJ B;  3AV1 D;  1U35 A;  2F8N H;  4J8U C;  2FJ7 C;  4J8X B;  3R45 B;  4J8U B;  5B40 C;  2FJ7 B;  3A6N B;  5B40 B;  3A1I A;  4Z66 D;  5B0Y D;  2F2A C;  3AZI D;  2ARO C;  2ARO B;  1JFI B;  3MNN A;  2Y2O A;  2F8N B;  2NZD D;  3REI A;  3X1V A;  1P3P C;  4WU8 B;  3AV2 A;  3B0C T;  1P3P B;  1Q9C A;  1TZY D;  5B2J D;  3LZ0 A;  3MVD D;  2CWE A;  4QLC A;  5JRG A;  3MGR A;  1P3M A;  3B6F A;  2G5I C;  5AVC C;  3AZH D;  3V9R B;  3W99 D;  5AVB D;  5AVC B;  3KXB D;  2RIQ A;  5CPI C;  4J8W A;  2LY8 A;  1P3A B;  5DNN A;  3REH C;  5CPI B;  4YM6 C;  3REH B;  3REK C;  4WU9 A;  4YM6 B;  4WNN A;  2HIO C;  1M18 A;  3REK B;  2HIO B;  2J8P A;  3WKJ A;  4KGC C;  3C1B C;  4KGC B;  3LJA A;  3AZG A;  2NQB C;  3C1B B;  2PYO A;  4NE6 A;  3AN2 D;  2NQB B;  3LEL D;  3X1T D;  3MGQ C;  5F99 D;  3KUY C;  2BG1 A;  3MGQ B;  1HQ3 C;  3KUY B;  3AZM D;  5AV5 A;  4LD9 A;  1HQ3 B;  2RVQ D;  3KSY A;  1TAF B;  2ZY2 A;  3MGP D;  5AV6 D;  1P3F D;  2BYK B;  4EO5 C;  1PZR A;  3O62 D;  1P3B B;  4EO5 B;  3C1C D;  3WAA C;  4J8X A;  4XZQ D;  3R45 A;  4J8U A;  4R8P D;  2FJ7 A;  4YS3 D;  3A6N A;  5B40 A;  5B24 D;  3W98 C;  3LZ1 D;  3W98 B;  2ARO A;  1JFI A;  4XUJ A;  1AOI C;  4J8V A;  1AOI B;  2F8N A;  5B31 C;  4WU8 A;  5B31 B;  2CV5 A;  3B6G D;  1H3O B;  4H9S C;  1A7W A;  3V9R A;  3H0R C;  1P3A A;  3P5J B;  3TU4 A;  5E5A D;  3REH A;  3AYW C;  1ID3 D;  3AYW B;  3REJ D;  3REK A;  3KWQ C;  3AZJ C;  1BH9 B;  2HIO A;  1M19 C;  3KWQ B;  3AZJ B;  3REL D;  1M19 B;  4KGC A;  3C1B A;  2BYM B;  3UT9 C;  4Z5T D;  5B1M C;  3AZK C;  3UT9 B;  5B33 D;  3MGQ A;  5B1M B;  3AZK B;  1HQ3 A;  3W97 C;  5CPK C;  1P3I A;  1TAF A;  4JJN A;  3W97 B;  5KDM A;  5B32 C;  5CPK B;  3X1S C;  1P3K D;  3VH5 A;  5B2I D;  4NE3 A;  2BYK A;  5B32 B;  5DNM A;  5B0Z D;  3X1S B;  5GT3 D;  1P3B A;  3MGS D;  3AZL C;  1M1A C;  1ZLA D;  4UUZ B;  5CP6 C;  3AZL B;  1M1A B;  3WA9 D;  5CP6 B;  4DRA A;  3W98 A;  1BH8 B;  5B1L C;  1U35 D;  2XD1 A;  4UPK A;  5FUG B;  3EPJ A;  5JA4 B;  5B1L B;  1AOI A;  3W96 C;  5GT0 C;  3W96 B;  2HUE C;  5B31 A;  5GT0 B;  2HUE B;  1T3U A;  4WV4 B;  3UTA C;  3UTA B;  3REI D;  3X1V D;  2ZM5 A;  3B0B A;  4H9S A;  5B0Y C;  3AZI C;  2XD5 A;  3LZ0 D;  5B0Y B;  3AZI B;  4KUD C;  4QLC D;  2F8N G;  3AYW A;  5JRG D;  3MGR D;  5GSU A;  1P3M D;  4KUD B;  5AV8 D;  3AL0 C;  2NZD C;  1BH9 A;  1P3L D;  2NZD B;  3KWQ A;  5AY8 C;  3UTB D;  1S32 A;  1TZY C;  5B2J C;  5AY8 B;  3MVD C;  1TZY B;  5B2J B;  2BYM A;  3MVD B;  4WU9 D;  3UT9 A;  1BFM A;  5B1M A;  3AZK A;  3KXB C;  5BT1 D;  3WKJ D;  3EPL A;  3KXB B;  3LJA D;  4X23 D;  3AZG D;  5CPK A;  5B32 A;  3NQU B;  3X1S A;  2W8S A;  5AV5 D;  4LD9 D;  4UUZ A;  4Z2M H;  3AZL A;  1M1A A;  3AN2 C;  3LEL C;  5F99 C;  3AN2 B;  3AZE A;  1BH8 A;  1KX5 A;  2Y2N A;  3H0M C;  3LEL B;  5FUG A;  5F99 B;  3AZM C;  5B1L A;  2RVQ C;  4CSR B;  4J8U D;  3AZM B;  3A6N D;  3MGP C;  3A1K A;  1P3O A;  5GXQ C;  3MGP B;  5GT0 A;  3WTP A;  5GXQ B;  3O62 C;  2ARO D;  4H9R A;  3C1C C;  4XUJ D;  3UTA A;  4J8V D;  4XZQ C;  5BNX A;  4R8P C;  2F8N D;  4YS3 C;  4XZQ B;  4R8P B;  3VH6 A;  4WU8 D;  4YS3 B;  2ZY5 A;  5CHL B;  5B24 C;  2CV5 D;  3B0C W;  5B0Y A;  5B24 B;  2JCH A;  2Y2L A;  3LZ1 C;  3AZI A;  1F66 A;  1B6W A;  5CPJ D;  3LZ1 B;  4H9P B;  4KUD A;  1Z2C B;  5B31 G;  3WAA B;  2NZD A;  1P3A D;  5AY8 A;  3TU4 D;  5B2J A;  3X1U D;  3B6G C;  3MVD A;  2UWX A;  3B6G B;  1P34 C;  2Y2I A;  1P34 B;  1N1J B;  1P3P A;  5E5A C;  4AWL C;  3C1B D;  5E5A B;  4AWL B;  1ID3 C;  3REJ C;  1ID3 B;  1W2E A;  3REJ B;  3MGQ D;  3AZF C;  4H9O B;  3AZF B;  5AVC A;  5AV9 D;  4ZUX C;  4H9Q B;  1P3I D;  4JJN D;  5CPI A;  4ZUX B;  2F8N K;  5DNM D;  3AN2 A;  4YM6 A;  1P3B D;  5F99 A;  3KFU G;  4CSR A;  3AZM A;  5B32 G;  3FDD A;  5B2I C;  4WZS B;  3MGP A;  5B0Z C;  2NQB A;  5GXQ A;  5B2I B;  5GT3 C;  2Y2G A;  5B0Z B;  1R4V A;  1P3G C;  5GT3 B;  1KX3 C;  1KX4 C;  3KUY A;  1P3G B;  3AZN C;  1KX3 B;  4DRB A;  1KX4 B;  4XZQ A;  1ZLA C;  4R8P A;  3WA9 C;  4CAY B;  3AZN B;  1ZLA B;  5B31 D;  3WA9 B;  5B24 A;  1WWS A;  1EQZ C;  3LZ1 A;  1EQZ B;  5BO0 B;  3IP4 C;  4H9P A;  2YFV B;  2G5H C;  3WAA A;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...