4H9PA

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9pA00
3WKJD 1EQZC 3AN2D 2NQBB 3MGSD 1M18D 3VH5A 3RELD 3KXBB 5CP6D 5F99A 2AROD 1P3FD 1KX5C 2JSSA 1M19D 4Z66C 4Z5TA 4WU9A 3X1TB 1KX5D 5GT3B 1EQZA 4Z66D 5KDMA 1S32C 1F1EA 3MVDA 2F8NH 5AV8B 3B6GC 4R8PC 3O62B 3AZJB 4QLCB 1S32D 3AZLB 3A6ND 5B2IA 1JFIA 4KUDC 3V9RB 4G91C 2YFWB 4R8PD 3UTBB 1P3GC 1M1AB 1F66B 4J8XB 3REJB 5CPJB 1KX3B 3WAAD 4KUDD 5DNMC 5B33C 3MGQB 5BS7C 4ZUXC 4J8WB 5AVCB 4XZQC 1P3KD 4NE6A 3AYWB 2HIOB 5C3IB 3UTAC 1P3PB 1ZLAA 4ZUXD 3UT9D 3AZMB 1HQ3A 3C1BB 1AOID 5B33A 3UTAD 3W98A 1ID3C 1P3ID 5AV5C 5E5AC 1P3BC 4YM6B 4DRAA 3REIA 3B6FA 3MNNC 1ID3D 5AV5D 3X1UC 3REHC 4WU8B 2F8NK 1P3BD 5B32B 5B40D 4LD9B 3X1VA 3AFAA 5B24C 3WA9C 1KX4A 3LZ1A 5GSUC 5E5AA 2FJ7B 4H9SA 3AZHB 3B0DB 3X1UD 1N1JA 5B1LB 5AV6C 4YS3D 3REHD 3C1CD 3AZIA 3MNNA 2NQBC 2YFVA 5GSUD 4KGCB 1BH9A 1P3AC 5B24A 1P3OA 4X23A 1H3OA 2NQBD 4WU9B 3KXBD 5CHLB 5AV6A 3VH6W 3LZ0C 5JRGB 3LJAC 1WWSA 4E45A 5KDMB 4AWLC 3W96C 5AV9B 3AV2A 5BO0A 5B31C 3LJAD 3MGRC 5B1MA 1P3AA 1BH8A 5JA4A 5DNNB 5GT3D 2PYOB 5GXQB 3AZGB 5CPKB 3VH6A 1JFIB 5B2IB 4M6BA 3WTPC 5CPIC 3AZLC 4WNNA 5AV8D 2F8NB 5B2JA 5AY8A 3AZJD 1TAFA 1M1AC 3LELB 5B31A 4QLCD 3REJC 1P34A 4WZSB 3AZLD 2CV5A 3KWQB 2CWEA 4UUZA 3AZEB 1U35A 3UTBD 4J8WC 3R45A 5AVCC 3WTPA 1M1AD 1F66D 5CPIA 4J8XD 3REJD 5CPJD 5B0ZB 3AYWC 4CAYB 5GT0A 1P3PC 1ZLAB 3MGQD 3AZMC 4J8WD 1HQ3B 5AVCD 3AYWD 2IO5B 3W98B 2HIOD 3NQJA 4H9RA 3VH5W 1P3PD 4H9NA 4J8VA 4E44A 3AZMD 3WKJC 3AN2C 3C1BD 3REIB 4ZBJB 3B6FB 4XUJB 2HUEB 2AROC 1P3FC 2BYKB 1M19C 4WU8C 3LZ1B 3AZKA 3B0BA 1P3LB 5FUGA 3B0DC 3AN2A 4CSRA 5AVBB 3MGSA 1M18A 3RELA 4WU8D 3AZIB 5B32D 4H9QA 5CP6A 4LD9D 1P3FA 4J8UB 2YFVB 2BYMA 3AZNB 1M19A 2FJ7D 4KGCC 1BH9B 1TZYC 5B1LD 1P3OB 1H3OB 3X1SB 1B6WA 3AZFC 1KX5A 3A6NC 3W97B 4Z66A 4JJNB 4KGCD 1TZYD 4H9PB 3AZFD 4WU9D 3AV2B 3WAAC 3NQUB 5AV9C 4G92C 5B1MB 5B0YB 5JRGD 1WWIA 5DNNC 1S32A 3VH5T 5GXQC 1P3KC 3KSYA 3AZGC 5CPKC 3TU4C 5AV9D 3B6GA 4R8PA 4WNNB 3UT9C 3MGPC 3KUYB 4KHAB 5DNND 2PYOD 5GXQD 3WAAA 4KUDA 1AOIC 3AZGD 3LELC 3TU4D 5CPKD 1P34B 2NZDB 1P3GA 3KWQC 1P3MC 3MGPD 1P3IC 3AZEC 3R45B 3AV1C 2F8ND 5DNMA 3LELD 2F8NG 5B0ZC 3W99B 5BS7A 4ZUXA 3KWQD 1P3MD 3AZED 4XZQA 3AV1D 1AOIA 3UTAA 5B40C 5B0ZD 2IO5C 4J8VB 1ZLAD 4HGAC 4YS3C 3C1CC 1HQ3D 2RVQC 1ID3A 4ZBJC 5G49B 5AV5A 4NE5A 3REKB 1P3BA 5B40A 2RVQD 5BNVA 3REID 3B6FD 4XUJD 3X1UA 3KXBC 5F99B 3AZKB 3REHA 5BT1C 4EO5B 1P3LC 4CSRB 3RELB 5AVBC 3WA9A 4Z5TB 4H9QB 5GSUA 5BT1D 4J8UC 3X1TC 3AZNC 1P3LD 1EQZB 5GT3C 2NQBA 5AVBD 3AZID 3MVDB 4J8UD 5AV8C 3X1TD 3AZND 1R4VA 3O62C 3AZJC 4QLCC 3X1SD 3LZ0A 3LJAA 2LY8A 3B0CW 1KU5A 5GT3A 3W97D 4JJND 1HTAA 3O62D 3W96A 3UTBC 1F66C 4J8XC 5CPJC 3MGRA 3B6GB 3AV2D 1KX3C 5B1MD 5B0YD 3MGQC 3AZJA 4KUDB 3AZLA 3V9RA 2YFWA 2NZDC 2HIOC 1KX3D 4DRBA 5C3IC 1P3GB 1M1AA 1F66A 3KUYD 4H9OA 4J8XA 3REJA 3C1BC 5DNMB 5B33B 2NZDD 1P34D 3W99C 4J8WA 4XZQB 5AVCA 3AYWA 3VH6T 2HIOA 4YM6C 1P3PA 4NE3A 3W99D 3AZMA 3C1BA 4Z2MG 4YM6D 5B32C 3X1VB 3AFAB 4LD9C 1KX4B 5E5AB 3WKJA 1B67A 2FJ7C 1N1JB 3REKC 3AZHC 1ULYA 5B1LC 3MNNB 2AROA 3X1UB 5B32G 5F99C 3REKD 4WU8A 3AZHD 5B24B 4LD9A 3WA9B 4X23B 3AZHA 4WU9C 5AV6B 5F99D 3AZKD 5JRGC 5BNXA 4Z5TD 5BO0B 3MVDC 4KGCA 1TZYA 1P3AB 1BH8B 5JA4B 1EQZD 2PYOC 3AZFA 3A6NA 3LZ0B 3LJAB 5JRGA 5B2IC 3MVDD 4AWLB 3W96B 5B2JB 5AY8B 1TAFB 5AV9A 5B31B 3MGRB 5B2ID 2CV5B 5DNNA 4UUZB 2PYOA 1U35B 5GXQA 1P3KA 3AZGA 3WTPB 3TU4A 5CPKA 5CPIB 3UT9A 5GT0B 3B6GD 3MGPA 1ZLAC 2F8NA 4H9OB 3LELA 1HQ3C 3NQJB 4H9RB 3KWQA 1P3MA 1P3IA 3W98C 4H9NB 3AZEA 1P3GD 3AV1A 5B0ZA 5DNMD 3REIC 4CAYA 3B6FC 5B33D 4XUJC 3W98D 2HUEC 4XZQD 3X1VC 3AFAC 4YS3A 1KX4C 3LZ1C 3WKJB 5FUGB 3C1CA 4H9SC 3AN2B 3MGSB 1M18B 4XUJA 5CP6B 3AZIC 3X1VD 3AFAD 2AROB 1P3FB 2BYMB 1KX4D 3LZ1D 1M19B 2BYKA 5E5AD 1P3OC 4X23C 3KXBA 3MNND 3X1SC 1KX5B 1P3LA 4Z66B 3W97C 5AVBA 4JJNC 5BNXB 4WV4B 5B24D 1P3OD 3WA9D 4X23D 4J8UA 3X1TA 3AZNA 3AV2C 1TZYB 5AV6D 5B1MC 5B0YC 1S32B 3AZFB 3X1SA 3A6NB 3W97A 5AV8A 4R8PB 4JJNA 3O62A 1P3AD 4H9PA 3KUYC 4QLCA 5B2JC 5AY8C 3WAAB 4G91B 4G92B 3NQUA 3LZ0D 1A7WA 2L5AA 1P34C 5B0YA 2CV5C 3UTBA 1P3KB 1U35C 3W96D 3WTPE 5B2JD 5AY8D 3TU4B 5CPJA 1KX3A 5B31D 3MGRD 4ZUXB 3UT9B 3MGPB 3MGQA 2CV5D 5GT0C 5B31G 3KUYA 4KHAA 1U35D 1AOIB 4Z2MH 3UTAB 3WTPD 2NZDA 5CPID 1P3MB 1P3IB 5GT0D 3AV1B 4J8VC 1BFMA 1Q9CA 3W99A 1ID3B 5AV5B 4J8VD 1P3BB 5B40B 4YM6A 3B0CT 5BNVB 4HGAB 4YS3B 3REHB 3C1CB 3AZKC 4EO5C 5B32A 3MGSC 1M18C 3RELC 5G49A 4Z5TC 5GSUB 5CP6C 2FJ7A 3REKA 4NFTA 5B1LA
chains in the Genus database with same CATH superfamily
3WKJD 1EQZC 3AN2D 2NQBB 3MGSD 1M18D 3VH5A 3RELD 3KXBB 2BG1A 5CP6D 5F99A 2AROD 1P3FD 2JE5A 1KX5C 2Y2JA 2JSSA 1M19D 4Z66C 4Z5TA 4WU9A 3EPKA 3X1TB 1KX5D 5GT3B 1EQZA 4Z66D 5KDMA 1S32C 1F1EA 3MVDA 2F8NH 5AV8B 3B6GC 4R8PC 3O62B 3AZJB 4QLCB 1S32D 3AZLB 3A6ND 5B2IA 1JFIA 4KUDC 3V9RB 4G91C 2YFWB 2Y2GA 4R8PD 3UTBB 1P3GC 1M1AB 1F66B 4J8XB 3REJB 5CPJB 2Y2LA 1KX3B 3WAAD 4KUDD 5DNMC 5B33C 3MGQB 5BS7C 4ZUXC 4J8WB 5AVCB 4XZQC 1P3KD 4NE6A 3AYWB 2HIOB 5C3IB 3UTAC 1P3PB 1ZLAA 4ZUXD 3UT9D 3AZMB 1HQ3A 3C1BB 1AOID 2Y2PA 5B33A 3UTAD 3W98A 1ID3C 1P3ID 5AV5C 5E5AC 1P3BC 4YM6B 4DRAA 3REIA 3B6FA 2Y2QA 3MNNC 1ID3D 5AV5D 3X1UC 3REHC 4WU8B 2F8NK 1P3BD 5B32B 2J8PA 5B40D 3X1VA 4LD9B 3AFAA 5B24C 3WA9C 1KX4A 3LZ1A 3EPHA 5GSUC 5E5AA 2FJ7B 4H9SA 3AZHB 3B0DB 3X1UD 1N1JA 5B1LB 5AV6C 4YS3D 3REHD 3C1CD 3AZIA 3MNNA 2NQBC 2YFVA 5GSUD 2ZY4A 2RIQA 4KGCB 1BH9A 1P3AC 5B24A 1P3OA 4X23A 1H3OA 2NQBD 4WU9B 3KXBD 5CHLB 5AV6A 3VH6W 3LZ0C 5JRGB 3LJAC 1WWSA 4E45A 2Y2MA 5KDMB 4AWLC 3W96C 5AV9B 3AV2A 5BO0A 5B31C 3LJAD 3MGRC 5B1MA 1P3AA 1BH8A 5JA4A 5DNNB 5GT3D 2PYOB 5GXQB 3AZGB 5CPKB 3VH6A 1JFIB 5B2IB 4M6BA 3WTPC 5CPIC 3AZLC 2Y2OA 4WNNA 5AV8D 2F8NB 5B2JA 5AY8A 3AZJD 1TAFA 1M1AC 3LELB 5B31A 4QLCD 3REJC 1P34A 4WZSB 3AZLD 2CV5A 3KWQB 2CWEA 4UUZA 3AZEB 1U35A 3UTBD 4J8WC 3R45A 5AVCC 3WTPA 1M1AD 1F66D 5CPIA 4J8XD 3REJD 5CPJD 5B0ZB 3AYWC 4CAYB 5GT0A 1P3PC 1ZLAB 3MGQD 3AZMC 4J8WD 3H0RC 1HQ3B 5AVCD 2XD1A 3AYWD 2IO5B 3W98B 2HIOD 3NQJA 4H9RA 3VH5W 1P3PD 4H9NA 4J8VA 4E44A 3AZMD 3WKJC 2Y2HA 3AN2C 3C1BD 3REIB 4ZBJB 3B6FB 4XUJB 2HUEB 2ZY5A 2AROC 1P3FC 2BYKB 1M19C 4WU8C 3LZ1B 3AZKA 3B0BA 1P3LB 5FUGA 3B0DC 3AN2A 4CSRA 5AVBB 3MGSA 1M18A 3RELA 4WU8D 3AZIB 5B32D 4H9QA 5CP6A 4LD9D 1P3FA 4J8UB 2YFVB 2BYMA 3AZNB 1M19A 2FJ7D 4KGCC 1BH9B 1TZYC 5B1LD 1P3OB 2W8SA 1H3OB 3X1SB 1B6WA 3AZFC 1KX5A 3A6NC 3W97B 4Z66A 4JJNB 4KGCD 1TZYD 4H9PB 3AZFD 4WU9D 3EG5B 3AV2B 3WAAC 3NQUB 5AV9C 4G92C 5B1MB 5B0YB 5JRGD 1WWIA 5DNNC 1S32A 3VH5T 5GXQC 1P3KC 3KSYA 3AZGC 5CPKC 3TU4C 5AV9D 3B6GA 4R8PA 4WNNB 4DQYB 3UT9C 3MGPC 3KUYB 4KHAB 5DNND 2PYOD 4UPKA 5GXQD 3WAAA 4KUDA 1AOIC 3AZGD 3LELC 3TU4D 5CPKD 1P34B 2NZDB 1P3GA 3A1KA 3KWQC 1P3MC 3MGPD 1P3IC 3AZEC 3R45B 3AV1C 2F8ND 5DNMA 3LELD 2F8NG 5B0ZC 3W99B 5BS7A 1PZRA 4ZUXA 3KWQD 1P3MD 3AZED 4XZQA 3AV1D 1AOIA 3UTAA 2Y2IA 5B40C 5B0ZD 2IO5C 4J8VB 1ZLAD 4HGAC 4YS3C 3C1CC 2Y2NA 1HQ3D 2RVQC 3IP4C 1ID3A 4ZBJC 5G49B 5AV5A 4NE5A 3REKB 1P3BA 5B40A 2RVQD 5BNVA 3REID 3B6FD 4XUJD 3X1UA 3KXBC 5F99B 3AZKB 3REHA 5BT1C 4EO5B 1P3LC 4CSRB 3RELB 5AVBC 3WA9A 4Z5TB 3KFUG 4H9QB 5GSUA 5BT1D 4J8UC 3X1TC 3AZNC 1P3LD 2G5HC 1EQZB 5GT3C 2NQBA 5AVBD 3AZID 3MVDB 4J8UD 5AV8C 3X1TD 3AZND 1R4VA 3O62C 3AZJC 4QLCC 3X1SD 3LZ0A 3LJAA 2LY8A 3B0CW 1KU5A 5GT3A 3W97D 4JJND 1HTAA 3O62D 3W96A 3UTBC 1F66C 4J8XC 5CPJC 3MGRA 3B6GB 3AV2D 1KX3C 2ZM5A 5B1MD 5B0YD 3MGQC 3AZJA 4KUDB 3AZLA 3V9RA 2YFWA 2NZDC 2HIOC 1KX3D 4DRBA 5C3IC 1P3GB 1M1AA 1F66A 3KUYD 4H9OA 4J8XA 3REJA 3C1BC 5DNMB 5B33B 2NZDD 1P34D 3W99C 4J8WA 3EPLA 4XZQB 5AVCA 3AYWA 3VH6T 2HIOA 4YM6C 1P3PA 4NE3A 3W99D 3AZMA 3C1BA 4Z2MG 2XD5A 4YM6D 5B32C 3X1VB 3AFAB 4LD9C 1KX4B 3A1IA 5E5AB 2DQNC 3WKJA 1B67A 2FJ7C 1N1JB 3REKC 3AZHC 1ULYA 5B1LC 3MNNB 2AROA 1Z2CB 3X1UB 5B32G 5F99C 3REKD 4WU8A 3AZHD 5B24B 4LD9A 3WA9B 4X23B 3AZHA 2DF4C 4WU9C 3H0LC 5AV6B 2ZY3A 5F99D 3AZKD 5JRGC 3EPJA 5BNXA 4Z5TD 5BO0B 3MVDC 4KGCA 1TZYA 1P3AB 1BH8B 5JA4B 1EQZD 4WJ3C 2PYOC 3AZFA 3A6NA 3LZ0B 3LJAB 5JRGA 5B2IC 3MVDD 4AWLB 3W96B 5B2JB 5AY8B 1TAFB 5AV9A 2G5IC 5B31B 3MGRB 5B2ID 2CV5B 5DNNA 4UUZB 2PYOA 1U35B 5GXQA 1P3KA 2FFFB 3AZGA 3WTPB 3TU4A 5CPKA 5CPIB 1W2EA 2JCHA 5GT0B 3UT9A 3MGPA 3B6GD 1ZLAC 2F8NA 4H9OB 3LELA 1HQ3C 3NQJB 4H9RB 3KWQA 1P3MA 1P3IA 3W98C 2F2AC 4H9NB 3AZEA 1P3GD 3AV1A 5B0ZA 5DNMD 3REIC 4CAYA 3B6FC 5B33D 4XUJC 3W98D 2HUEC 4XZQD 3X1VC 3AFAC 4YS3A 1KX4C 3LZ1C 3WKJB 5FUGB 3C1CA 4H9SC 3AL0C 3AN2B 3MGSB 1M18B 4XUJA 5CP6B 3AZIC 3X1VD 3AFAD 2AROB 1P3FB 2BYMB 1KX4D 3LZ1D 1M19B 2BYKA 5E5AD 3H0MC 1P3OC 2ZY2A 4X23C 3KXBA 3MNND 3X1SC 1KX5B 3FDDA 1P3LA 4Z66B 3W97C 5AVBA 4JJNC 5BNXB 2VQRA 4WV4B 5B24D 1P3OD 3WA9D 4X23D 1T3UA 4J8UA 2UWXA 3X1TA 3AZNA 3AV2C 1TZYB 5AV6D 5B1MC 5B0YC 2Y2KA 1S32B 3F6TA 3AZFB 3X1SA 3A6NB 3W97A 5AV8A 4R8PB 4JJNA 3O62A 1P3AD 4H9PA 3KUYC 4QLCA 5B2JC 5AY8C 3WAAB 4G91B 4G92B 3NQUA 3LZ0D 1A7WA 2L5AA 1P34C 5B0YA 2CV5C 3UTBA 1P3KB 1U35C 3W96D 3WTPE 5B2JD 5AY8D 3TU4B 5CPJA 1KX3A 5B31D 3MGRD 4ZUXB 3UT9B 3MGPB 3MGQA 2CV5D 5GT0C 5B31G 3KUYA 4KHAA 1U35D 3P5JB 1AOIB 4Z2MH 3UTAB 3WTPD 2NZDA 5CPID 1P3MB 1P3IB 5GT0D 3AV1B 4J8VC 1BFMA 1Q9CA 3W99A 1ID3B 5AV5B 4J8VD 1P3BB 5B40B 4YM6A 3B0CT 5BNVB 4HGAB 4YS3B 3REHB 3C1CB 3AZKC 4EO5C 5B32A 3MGSC 1M18C 3RELC 5G49A 4Z5TC 5GSUB 5CP6C 2FJ7A 3REKA 4NFTA 5B1LA
chains in the Genus database with same CATH topology
3WKJD 1EQZC 3AN2D 2NQBB 3MGSD 1M18D 3VH5A 3RELD 3KXBB 2BG1A 5CP6D 5F99A 2AROD 1P3FD 2JE5A 1KX5C 2Y2JA 2JSSA 1M19D 4Z66C 4Z5TA 4WU9A 3EPKA 3X1TB 1KX5D 5GT3B 1EQZA 4Z66D 5KDMA 1S32C 1F1EA 3MVDA 2F8NH 5AV8B 3B6GC 4R8PC 3O62B 3AZJB 4QLCB 1S32D 3AZLB 3A6ND 5B2IA 1JFIA 4KUDC 3V9RB 4G91C 2YFWB 2Y2GA 4R8PD 3UTBB 1P3GC 1M1AB 1F66B 4J8XB 3REJB 5CPJB 2Y2LA 1KX3B 3WAAD 4KUDD 5DNMC 5B33C 3MGQB 5BS7C 4ZUXC 4J8WB 5AVCB 4XZQC 1P3KD 4NE6A 3AYWB 2HIOB 5C3IB 3UTAC 1P3PB 1ZLAA 4ZUXD 3UT9D 3AZMB 1HQ3A 3C1BB 1AOID 2Y2PA 5B33A 3UTAD 3W98A 1ID3C 1P3ID 5AV5C 5E5AC 1P3BC 4YM6B 4DRAA 3REIA 3B6FA 2Y2QA 3MNNC 1ID3D 5AV5D 3X1UC 3REHC 4WU8B 2F8NK 1P3BD 5B32B 2J8PA 5B40D 3X1VA 4LD9B 3AFAA 5B24C 3WA9C 1KX4A 3LZ1A 3EPHA 5GSUC 5E5AA 2FJ7B 4H9SA 3AZHB 3B0DB 3X1UD 1N1JA 5B1LB 5AV6C 4YS3D 3REHD 3C1CD 3AZIA 3MNNA 2NQBC 2YFVA 5GSUD 2ZY4A 2RIQA 4KGCB 1BH9A 1P3AC 5B24A 1P3OA 4X23A 1H3OA 2NQBD 4WU9B 3KXBD 5CHLB 5AV6A 3VH6W 3LZ0C 5JRGB 3LJAC 1WWSA 4E45A 2Y2MA 5KDMB 4AWLC 3W96C 5AV9B 3AV2A 5BO0A 5B31C 3LJAD 3MGRC 5B1MA 1P3AA 1BH8A 5JA4A 5DNNB 5GT3D 2PYOB 5GXQB 3AZGB 5CPKB 3VH6A 1JFIB 5B2IB 4M6BA 3WTPC 5CPIC 3AZLC 2Y2OA 4WNNA 5AV8D 2F8NB 5B2JA 5AY8A 3AZJD 1TAFA 1M1AC 3LELB 5B31A 4QLCD 3REJC 1P34A 4WZSB 3AZLD 2CV5A 3KWQB 2CWEA 4UUZA 3AZEB 1U35A 3UTBD 4J8WC 3R45A 5AVCC 3WTPA 1M1AD 1F66D 5CPIA 4J8XD 3REJD 5CPJD 5B0ZB 3AYWC 4CAYB 5GT0A 1P3PC 1ZLAB 3MGQD 3AZMC 4J8WD 3H0RC 1HQ3B 5AVCD 2XD1A 3AYWD 2IO5B 3W98B 2HIOD 3NQJA 4H9RA 3VH5W 1P3PD 4H9NA 4J8VA 4E44A 3AZMD 3WKJC 2Y2HA 3AN2C 3C1BD 3REIB 4ZBJB 3B6FB 4XUJB 2HUEB 2ZY5A 2AROC 1P3FC 2BYKB 1M19C 4WU8C 3LZ1B 3AZKA 3B0BA 1P3LB 5FUGA 3B0DC 3AN2A 4CSRA 5AVBB 3MGSA 1M18A 3RELA 4WU8D 3AZIB 5B32D 4H9QA 5CP6A 4LD9D 1P3FA 4J8UB 2YFVB 2BYMA 3AZNB 1M19A 2FJ7D 4KGCC 1BH9B 1TZYC 5B1LD 1P3OB 2W8SA 1H3OB 3X1SB 1B6WA 3AZFC 1KX5A 3A6NC 3W97B 4Z66A 4JJNB 4KGCD 1TZYD 4H9PB 3AZFD 4WU9D 3EG5B 3AV2B 3WAAC 3NQUB 5AV9C 4G92C 5B1MB 5B0YB 5JRGD 1WWIA 5DNNC 1S32A 3VH5T 5GXQC 1P3KC 3KSYA 3AZGC 5CPKC 3TU4C 5AV9D 3B6GA 4R8PA 4WNNB 4DQYB 3UT9C 3MGPC 3KUYB 4KHAB 5DNND 2PYOD 4UPKA 5GXQD 3WAAA 4KUDA 1AOIC 3AZGD 3LELC 3TU4D 5CPKD 1P34B 2NZDB 1P3GA 3A1KA 3KWQC 1P3MC 3MGPD 1P3IC 3AZEC 3R45B 3AV1C 2F8ND 5DNMA 3LELD 2F8NG 5B0ZC 3W99B 5BS7A 1PZRA 4ZUXA 3KWQD 1P3MD 3AZED 4XZQA 3AV1D 1AOIA 3UTAA 2Y2IA 5B40C 5B0ZD 2IO5C 4J8VB 1ZLAD 4HGAC 4YS3C 3C1CC 2Y2NA 1HQ3D 2RVQC 3IP4C 1ID3A 4ZBJC 5G49B 5AV5A 4NE5A 3REKB 1P3BA 5B40A 2RVQD 5BNVA 3REID 3B6FD 4XUJD 3X1UA 3KXBC 5F99B 3AZKB 3REHA 5BT1C 4EO5B 1P3LC 4CSRB 3RELB 5AVBC 3WA9A 4Z5TB 3KFUG 4H9QB 5GSUA 5BT1D 4J8UC 3X1TC 3AZNC 1P3LD 2G5HC 1EQZB 5GT3C 2NQBA 5AVBD 3AZID 3MVDB 4J8UD 5AV8C 3X1TD 3AZND 1R4VA 3O62C 3AZJC 4QLCC 3X1SD 3LZ0A 3LJAA 2LY8A 3B0CW 1KU5A 5GT3A 3W97D 4JJND 1HTAA 3O62D 3W96A 3UTBC 1F66C 4J8XC 5CPJC 3MGRA 3B6GB 3AV2D 1KX3C 2ZM5A 5B1MD 5B0YD 3MGQC 3AZJA 4KUDB 3AZLA 3V9RA 2YFWA 2NZDC 2HIOC 1KX3D 4DRBA 5C3IC 1P3GB 1M1AA 1F66A 3KUYD 4H9OA 4J8XA 3REJA 3C1BC 5DNMB 5B33B 2NZDD 1P34D 3W99C 4J8WA 3EPLA 4XZQB 5AVCA 3AYWA 3VH6T 2HIOA 4YM6C 1P3PA 4NE3A 3W99D 3AZMA 3C1BA 4Z2MG 2XD5A 4YM6D 5B32C 3X1VB 3AFAB 4LD9C 1KX4B 3A1IA 5E5AB 2DQNC 3WKJA 1B67A 2FJ7C 1N1JB 3REKC 3AZHC 1ULYA 5B1LC 3MNNB 2AROA 1Z2CB 3X1UB 5B32G 5F99C 3REKD 4WU8A 3AZHD 5B24B 4LD9A 3WA9B 4X23B 3AZHA 2DF4C 4WU9C 3H0LC 5AV6B 2ZY3A 5F99D 3AZKD 5JRGC 3EPJA 5BNXA 4Z5TD 5BO0B 3MVDC 4KGCA 1TZYA 1P3AB 1BH8B 5JA4B 1EQZD 4WJ3C 2PYOC 3AZFA 3A6NA 3LZ0B 3LJAB 5JRGA 5B2IC 3MVDD 4AWLB 3W96B 5B2JB 5AY8B 1TAFB 5AV9A 2G5IC 5B31B 3MGRB 5B2ID 2CV5B 5DNNA 4UUZB 2PYOA 1U35B 5GXQA 1P3KA 2FFFB 3AZGA 3WTPB 3TU4A 5CPKA 5CPIB 1W2EA 2JCHA 5GT0B 3UT9A 3MGPA 3B6GD 1ZLAC 2F8NA 4H9OB 3LELA 1HQ3C 3NQJB 4H9RB 3KWQA 1P3MA 1P3IA 3W98C 2F2AC 4H9NB 3AZEA 1P3GD 3AV1A 5B0ZA 5DNMD 3REIC 4CAYA 3B6FC 5B33D 4XUJC 3W98D 2HUEC 4XZQD 3X1VC 3AFAC 4YS3A 1KX4C 3LZ1C 3WKJB 5FUGB 3C1CA 4H9SC 3AL0C 3AN2B 3MGSB 1M18B 4XUJA 5CP6B 3AZIC 3X1VD 3AFAD 2AROB 1P3FB 2BYMB 1KX4D 3LZ1D 1M19B 2BYKA 5E5AD 3H0MC 1P3OC 2ZY2A 4X23C 3KXBA 3MNND 3X1SC 1KX5B 3FDDA 1P3LA 4Z66B 3W97C 5AVBA 4JJNC 5BNXB 2VQRA 4WV4B 5B24D 1P3OD 3WA9D 4X23D 1T3UA 4J8UA 2UWXA 3X1TA 3AZNA 3AV2C 1TZYB 5AV6D 5B1MC 5B0YC 2Y2KA 1S32B 3F6TA 3AZFB 3X1SA 3A6NB 3W97A 5AV8A 4R8PB 4JJNA 3O62A 1P3AD 4H9PA 3KUYC 4QLCA 5B2JC 5AY8C 3WAAB 4G91B 4G92B 3NQUA 3LZ0D 1A7WA 2L5AA 1P34C 5B0YA 2CV5C 3UTBA 1P3KB 1U35C 3W96D 3WTPE 5B2JD 5AY8D 3TU4B 5CPJA 1KX3A 5B31D 3MGRD 4ZUXB 3UT9B 3MGPB 3MGQA 2CV5D 5GT0C 5B31G 3KUYA 4KHAA 1U35D 3P5JB 1AOIB 4Z2MH 3UTAB 3WTPD 2NZDA 5CPID 1P3MB 1P3IB 5GT0D 3AV1B 4J8VC 1BFMA 1Q9CA 3W99A 1ID3B 5AV5B 4J8VD 1P3BB 5B40B 4YM6A 3B0CT 5BNVB 4HGAB 4YS3B 3REHB 3C1CB 3AZKC 4EO5C 5B32A 3MGSC 1M18C 3RELC 5G49A 4Z5TC 5GSUB 5CP6C 2FJ7A 3REKA 4NFTA 5B1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ D;  1EQZ C;  3AN2 D;  2NQB B;  3MGS D;  1M18 D;  3VH5 A;  3REL D;  3KXB B;  5CP6 D;  5F99 A;  2ARO D;  1P3F D;  1KX5 C;  2JSS A;  1M19 D;  4Z66 C;  4Z5T A;  4WU9 A;  3X1T B;  1KX5 D;  5GT3 B;  1EQZ A;  4Z66 D;  5KDM A;  1S32 C;  1F1E A;  3MVD A;  2F8N H;  5AV8 B;  3B6G C;  4R8P C;  3O62 B;  3AZJ B;  4QLC B;  1S32 D;  3AZL B;  3A6N D;  5B2I A;  1JFI A;  4KUD C;  3V9R B;  4G91 C;  2YFW B;  4R8P D;  3UTB B;  1P3G C;  1M1A B;  1F66 B;  4J8X B;  3REJ B;  5CPJ B;  1KX3 B;  3WAA D;  4KUD D;  5DNM C;  5B33 C;  3MGQ B;  5BS7 C;  4ZUX C;  4J8W B;  5AVC B;  4XZQ C;  1P3K D;  4NE6 A;  3AYW B;  2HIO B;  5C3I B;  3UTA C;  1P3P B;  1ZLA A;  4ZUX D;  3UT9 D;  3AZM B;  1HQ3 A;  3C1B B;  1AOI D;  5B33 A;  3UTA D;  3W98 A;  1ID3 C;  1P3I D;  5AV5 C;  5E5A C;  1P3B C;  4YM6 B;  4DRA A;  3REI A;  3B6F A;  3MNN C;  1ID3 D;  5AV5 D;  3X1U C;  3REH C;  4WU8 B;  2F8N K;  1P3B D;  5B32 B;  5B40 D;  4LD9 B;  3X1V A;  3AFA A;  5B24 C;  3WA9 C;  1KX4 A;  3LZ1 A;  5GSU C;  5E5A A;  2FJ7 B;  4H9S A;  3AZH B;  3B0D B;  3X1U D;  1N1J A;  5B1L B;  5AV6 C;  4YS3 D;  3REH D;  3C1C D;  3AZI A;  3MNN A;  2NQB C;  2YFV A;  5GSU D;  4KGC B;  1BH9 A;  1P3A C;  5B24 A;  1P3O A;  4X23 A;  1H3O A;  2NQB D;  4WU9 B;  3KXB D;  5CHL B;  5AV6 A;  3VH6 W;  3LZ0 C;  5JRG B;  3LJA C;  1WWS A;  4E45 A;  5KDM B;  4AWL C;  3W96 C;  5AV9 B;  3AV2 A;  5BO0 A;  5B31 C;  3LJA D;  3MGR C;  5B1M A;  1P3A A;  1BH8 A;  5JA4 A;  5DNN B;  5GT3 D;  2PYO B;  5GXQ B;  3AZG B;  5CPK B;  3VH6 A;  1JFI B;  5B2I B;  4M6B A;  3WTP C;  5CPI C;  3AZL C;  4WNN A;  5AV8 D;  2F8N B;  5B2J A;  5AY8 A;  3AZJ D;  1TAF A;  1M1A C;  3LEL B;  5B31 A;  4QLC D;  3REJ C;  1P34 A;  4WZS B;  3AZL D;  2CV5 A;  3KWQ B;  2CWE A;  4UUZ A;  3AZE B;  1U35 A;  3UTB D;  4J8W C;  3R45 A;  5AVC C;  3WTP A;  1M1A D;  1F66 D;  5CPI A;  4J8X D;  3REJ D;  5CPJ D;  5B0Z B;  3AYW C;  4CAY B;  5GT0 A;  1P3P C;  1ZLA B;  3MGQ D;  3AZM C;  4J8W D;  1HQ3 B;  5AVC D;  3AYW D;  2IO5 B;  3W98 B;  2HIO D;  3NQJ A;  4H9R A;  3VH5 W;  1P3P D;  4H9N A;  4J8V A;  4E44 A;  3AZM D;  3WKJ C;  3AN2 C;  3C1B D;  3REI B;  4ZBJ B;  3B6F B;  4XUJ B;  2HUE B;  2ARO C;  1P3F C;  2BYK B;  1M19 C;  4WU8 C;  3LZ1 B;  3AZK A;  3B0B A;  1P3L B;  5FUG A;  3B0D C;  3AN2 A;  4CSR A;  5AVB B;  3MGS A;  1M18 A;  3REL A;  4WU8 D;  3AZI B;  5B32 D;  4H9Q A;  5CP6 A;  4LD9 D;  1P3F A;  4J8U B;  2YFV B;  2BYM A;  3AZN B;  1M19 A;  2FJ7 D;  4KGC C;  1BH9 B;  1TZY C;  5B1L D;  1P3O B;  1H3O B;  3X1S B;  1B6W A;  3AZF C;  1KX5 A;  3A6N C;  3W97 B;  4Z66 A;  4JJN B;  4KGC D;  1TZY D;  4H9P B;  3AZF D;  4WU9 D;  3AV2 B;  3WAA C;  3NQU B;  5AV9 C;  4G92 C;  5B1M B;  5B0Y B;  5JRG D;  1WWI A;  5DNN C;  1S32 A;  3VH5 T;  5GXQ C;  1P3K C;  3KSY A;  3AZG C;  5CPK C;  3TU4 C;  5AV9 D;  3B6G A;  4R8P A;  4WNN B;  3UT9 C;  3MGP C;  3KUY B;  4KHA B;  5DNN D;  2PYO D;  5GXQ D;  3WAA A;  4KUD A;  1AOI C;  3AZG D;  3LEL C;  3TU4 D;  5CPK D;  1P34 B;  2NZD B;  1P3G A;  3KWQ C;  1P3M C;  3MGP D;  1P3I C;  3AZE C;  3R45 B;  3AV1 C;  2F8N D;  5DNM A;  3LEL D;  2F8N G;  5B0Z C;  3W99 B;  5BS7 A;  4ZUX A;  3KWQ D;  1P3M D;  3AZE D;  4XZQ A;  3AV1 D;  1AOI A;  3UTA A;  5B40 C;  5B0Z D;  2IO5 C;  4J8V B;  1ZLA D;  4HGA C;  4YS3 C;  3C1C C;  1HQ3 D;  2RVQ C;  1ID3 A;  4ZBJ C;  5G49 B;  5AV5 A;  4NE5 A;  3REK B;  1P3B A;  5B40 A;  2RVQ D;  5BNV A;  3REI D;  3B6F D;  4XUJ D;  3X1U A;  3KXB C;  5F99 B;  3AZK B;  3REH A;  5BT1 C;  4EO5 B;  1P3L C;  4CSR B;  3REL B;  5AVB C;  3WA9 A;  4Z5T B;  4H9Q B;  5GSU A;  5BT1 D;  4J8U C;  3X1T C;  3AZN C;  1P3L D;  1EQZ B;  5GT3 C;  2NQB A;  5AVB D;  3AZI D;  3MVD B;  4J8U D;  5AV8 C;  3X1T D;  3AZN D;  1R4V A;  3O62 C;  3AZJ C;  4QLC C;  3X1S D;  3LZ0 A;  3LJA A;  2LY8 A;  3B0C W;  1KU5 A;  5GT3 A;  3W97 D;  4JJN D;  1HTA A;  3O62 D;  3W96 A;  3UTB C;  1F66 C;  4J8X C;  5CPJ C;  3MGR A;  3B6G B;  3AV2 D;  1KX3 C;  5B1M D;  5B0Y D;  3MGQ C;  3AZJ A;  4KUD B;  3AZL A;  3V9R A;  2YFW A;  2NZD C;  2HIO C;  1KX3 D;  4DRB A;  5C3I C;  1P3G B;  1M1A A;  1F66 A;  3KUY D;  4H9O A;  4J8X A;  3REJ A;  3C1B C;  5DNM B;  5B33 B;  2NZD D;  1P34 D;  3W99 C;  4J8W A;  4XZQ B;  5AVC A;  3AYW A;  3VH6 T;  2HIO A;  4YM6 C;  1P3P A;  4NE3 A;  3W99 D;  3AZM A;  3C1B A;  4Z2M G;  4YM6 D;  5B32 C;  3X1V B;  3AFA B;  4LD9 C;  1KX4 B;  5E5A B;  3WKJ A;  1B67 A;  2FJ7 C;  1N1J B;  3REK C;  3AZH C;  1ULY A;  5B1L C;  3MNN B;  2ARO A;  3X1U B;  5B32 G;  5F99 C;  3REK D;  4WU8 A;  3AZH D;  5B24 B;  4LD9 A;  3WA9 B;  4X23 B;  3AZH A;  4WU9 C;  5AV6 B;  5F99 D;  3AZK D;  5JRG C;  5BNX A;  4Z5T D;  5BO0 B;  3MVD C;  4KGC A;  1TZY A;  1P3A B;  1BH8 B;  5JA4 B;  1EQZ D;  2PYO C;  3AZF A;  3A6N A;  3LZ0 B;  3LJA B;  5JRG A;  5B2I C;  3MVD D;  4AWL B;  3W96 B;  5B2J B;  5AY8 B;  1TAF B;  5AV9 A;  5B31 B;  3MGR B;  5B2I D;  2CV5 B;  5DNN A;  4UUZ B;  2PYO A;  1U35 B;  5GXQ A;  1P3K A;  3AZG A;  3WTP B;  3TU4 A;  5CPK A;  5CPI B;  3UT9 A;  5GT0 B;  3B6G D;  3MGP A;  1ZLA C;  2F8N A;  4H9O B;  3LEL A;  1HQ3 C;  3NQJ B;  4H9R B;  3KWQ A;  1P3M A;  1P3I A;  3W98 C;  4H9N B;  3AZE A;  1P3G D;  3AV1 A;  5B0Z A;  5DNM D;  3REI C;  4CAY A;  3B6F C;  5B33 D;  4XUJ C;  3W98 D;  2HUE C;  4XZQ D;  3X1V C;  3AFA C;  4YS3 A;  1KX4 C;  3LZ1 C;  3WKJ B;  5FUG B;  3C1C A;  4H9S C;  3AN2 B;  3MGS B;  1M18 B;  4XUJ A;  5CP6 B;  3AZI C;  3X1V D;  3AFA D;  2ARO B;  1P3F B;  2BYM B;  1KX4 D;  3LZ1 D;  1M19 B;  2BYK A;  5E5A D;  1P3O C;  4X23 C;  3KXB A;  3MNN D;  3X1S C;  1KX5 B;  1P3L A;  4Z66 B;  3W97 C;  5AVB A;  4JJN C;  5BNX B;  4WV4 B;  5B24 D;  1P3O D;  3WA9 D;  4X23 D;  4J8U A;  3X1T A;  3AZN A;  3AV2 C;  1TZY B;  5AV6 D;  5B1M C;  5B0Y C;  1S32 B;  3AZF B;  3X1S A;  3A6N B;  3W97 A;  5AV8 A;  4R8P B;  4JJN A;  3O62 A;  1P3A D;  4H9P A;  3KUY C;  4QLC A;  5B2J C;  5AY8 C;  3WAA B;  4G91 B;  4G92 B;  3NQU A;  3LZ0 D;  1A7W A;  2L5A A;  1P34 C;  5B0Y A;  2CV5 C;  3UTB A;  1P3K B;  1U35 C;  3W96 D;  3WTP E;  5B2J D;  5AY8 D;  3TU4 B;  5CPJ A;  1KX3 A;  5B31 D;  3MGR D;  4ZUX B;  3UT9 B;  3MGP B;  3MGQ A;  2CV5 D;  5GT0 C;  5B31 G;  3KUY A;  4KHA A;  1U35 D;  1AOI B;  4Z2M H;  3UTA B;  3WTP D;  2NZD A;  5CPI D;  1P3M B;  1P3I B;  5GT0 D;  3AV1 B;  4J8V C;  1BFM A;  1Q9C A;  3W99 A;  1ID3 B;  5AV5 B;  4J8V D;  1P3B B;  5B40 B;  4YM6 A;  3B0C T;  5BNV B;  4HGA B;  4YS3 B;  3REH B;  3C1C B;  3AZK C;  4EO5 C;  5B32 A;  3MGS C;  1M18 C;  3REL C;  5G49 A;  4Z5T C;  5GSU B;  5CP6 C;  2FJ7 A;  3REK A;  4NFT A;  5B1L A; 
#chains in the Genus database with same CATH topology
 3WKJ D;  1EQZ C;  3AN2 D;  2NQB B;  3MGS D;  1M18 D;  3VH5 A;  3REL D;  3KXB B;  2BG1 A;  5CP6 D;  5F99 A;  2ARO D;  1P3F D;  2JE5 A;  1KX5 C;  2Y2J A;  2JSS A;  1M19 D;  4Z66 C;  4Z5T A;  4WU9 A;  3EPK A;  3X1T B;  1KX5 D;  5GT3 B;  1EQZ A;  4Z66 D;  5KDM A;  1S32 C;  1F1E A;  3MVD A;  2F8N H;  5AV8 B;  3B6G C;  4R8P C;  3O62 B;  3AZJ B;  4QLC B;  1S32 D;  3AZL B;  3A6N D;  5B2I A;  1JFI A;  4KUD C;  3V9R B;  4G91 C;  2YFW B;  2Y2G A;  4R8P D;  3UTB B;  1P3G C;  1M1A B;  1F66 B;  4J8X B;  3REJ B;  5CPJ B;  2Y2L A;  1KX3 B;  3WAA D;  4KUD D;  5DNM C;  5B33 C;  3MGQ B;  5BS7 C;  4ZUX C;  4J8W B;  5AVC B;  4XZQ C;  1P3K D;  4NE6 A;  3AYW B;  2HIO B;  5C3I B;  3UTA C;  1P3P B;  1ZLA A;  4ZUX D;  3UT9 D;  3AZM B;  1HQ3 A;  3C1B B;  1AOI D;  2Y2P A;  5B33 A;  3UTA D;  3W98 A;  1ID3 C;  1P3I D;  5AV5 C;  5E5A C;  1P3B C;  4YM6 B;  4DRA A;  3REI A;  3B6F A;  2Y2Q A;  3MNN C;  1ID3 D;  5AV5 D;  3X1U C;  3REH C;  4WU8 B;  2F8N K;  1P3B D;  5B32 B;  2J8P A;  5B40 D;  3X1V A;  4LD9 B;  3AFA A;  5B24 C;  3WA9 C;  1KX4 A;  3LZ1 A;  3EPH A;  5GSU C;  5E5A A;  2FJ7 B;  4H9S A;  3AZH B;  3B0D B;  3X1U D;  1N1J A;  5B1L B;  5AV6 C;  4YS3 D;  3REH D;  3C1C D;  3AZI A;  3MNN A;  2NQB C;  2YFV A;  5GSU D;  2ZY4 A;  2RIQ A;  4KGC B;  1BH9 A;  1P3A C;  5B24 A;  1P3O A;  4X23 A;  1H3O A;  2NQB D;  4WU9 B;  3KXB D;  5CHL B;  5AV6 A;  3VH6 W;  3LZ0 C;  5JRG B;  3LJA C;  1WWS A;  4E45 A;  2Y2M A;  5KDM B;  4AWL C;  3W96 C;  5AV9 B;  3AV2 A;  5BO0 A;  5B31 C;  3LJA D;  3MGR C;  5B1M A;  1P3A A;  1BH8 A;  5JA4 A;  5DNN B;  5GT3 D;  2PYO B;  5GXQ B;  3AZG B;  5CPK B;  3VH6 A;  1JFI B;  5B2I B;  4M6B A;  3WTP C;  5CPI C;  3AZL C;  2Y2O A;  4WNN A;  5AV8 D;  2F8N B;  5B2J A;  5AY8 A;  3AZJ D;  1TAF A;  1M1A C;  3LEL B;  5B31 A;  4QLC D;  3REJ C;  1P34 A;  4WZS B;  3AZL D;  2CV5 A;  3KWQ B;  2CWE A;  4UUZ A;  3AZE B;  1U35 A;  3UTB D;  4J8W C;  3R45 A;  5AVC C;  3WTP A;  1M1A D;  1F66 D;  5CPI A;  4J8X D;  3REJ D;  5CPJ D;  5B0Z B;  3AYW C;  4CAY B;  5GT0 A;  1P3P C;  1ZLA B;  3MGQ D;  3AZM C;  4J8W D;  3H0R C;  1HQ3 B;  5AVC D;  2XD1 A;  3AYW D;  2IO5 B;  3W98 B;  2HIO D;  3NQJ A;  4H9R A;  3VH5 W;  1P3P D;  4H9N A;  4J8V A;  4E44 A;  3AZM D;  3WKJ C;  2Y2H A;  3AN2 C;  3C1B D;  3REI B;  4ZBJ B;  3B6F B;  4XUJ B;  2HUE B;  2ZY5 A;  2ARO C;  1P3F C;  2BYK B;  1M19 C;  4WU8 C;  3LZ1 B;  3AZK A;  3B0B A;  1P3L B;  5FUG A;  3B0D C;  3AN2 A;  4CSR A;  5AVB B;  3MGS A;  1M18 A;  3REL A;  4WU8 D;  3AZI B;  5B32 D;  4H9Q A;  5CP6 A;  4LD9 D;  1P3F A;  4J8U B;  2YFV B;  2BYM A;  3AZN B;  1M19 A;  2FJ7 D;  4KGC C;  1BH9 B;  1TZY C;  5B1L D;  1P3O B;  2W8S A;  1H3O B;  3X1S B;  1B6W A;  3AZF C;  1KX5 A;  3A6N C;  3W97 B;  4Z66 A;  4JJN B;  4KGC D;  1TZY D;  4H9P B;  3AZF D;  4WU9 D;  3EG5 B;  3AV2 B;  3WAA C;  3NQU B;  5AV9 C;  4G92 C;  5B1M B;  5B0Y B;  5JRG D;  1WWI A;  5DNN C;  1S32 A;  3VH5 T;  5GXQ C;  1P3K C;  3KSY A;  3AZG C;  5CPK C;  3TU4 C;  5AV9 D;  3B6G A;  4R8P A;  4WNN B;  4DQY B;  3UT9 C;  3MGP C;  3KUY B;  4KHA B;  5DNN D;  2PYO D;  4UPK A;  5GXQ D;  3WAA A;  4KUD A;  1AOI C;  3AZG D;  3LEL C;  3TU4 D;  5CPK D;  1P34 B;  2NZD B;  1P3G A;  3A1K A;  3KWQ C;  1P3M C;  3MGP D;  1P3I C;  3AZE C;  3R45 B;  3AV1 C;  2F8N D;  5DNM A;  3LEL D;  2F8N G;  5B0Z C;  3W99 B;  5BS7 A;  1PZR A;  4ZUX A;  3KWQ D;  1P3M D;  3AZE D;  4XZQ A;  3AV1 D;  1AOI A;  3UTA A;  2Y2I A;  5B40 C;  5B0Z D;  2IO5 C;  4J8V B;  1ZLA D;  4HGA C;  4YS3 C;  3C1C C;  2Y2N A;  1HQ3 D;  2RVQ C;  3IP4 C;  1ID3 A;  4ZBJ C;  5G49 B;  5AV5 A;  4NE5 A;  3REK B;  1P3B A;  5B40 A;  2RVQ D;  5BNV A;  3REI D;  3B6F D;  4XUJ D;  3X1U A;  3KXB C;  5F99 B;  3AZK B;  3REH A;  5BT1 C;  4EO5 B;  1P3L C;  4CSR B;  3REL B;  5AVB C;  3WA9 A;  4Z5T B;  3KFU G;  4H9Q B;  5GSU A;  5BT1 D;  4J8U C;  3X1T C;  3AZN C;  1P3L D;  2G5H C;  1EQZ B;  5GT3 C;  2NQB A;  5AVB D;  3AZI D;  3MVD B;  4J8U D;  5AV8 C;  3X1T D;  3AZN D;  1R4V A;  3O62 C;  3AZJ C;  4QLC C;  3X1S D;  3LZ0 A;  3LJA A;  2LY8 A;  3B0C W;  1KU5 A;  5GT3 A;  3W97 D;  4JJN D;  1HTA A;  3O62 D;  3W96 A;  3UTB C;  1F66 C;  4J8X C;  5CPJ C;  3MGR A;  3B6G B;  3AV2 D;  1KX3 C;  2ZM5 A;  5B1M D;  5B0Y D;  3MGQ C;  3AZJ A;  4KUD B;  3AZL A;  3V9R A;  2YFW A;  2NZD C;  2HIO C;  1KX3 D;  4DRB A;  5C3I C;  1P3G B;  1M1A A;  1F66 A;  3KUY D;  4H9O A;  4J8X A;  3REJ A;  3C1B C;  5DNM B;  5B33 B;  2NZD D;  1P34 D;  3W99 C;  4J8W A;  3EPL A;  4XZQ B;  5AVC A;  3AYW A;  3VH6 T;  2HIO A;  4YM6 C;  1P3P A;  4NE3 A;  3W99 D;  3AZM A;  3C1B A;  4Z2M G;  2XD5 A;  4YM6 D;  5B32 C;  3X1V B;  3AFA B;  4LD9 C;  1KX4 B;  3A1I A;  5E5A B;  2DQN C;  3WKJ A;  1B67 A;  2FJ7 C;  1N1J B;  3REK C;  3AZH C;  1ULY A;  5B1L C;  3MNN B;  2ARO A;  1Z2C B;  3X1U B;  5B32 G;  5F99 C;  3REK D;  4WU8 A;  3AZH D;  5B24 B;  4LD9 A;  3WA9 B;  4X23 B;  3AZH A;  2DF4 C;  4WU9 C;  3H0L C;  5AV6 B;  2ZY3 A;  5F99 D;  3AZK D;  5JRG C;  3EPJ A;  5BNX A;  4Z5T D;  5BO0 B;  3MVD C;  4KGC A;  1TZY A;  1P3A B;  1BH8 B;  5JA4 B;  1EQZ D;  4WJ3 C;  2PYO C;  3AZF A;  3A6N A;  3LZ0 B;  3LJA B;  5JRG A;  5B2I C;  3MVD D;  4AWL B;  3W96 B;  5B2J B;  5AY8 B;  1TAF B;  5AV9 A;  2G5I C;  5B31 B;  3MGR B;  5B2I D;  2CV5 B;  5DNN A;  4UUZ B;  2PYO A;  1U35 B;  5GXQ A;  1P3K A;  2FFF B;  3AZG A;  3WTP B;  3TU4 A;  5CPK A;  5CPI B;  1W2E A;  2JCH A;  5GT0 B;  3UT9 A;  3MGP A;  3B6G D;  1ZLA C;  2F8N A;  4H9O B;  3LEL A;  1HQ3 C;  3NQJ B;  4H9R B;  3KWQ A;  1P3M A;  1P3I A;  3W98 C;  2F2A C;  4H9N B;  3AZE A;  1P3G D;  3AV1 A;  5B0Z A;  5DNM D;  3REI C;  4CAY A;  3B6F C;  5B33 D;  4XUJ C;  3W98 D;  2HUE C;  4XZQ D;  3X1V C;  3AFA C;  4YS3 A;  1KX4 C;  3LZ1 C;  3WKJ B;  5FUG B;  3C1C A;  4H9S C;  3AL0 C;  3AN2 B;  3MGS B;  1M18 B;  4XUJ A;  5CP6 B;  3AZI C;  3X1V D;  3AFA D;  2ARO B;  1P3F B;  2BYM B;  1KX4 D;  3LZ1 D;  1M19 B;  2BYK A;  5E5A D;  3H0M C;  1P3O C;  2ZY2 A;  4X23 C;  3KXB A;  3MNN D;  3X1S C;  1KX5 B;  3FDD A;  1P3L A;  4Z66 B;  3W97 C;  5AVB A;  4JJN C;  5BNX B;  2VQR A;  4WV4 B;  5B24 D;  1P3O D;  3WA9 D;  4X23 D;  1T3U A;  4J8U A;  2UWX A;  3X1T A;  3AZN A;  3AV2 C;  1TZY B;  5AV6 D;  5B1M C;  5B0Y C;  2Y2K A;  1S32 B;  3F6T A;  3AZF B;  3X1S A;  3A6N B;  3W97 A;  5AV8 A;  4R8P B;  4JJN A;  3O62 A;  1P3A D;  4H9P A;  3KUY C;  4QLC A;  5B2J C;  5AY8 C;  3WAA B;  4G91 B;  4G92 B;  3NQU A;  3LZ0 D;  1A7W A;  2L5A A;  1P34 C;  5B0Y A;  2CV5 C;  3UTB A;  1P3K B;  1U35 C;  3W96 D;  3WTP E;  5B2J D;  5AY8 D;  3TU4 B;  5CPJ A;  1KX3 A;  5B31 D;  3MGR D;  4ZUX B;  3UT9 B;  3MGP B;  3MGQ A;  2CV5 D;  5GT0 C;  5B31 G;  3KUY A;  4KHA A;  1U35 D;  3P5J B;  1AOI B;  4Z2M H;  3UTA B;  3WTP D;  2NZD A;  5CPI D;  1P3M B;  1P3I B;  5GT0 D;  3AV1 B;  4J8V C;  1BFM A;  1Q9C A;  3W99 A;  1ID3 B;  5AV5 B;  4J8V D;  1P3B B;  5B40 B;  4YM6 A;  3B0C T;  5BNV B;  4HGA B;  4YS3 B;  3REH B;  3C1C B;  3AZK C;  4EO5 C;  5B32 A;  3MGS C;  1M18 C;  3REL C;  5G49 A;  4Z5T C;  5GSU B;  5CP6 C;  2FJ7 A;  3REK A;  4NFT A;  5B1L A; 
#chains in the Genus database with same CATH homology
 3WKJ D;  1EQZ C;  3AN2 D;  2NQB B;  3MGS D;  1M18 D;  3VH5 A;  3REL D;  3KXB B;  2BG1 A;  5CP6 D;  5F99 A;  2ARO D;  1P3F D;  2JE5 A;  1KX5 C;  2Y2J A;  2JSS A;  1M19 D;  4Z66 C;  4Z5T A;  4WU9 A;  3EPK A;  3X1T B;  1KX5 D;  5GT3 B;  1EQZ A;  4Z66 D;  5KDM A;  1S32 C;  1F1E A;  3MVD A;  2F8N H;  5AV8 B;  3B6G C;  4R8P C;  3O62 B;  3AZJ B;  4QLC B;  1S32 D;  3AZL B;  3A6N D;  5B2I A;  1JFI A;  4KUD C;  3V9R B;  4G91 C;  2YFW B;  2Y2G A;  4R8P D;  3UTB B;  1P3G C;  1M1A B;  1F66 B;  4J8X B;  3REJ B;  5CPJ B;  2Y2L A;  1KX3 B;  3WAA D;  4KUD D;  5DNM C;  5B33 C;  3MGQ B;  5BS7 C;  4ZUX C;  4J8W B;  5AVC B;  4XZQ C;  1P3K D;  4NE6 A;  3AYW B;  2HIO B;  5C3I B;  3UTA C;  1P3P B;  1ZLA A;  4ZUX D;  3UT9 D;  3AZM B;  1HQ3 A;  3C1B B;  1AOI D;  2Y2P A;  5B33 A;  3UTA D;  3W98 A;  1ID3 C;  1P3I D;  5AV5 C;  5E5A C;  1P3B C;  4YM6 B;  4DRA A;  3REI A;  3B6F A;  2Y2Q A;  3MNN C;  1ID3 D;  5AV5 D;  3X1U C;  3REH C;  4WU8 B;  2F8N K;  1P3B D;  5B32 B;  2J8P A;  5B40 D;  3X1V A;  4LD9 B;  3AFA A;  5B24 C;  3WA9 C;  1KX4 A;  3LZ1 A;  3EPH A;  5GSU C;  5E5A A;  2FJ7 B;  4H9S A;  3AZH B;  3B0D B;  3X1U D;  1N1J A;  5B1L B;  5AV6 C;  4YS3 D;  3REH D;  3C1C D;  3AZI A;  3MNN A;  2NQB C;  2YFV A;  5GSU D;  2ZY4 A;  2RIQ A;  4KGC B;  1BH9 A;  1P3A C;  5B24 A;  1P3O A;  4X23 A;  1H3O A;  2NQB D;  4WU9 B;  3KXB D;  5CHL B;  5AV6 A;  3VH6 W;  3LZ0 C;  5JRG B;  3LJA C;  1WWS A;  4E45 A;  2Y2M A;  5KDM B;  4AWL C;  3W96 C;  5AV9 B;  3AV2 A;  5BO0 A;  5B31 C;  3LJA D;  3MGR C;  5B1M A;  1P3A A;  1BH8 A;  5JA4 A;  5DNN B;  5GT3 D;  2PYO B;  5GXQ B;  3AZG B;  5CPK B;  3VH6 A;  1JFI B;  5B2I B;  4M6B A;  3WTP C;  5CPI C;  3AZL C;  2Y2O A;  4WNN A;  5AV8 D;  2F8N B;  5B2J A;  5AY8 A;  3AZJ D;  1TAF A;  1M1A C;  3LEL B;  5B31 A;  4QLC D;  3REJ C;  1P34 A;  4WZS B;  3AZL D;  2CV5 A;  3KWQ B;  2CWE A;  4UUZ A;  3AZE B;  1U35 A;  3UTB D;  4J8W C;  3R45 A;  5AVC C;  3WTP A;  1M1A D;  1F66 D;  5CPI A;  4J8X D;  3REJ D;  5CPJ D;  5B0Z B;  3AYW C;  4CAY B;  5GT0 A;  1P3P C;  1ZLA B;  3MGQ D;  3AZM C;  4J8W D;  3H0R C;  1HQ3 B;  5AVC D;  2XD1 A;  3AYW D;  2IO5 B;  3W98 B;  2HIO D;  3NQJ A;  4H9R A;  3VH5 W;  1P3P D;  4H9N A;  4J8V A;  4E44 A;  3AZM D;  3WKJ C;  2Y2H A;  3AN2 C;  3C1B D;  3REI B;  4ZBJ B;  3B6F B;  4XUJ B;  2HUE B;  2ZY5 A;  2ARO C;  1P3F C;  2BYK B;  1M19 C;  4WU8 C;  3LZ1 B;  3AZK A;  3B0B A;  1P3L B;  5FUG A;  3B0D C;  3AN2 A;  4CSR A;  5AVB B;  3MGS A;  1M18 A;  3REL A;  4WU8 D;  3AZI B;  5B32 D;  4H9Q A;  5CP6 A;  4LD9 D;  1P3F A;  4J8U B;  2YFV B;  2BYM A;  3AZN B;  1M19 A;  2FJ7 D;  4KGC C;  1BH9 B;  1TZY C;  5B1L D;  1P3O B;  2W8S A;  1H3O B;  3X1S B;  1B6W A;  3AZF C;  1KX5 A;  3A6N C;  3W97 B;  4Z66 A;  4JJN B;  4KGC D;  1TZY D;  4H9P B;  3AZF D;  4WU9 D;  3EG5 B;  3AV2 B;  3WAA C;  3NQU B;  5AV9 C;  4G92 C;  5B1M B;  5B0Y B;  5JRG D;  1WWI A;  5DNN C;  1S32 A;  3VH5 T;  5GXQ C;  1P3K C;  3KSY A;  3AZG C;  5CPK C;  3TU4 C;  5AV9 D;  3B6G A;  4R8P A;  4WNN B;  4DQY B;  3UT9 C;  3MGP C;  3KUY B;  4KHA B;  5DNN D;  2PYO D;  4UPK A;  5GXQ D;  3WAA A;  4KUD A;  1AOI C;  3AZG D;  3LEL C;  3TU4 D;  5CPK D;  1P34 B;  2NZD B;  1P3G A;  3A1K A;  3KWQ C;  1P3M C;  3MGP D;  1P3I C;  3AZE C;  3R45 B;  3AV1 C;  2F8N D;  5DNM A;  3LEL D;  2F8N G;  5B0Z C;  3W99 B;  5BS7 A;  1PZR A;  4ZUX A;  3KWQ D;  1P3M D;  3AZE D;  4XZQ A;  3AV1 D;  1AOI A;  3UTA A;  2Y2I A;  5B40 C;  5B0Z D;  2IO5 C;  4J8V B;  1ZLA D;  4HGA C;  4YS3 C;  3C1C C;  2Y2N A;  1HQ3 D;  2RVQ C;  3IP4 C;  1ID3 A;  4ZBJ C;  5G49 B;  5AV5 A;  4NE5 A;  3REK B;  1P3B A;  5B40 A;  2RVQ D;  5BNV A;  3REI D;  3B6F D;  4XUJ D;  3X1U A;  3KXB C;  5F99 B;  3AZK B;  3REH A;  5BT1 C;  4EO5 B;  1P3L C;  4CSR B;  3REL B;  5AVB C;  3WA9 A;  4Z5T B;  3KFU G;  4H9Q B;  5GSU A;  5BT1 D;  4J8U C;  3X1T C;  3AZN C;  1P3L D;  2G5H C;  1EQZ B;  5GT3 C;  2NQB A;  5AVB D;  3AZI D;  3MVD B;  4J8U D;  5AV8 C;  3X1T D;  3AZN D;  1R4V A;  3O62 C;  3AZJ C;  4QLC C;  3X1S D;  3LZ0 A;  3LJA A;  2LY8 A;  3B0C W;  1KU5 A;  5GT3 A;  3W97 D;  4JJN D;  1HTA A;  3O62 D;  3W96 A;  3UTB C;  1F66 C;  4J8X C;  5CPJ C;  3MGR A;  3B6G B;  3AV2 D;  1KX3 C;  2ZM5 A;  5B1M D;  5B0Y D;  3MGQ C;  3AZJ A;  4KUD B;  3AZL A;  3V9R A;  2YFW A;  2NZD C;  2HIO C;  1KX3 D;  4DRB A;  5C3I C;  1P3G B;  1M1A A;  1F66 A;  3KUY D;  4H9O A;  4J8X A;  3REJ A;  3C1B C;  5DNM B;  5B33 B;  2NZD D;  1P34 D;  3W99 C;  4J8W A;  3EPL A;  4XZQ B;  5AVC A;  3AYW A;  3VH6 T;  2HIO A;  4YM6 C;  1P3P A;  4NE3 A;  3W99 D;  3AZM A;  3C1B A;  4Z2M G;  2XD5 A;  4YM6 D;  5B32 C;  3X1V B;  3AFA B;  4LD9 C;  1KX4 B;  3A1I A;  5E5A B;  2DQN C;  3WKJ A;  1B67 A;  2FJ7 C;  1N1J B;  3REK C;  3AZH C;  1ULY A;  5B1L C;  3MNN B;  2ARO A;  1Z2C B;  3X1U B;  5B32 G;  5F99 C;  3REK D;  4WU8 A;  3AZH D;  5B24 B;  4LD9 A;  3WA9 B;  4X23 B;  3AZH A;  2DF4 C;  4WU9 C;  3H0L C;  5AV6 B;  2ZY3 A;  5F99 D;  3AZK D;  5JRG C;  3EPJ A;  5BNX A;  4Z5T D;  5BO0 B;  3MVD C;  4KGC A;  1TZY A;  1P3A B;  1BH8 B;  5JA4 B;  1EQZ D;  4WJ3 C;  2PYO C;  3AZF A;  3A6N A;  3LZ0 B;  3LJA B;  5JRG A;  5B2I C;  3MVD D;  4AWL B;  3W96 B;  5B2J B;  5AY8 B;  1TAF B;  5AV9 A;  2G5I C;  5B31 B;  3MGR B;  5B2I D;  2CV5 B;  5DNN A;  4UUZ B;  2PYO A;  1U35 B;  5GXQ A;  1P3K A;  2FFF B;  3AZG A;  3WTP B;  3TU4 A;  5CPK A;  5CPI B;  1W2E A;  2JCH A;  5GT0 B;  3UT9 A;  3MGP A;  3B6G D;  1ZLA C;  2F8N A;  4H9O B;  3LEL A;  1HQ3 C;  3NQJ B;  4H9R B;  3KWQ A;  1P3M A;  1P3I A;  3W98 C;  2F2A C;  4H9N B;  3AZE A;  1P3G D;  3AV1 A;  5B0Z A;  5DNM D;  3REI C;  4CAY A;  3B6F C;  5B33 D;  4XUJ C;  3W98 D;  2HUE C;  4XZQ D;  3X1V C;  3AFA C;  4YS3 A;  1KX4 C;  3LZ1 C;  3WKJ B;  5FUG B;  3C1C A;  4H9S C;  3AL0 C;  3AN2 B;  3MGS B;  1M18 B;  4XUJ A;  5CP6 B;  3AZI C;  3X1V D;  3AFA D;  2ARO B;  1P3F B;  2BYM B;  1KX4 D;  3LZ1 D;  1M19 B;  2BYK A;  5E5A D;  3H0M C;  1P3O C;  2ZY2 A;  4X23 C;  3KXB A;  3MNN D;  3X1S C;  1KX5 B;  3FDD A;  1P3L A;  4Z66 B;  3W97 C;  5AVB A;  4JJN C;  5BNX B;  2VQR A;  4WV4 B;  5B24 D;  1P3O D;  3WA9 D;  4X23 D;  1T3U A;  4J8U A;  2UWX A;  3X1T A;  3AZN A;  3AV2 C;  1TZY B;  5AV6 D;  5B1M C;  5B0Y C;  2Y2K A;  1S32 B;  3F6T A;  3AZF B;  3X1S A;  3A6N B;  3W97 A;  5AV8 A;  4R8P B;  4JJN A;  3O62 A;  1P3A D;  4H9P A;  3KUY C;  4QLC A;  5B2J C;  5AY8 C;  3WAA B;  4G91 B;  4G92 B;  3NQU A;  3LZ0 D;  1A7W A;  2L5A A;  1P34 C;  5B0Y A;  2CV5 C;  3UTB A;  1P3K B;  1U35 C;  3W96 D;  3WTP E;  5B2J D;  5AY8 D;  3TU4 B;  5CPJ A;  1KX3 A;  5B31 D;  3MGR D;  4ZUX B;  3UT9 B;  3MGP B;  3MGQ A;  2CV5 D;  5GT0 C;  5B31 G;  3KUY A;  4KHA A;  1U35 D;  3P5J B;  1AOI B;  4Z2M H;  3UTA B;  3WTP D;  2NZD A;  5CPI D;  1P3M B;  1P3I B;  5GT0 D;  3AV1 B;  4J8V C;  1BFM A;  1Q9C A;  3W99 A;  1ID3 B;  5AV5 B;  4J8V D;  1P3B B;  5B40 B;  4YM6 A;  3B0C T;  5BNV B;  4HGA B;  4YS3 B;  3REH B;  3C1C B;  3AZK C;  4EO5 C;  5B32 A;  3MGS C;  1M18 C;  3REL C;  5G49 A;  4Z5T C;  5GSU B;  5CP6 C;  2FJ7 A;  3REK A;  4NFT A;  5B1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...