4H9PA

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAFLVALFEDTNLCTIHAKRVTIFPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9pA00
5F99B 3LJAB 3W98C 3AV1A 3KUYC 4J8WD 1KX4C 4H9QA 4YM6A 4KUDD 5B1MC 1KX5C 1P3IC 2F8NK 1F66A 1M1AB 3A6NA 5AV6C 3X1VD 1P3BB 3MGRD 3MVDD 1P3PC 4E44A 3W96A 1U35A 5GSUC 5DNNB 4CAYB 3AZED 2AROC 3MGPB 5GXQB 4X23C 3AZJD 4WU8A 4NFTA 5CP6B 5CPIA 4J8XB 4XUJB 5JRGA 1P3KA 5C3IC 4J8WC 5B24B 3AFAA 3AV1D 4QLCA 4YM6D 3X1TB 4Z66A 5E5AB 2HIOA 2NQBC 1P3OA 1F66D 1S32C 3X1SB 5B2IB 3A6ND 3X1UA 2CWEA 3AZEC 3REIC 4HGAC 1M18B 3B6GA 3W96D 1M19C 1U35D 3MNNA 3REHB 5BNXB 2FJ7A 3C1BB 3KSYA 5AV8B 1BH8B 3TU4D 3REKB 4J8VC 3C1CB 2IO5C 4WU8D 4WU9C 3LELA 1P3LC 5CPID 5CPKD 3W97B 1BH9B 5JRGD 3AZHC 3AV2A 1TZYC 1P3KD 3WA9C 3LZ1B 4LD9C 4YM6C 4G91C 4ZUXB 3KWQA 4H9PB 3VH5T 5KDMB 3AZIA 1P3AB 4QLCD 3REJA 2F8NA 3AZGB 3B6FA 5DNMA 5B0YD 4J8UC 3A6NC 3UTAB 4Z66D 4KGCC 3AZFB 2HIOD 1AOIB 3W98A 3KUYA 3UTBD 1P3OD 3UT9B 1KX4A 5AVBC 3O62D 5B1MA 1KX5A 4AWLB 4YS3A 1WWIA 4E45A 5AY8C 5B40B 1P3IA 5FUGB 3B6GD 3MNND 3AZMB 2YFVB 5AV6A 3TU4C 4WU8C 1EQZB 4R8PA 1P3PA 5CPKC 4UUZB 5GSUA 1P3GA 1P3MD 4Z2MG 1KX3A 3W99D 2RVQC 5AV5C 5GT3B 1P3KC 3VH5A 3LELD 1H3OB 4XZQB 2CV5B 4X23A 5JA4A 3WAAB 2LY8A 4WNNA 5B0YC 3KWQD 4Z66C 3AZID 3AYWB 3KXBD 3REJD 1ZLAD 3LZ0B 4J8WA 3MGSB 5DNMD 3UTBC 2F8ND 1HQ3B 4ZBJC 3WKJC 3V9RA 3O62C 5B2JC 1KX4D 3WTPB 5B1MD 1KX5D 5CPJC 4YS3D 2NQBA 4H9NA 5AV9B 1S32A 1P3MC 3W99C 4R8PD 3MGQB 3REIA 3AZEA 5AVCB 1P3PD 3AZLB 1M19A 5GSUD 1P3GD 1KX3D 1F1EA 1BFMA 3NQUA 5B32D 2YFWA 2NZDC 3KWQC 5BNVB 4X23D 4J8VA 3VH6T 3KXBC 2HUEC 4H9SC 3REJC 4WU9A 1ZLAC 1A7WA 2PYOD 1P3LA 1HTAA 3AZNC 3AZHA 1ULYA 1TZYA 3WA9A 4LD9A 1KU5A 5B1LD 4YS3C 5B33B 1P34B 4Z5TC 4J8UA 4KUDB 4J8XA 4KGCA 5G49B 2NQBD 4R8PC 1N1JA 1S32D 5AVBA 3X1VB 1P3GC 1KX3C 1ID3B 3MGRB 5AY8A 3MVDB 3REID 3VH6A 1M19D 5BS7C 5B32C 3TU4A 2PYOC 4H9RA 5CPKA 4J8VD 3AZJB 5AV5A 5BO0A 4WU9D 1P3BD 1P3LD 3RELB 1JFIA 3B0DC 3AZKA 3AZHD 5DNND 1TZYD 5B1LC 3WTPE 3WA9D 4JJNC 4LD9D 2BYKA 5B0ZB 5B0YA 5B31C 3AV1B 5GT0C 3UTBA 3WKJA 4H9QB 4J8UD 5CP6D 4J8XD 4XUJD 3O62A 4KGCD 5B2JA 5F99C 3LJAC 1F66B 5AVBD 3A6NB 5CPJA 1P3AA 5AY8D 3W96B 1U35B 4CSRA 3NQJA 1M1AC 1P3MA 3W99A 1P3BC 4H9OA 2BYMA 3B0CT 5DNNC 2RVQD 5AV5D 1TAFA 5CPIB 3MGPC 3AZKD 5JRGB 2NZDA 5GXQC 3KXBA 3AFAB 4H9SA 1ZLAA 5AV8D 4EO5B 5CP6C 4J8XC 1P3FA 3AZNA 4XUJC 3AN2A 4QLCB 3WKJD 5B24C 4Z66B 4WZSB 5B2JD 2HIOB 2CV5A 1P3OB 3WAAA 4Z5TA 4M6BA 3X1TC 5CPJD 3X1UB 1P3AD 5E5AC 3B6GB 3MNNB 3X1SC 5B2IC 2FJ7B 3AZFD 1AOID 1M18C 5BS7A 4WV4B 5B32A 3AZKC 4KHAA 3REHC 3LELB 2PYOA 3C1BC 5AV8C 2JSSA 3AV2B 2NZDD 3REKC 3C1CC 1EQZD 1R4VA 3W97C 1P3FD 4G92B 3AZND 3AZIB 3AN2D 5B1LA 3B6FB 5DNMB 4JJNA 3LZ1C 3VH5W 2F8NH 5B31A 2CV5D 4ZUXC 3W98B 1P3AC 3KUYB 1KX4B 3WAAD 5GT0A 4Z5TD 3AZGC 5B1MB 1KX5B 3UTAC 1P3IB 5F99A 3LJAA 3AZFC 1AOIC 3UT9C 3B0BA 5AV6B 4AWLC 1P3PB 5B40C 5GSUB 1M1AA 3AZMC 3WTPD 1B6WA 2AROB 1P3BA 1EQZC 1P3FC 4X23B 3AN2C 5DNNA 4CAYA 4WNNB 5GT3C 5AVCD 3MGPA 4XZQC 2CV5C 5GXQA 5C3IB 3R45B 4J8WB 3WAAC 4JJND 3V9RB 5CP6A 5B31D 4XUJA 3AYWC 5GT0D 3LZ0C 5B24A 3MGSC 1HQ3C 5F99D 3LJAD 2NQBB 1WWSA 4H9NB 1S32B 5BT1C 3X1TA 3WTPC 5E5AA 3REIB 5B33D 3AZEB 4HGAB 1P34D 1M19B 5AV9C 1M1AD 3X1SA 5B2IA 3NQUB 3MGQC 5AVCC 2YFWB 1M18A 3AZLC 4J8VB 2IO5B 3REHA 5BNXA 4WU9B 1ID3D 1P3LB 4NE5A 3MGPD 3C1BA 5AV8A 3VH6W 3AZHB 1BH8A 3REKA 1TZYB 5GXQD 3C1CA 3WA9B 4LD9B 4YM6B 3W97A 4G91B 4NE3A 1BH9A 5B24D 4J8UB 3LZ1A 3RELD 4KGCB 4ZUXA 4H9PA 5KDMA 1N1JB 5B33C 5AVBB 1P34C 3AZGA 5B0ZD 4KUDC 3X1TD 3UTAA 5E5AD 5AY8B 3AZFA 1AOIA 3UT9A 3X1SD 5B2ID 2L5AA 3TU4B 3X1VC 4WU8B 1ID3C 5B40A 4H9RB 3MVDC 3MGRC 5FUGA 5CPKB 1M18D 3AZMA 2YFVA 3REHD 5BO0B 5AV5B 1P3KB 1EQZA 3C1BD 1JFIB 3AZKB 4UUZA 3REKD 3C1CD 3AZJC 5GT3A 2BYKB 5B0YB 1H3OA 3W97D 4XZQA 3RELC 2F8NG 1Q9CA 3UTBB 3WKJB 4ZBJB 3LZ1D 5B0ZC 3O62B 5B2JB 4ZUXD 3AYWA 3AV1C 3AFAD 3LZ0A 3AZGD 3MGSA 1HQ3A 3UTAD 5CPJB 3UT9D 1F66C 4CSRB 3NQJB 1P3MB 3WTPA 3W99B 5B40D 4H9OB 3W96C 5AV9A 1U35C 3AZMD 2BYMB 3X1UD 5B32G 1TAFB 3MGQA 5AVCA 3B0CW 3AZLA 3KWQB 2NZDB 2FJ7D 3KXBB 2HUEB 3REJB 1ZLAB 2F8NB 5GT3D 1B67A 5CPIC 4XZQD 1P3FB 3AZNB 5JRGC 3AN2B 5BNVA 3AFAC 2AROA 4EO5C 3AV2D 4YS3B 3AYWD 4QLCC 5B31G 4Z5TB 3LZ0D 3MGSD 1HQ3D 2HIOC 4R8PB 5B33A 3R45A 1P3OC 3B6FD 1P34A 4KUDA 5BT1D 1P3GB 1KX3B 3X1UC 3W98D 3KUYD 5G49A 3B6GC 5B32B 5AV9D 3MNNC 4KHAB 3X1VA 2FJ7C 5JA4B 1P3ID 3MGQD 2PYOB 4DRAA 3MGRA 1ID3A 3MVDA 4DRBA 3AZLD 5AV6D 5CHLB 3LELC 3B0DB 3AV2C 4Z2MH 5B1LB 3AZJA 4JJNB 2AROD 5B31B 3RELA 4G92C 3AZIC 5GT0B 3B6FC 5DNMC 4NE6A 5B0ZA
chains in the Genus database with same CATH superfamily
1Z2CB 5F99B 3LJAB 3W98C 3H0RC 3KUYC 4J8WD 3AV1A 1KX4C 3AL0C 4H9QA 4YM6A 4KUDD 5B1MC 1KX5C 1P3IC 2F8NK 2W8SA 1F66A 1M1AB 3A6NA 5AV6C 3X1VD 1P3BB 3MGRD 3MVDD 1P3PC 4E44A 3W96A 1U35A 5GSUC 5DNNB 4CAYB 3AZED 2XD1A 2AROC 3MGPB 5GXQB 4X23C 3AZJD 4WU8A 4NFTA 5CP6B 5CPIA 4J8XB 4XUJB 5JRGA 1P3KA 5C3IC 4J8WC 5B24B 3AFAA 2ZY5A 3AV1D 4QLCA 4YM6D 3X1TB 4Z66A 5E5AB 2Y2QA 2HIOA 2NQBC 1P3OA 1F66D 1S32C 3X1SB 5B2IB 3A6ND 3X1UA 2CWEA 2G5HC 3AZEC 3REIC 4HGAC 1M18B 3B6GA 3W96D 1M19C 3EPKA 3MNNA 1U35D 3REHB 5BNXB 2FJ7A 2Y2PA 3C1BB 3KSYA 5AV8B 1BH8B 3TU4D 3REKB 4J8VC 3C1CB 2IO5C 4WU8D 2G5IC 4WU9C 3LELA 1P3LC 5CPID 5CPKD 3W97B 1BH9B 3A1IA 5JRGD 3AZHC 3AV2A 1TZYC 1P3KD 3WA9C 2ZY2A 3LZ1B 4LD9C 4YM6C 4G91C 4ZUXB 3KWQA 4H9PB 3VH5T 5KDMB 3AZIA 1P3AB 4QLCD 3REJA 2F8NA 3AZGB 3B6FA 5DNMA 5B0YD 4J8UC 3A6NC 3UTAB 4Z66D 4KGCC 3AZFB 2HIOD 3KFUG 1AOIB 3W98A 3KUYA 3UTBD 1P3OD 3UT9B 1KX4A 5AVBC 3O62D 5B1MA 1KX5A 4AWLB 4YS3A 1WWIA 4E45A 5AY8C 5B40B 1P3IA 5FUGB 3B6GD 3MNND 3AZMB 2YFVB 5AV6A 3TU4C 4WU8C 1EQZB 4R8PA 1P3PA 5CPKC 4UUZB 5GSUA 1P3GA 1P3MD 4Z2MG 1KX3A 3W99D 2RVQC 5AV5C 5GT3B 1P3KC 3VH5A 3LELD 1H3OB 4XZQB 2CV5B 4X23A 5JA4A 3WAAB 2LY8A 4WNNA 5B0YC 3KWQD 4Z66C 3AZID 3AYWB 3KXBD 3REJD 1ZLAD 3LZ0B 4J8WA 2DQNC 5DNMD 3MGSB 3UTBC 1HQ3B 4ZBJC 2F8ND 3WKJC 3V9RA 3O62C 5B2JC 1KX4D 3H0MC 2FFFB 3EPJA 3WTPB 5B1MD 1KX5D 5CPJC 4YS3D 2NQBA 4H9NA 5AV9B 1S32A 1P3MC 3H0LC 3W99C 4R8PD 3MGQB 3REIA 3AZEA 5AVCB 1P3PD 3AZLB 1M19A 2JCHA 5GSUD 1P3GD 1KX3D 1F1EA 1BFMA 3NQUA 5B32D 2YFWA 2NZDC 2ZY3A 3KWQC 5BNVB 4X23D 4J8VA 3VH6T 3KXBC 2HUEC 4H9SC 3REJC 4WU9A 1ZLAC 1A7WA 2PYOD 1P3LA 1HTAA 3AZNC 3AZHA 1ULYA 1TZYA 3WA9A 4LD9A 1KU5A 5B1LD 4YS3C 5B33B 1P34B 4Z5TC 3EG5B 4J8UA 4KUDB 4J8XA 4KGCA 5G49B 2NQBD 4R8PC 1N1JA 1S32D 5AVBA 3X1VB 1P3GC 1KX3C 1ID3B 3MGRB 5AY8A 3MVDB 3REID 3VH6A 1M19D 5BS7C 5B32C 3TU4A 2PYOC 4H9RA 5CPKA 4J8VD 3AZJB 5AV5A 2UWXA 5BO0A 4WU9D 1P3BD 1P3LD 3RELB 1JFIA 3B0DC 3AZKA 3AZHD 5DNND 1TZYD 5B1LC 3WTPE 3WA9D 4JJNC 4LD9D 2BYKA 5B0ZB 5B0YA 5B31C 3AV1B 5GT0C 3UTBA 3WKJA 4H9QB 4J8UD 5CP6D 4J8XD 4XUJD 3O62A 4KGCD 5B2JA 2Y2KA 5F99C 3LJAC 1F66B 5AVBD 3A6NB 2Y2IA 2Y2JA 5CPJA 1P3AA 5AY8D 3W96B 1U35B 4CSRA 3NQJA 1M1AC 1P3MA 3W99A 1P3BC 2ZM5A 4H9OA 3A1KA 2BYMA 3B0CT 5DNNC 2RVQD 5AV5D 1TAFA 5CPIB 3MGPC 3AZKD 5JRGB 2NZDA 5GXQC 3KXBA 3AFAB 4H9SA 1ZLAA 5AV8D 4EO5B 5CP6C 4J8XC 1P3FA 3AZNA 4XUJC 3AN2A 4QLCB 3WKJD 5B24C 4Z66B 4WZSB 5B2JD 2HIOB 3EPLA 2CV5A 1P3OB 3WAAA 2F2AC 4Z5TA 2DF4C 4M6BA 3X1TC 5CPJD 3X1UB 1P3AD 2Y2HA 5E5AC 3B6GB 3MNNB 3X1SC 5B2IC 2FJ7B 3AZFD 1AOID 3IP4C 1M18C 2Y2OA 4WV4B 5BS7A 5B32A 3AZKC 4KHAA 3REHC 3LELB 2PYOA 3C1BC 5AV8C 2JSSA 3AV2B 2NZDD 3REKC 3C1CC 1EQZD 3F6TA 1R4VA 3W97C 1P3FD 4G92B 3AZND 3AZIB 3AN2D 2JE5A 5B1LA 3B6FB 5DNMB 4JJNA 3LZ1C 3VH5W 2F8NH 5B31A 2CV5D 4ZUXC 3W98B 1P3AC 3P5JB 3KUYB 1KX4B 3WAAD 5GT0A 4Z5TD 3AZGC 5B1MB 1KX5B 3UTAC 1P3IB 5F99A 3LJAA 3AZFC 1AOIC 3UT9C 3B0BA 2RIQA 5AV6B 4AWLC 1P3PB 2ZY4A 5B40C 5GSUB 3FDDA 3AZMC 1M1AA 3WTPD 1B6WA 2AROB 1P3BA 1EQZC 2BG1A 1P3FC 4X23B 3AN2C 5DNNA 4DQYB 4CAYA 4WNNB 5GT3C 5AVCD 3MGPA 4XZQC 2CV5C 5GXQA 5C3IB 3R45B 4J8WB 3WAAC 4JJND 3V9RB 5CP6A 5B31D 4XUJA 3AYWC 5GT0D 3LZ0C 5B24A 3MGSC 1HQ3C 2Y2MA 5F99D 3LJAD 1PZRA 1WWSA 2NQBB 4H9NB 4WJ3C 1S32B 5BT1C 3X1TA 3WTPC 5E5AA 3REIB 5B33D 3AZEB 4HGAB 1P34D 1M19B 5AV9C 1M1AD 3X1SA 5B2IA 1W2EA 3NQUB 3MGQC 5AVCC 2YFWB 1M18A 3AZLC 4J8VB 2IO5B 3REHA 5BNXA 4WU9B 1ID3D 1P3LB 4NE5A 3MGPD 3C1BA 5AV8A 3VH6W 3AZHB 1BH8A 3REKA 1TZYB 5GXQD 3C1CA 3WA9B 4LD9B 4YM6B 3W97A 4G91B 2Y2LA 4NE3A 1BH9A 5B24D 4J8UB 3LZ1A 3RELD 4KGCB 4ZUXA 4H9PA 5KDMA 1N1JB 5B33C 5AVBB 1P34C 3AZGA 5B0ZD 4KUDC 3X1TD 3UTAA 5E5AD 5AY8B 3AZFA 1AOIA 3UT9A 3X1SD 5B2ID 2L5AA 3TU4B 3X1VC 4WU8B 1ID3C 5B40A 4H9RB 3MVDC 3MGRC 5FUGA 5CPKB 1M18D 3AZMA 2YFVA 3REHD 5BO0B 5AV5B 1P3KB 1EQZA 2Y2NA 4UPKA 3C1BD 1JFIB 3AZKB 4UUZA 3REKD 3C1CD 3AZJC 5GT3A 2BYKB 5B0YB 1H3OA 3W97D 4XZQA 3RELC 2F8NG 1Q9CA 3UTBB 3WKJB 4ZBJB 3LZ1D 5B0ZC 3O62B 5B2JB 4ZUXD 3AYWA 3AV1C 3AFAD 3LZ0A 3AZGD 3MGSA 2XD5A 1HQ3A 3UTAD 5CPJB 3UT9D 1F66C 4CSRB 3NQJB 1P3MB 3WTPA 3W99B 3EPHA 5B40D 4H9OB 3W96C 5AV9A 1U35C 3AZMD 2BYMB 3X1UD 5B32G 2Y2GA 1TAFB 3MGQA 5AVCA 3B0CW 3AZLA 3KWQB 2NZDB 2FJ7D 3KXBB 2HUEB 3REJB 1ZLAB 2F8NB 5GT3D 2VQRA 1B67A 5CPIC 4XZQD 1P3FB 3AZNB 5JRGC 3AN2B 5BNVA 3AFAC 2AROA 4EO5C 3AV2D 4YS3B 3AYWD 4QLCC 5B31G 4Z5TB 3LZ0D 3MGSD 1HQ3D 2HIOC 4R8PB 5B33A 3R45A 1P3OC 3B6FD 1P34A 4KUDA 5BT1D 1P3GB 2J8PA 1KX3B 3X1UC 3W98D 3KUYD 5G49A 3B6GC 5B32B 5AV9D 3MNNC 4KHAB 3X1VA 2FJ7C 5JA4B 1P3ID 3MGQD 2PYOB 4DRAA 3MGRA 1ID3A 3MVDA 4DRBA 3AZLD 5AV6D 5CHLB 3LELC 3B0DB 3AV2C 4Z2MH 5B1LB 3AZJA 4JJNB 2AROD 1T3UA 5B31B 3RELA 4G92C 3AZIC 5GT0B 3B6FC 5DNMC 4NE6A 5B0ZA
chains in the Genus database with same CATH topology
1Z2CB 5F99B 3LJAB 3W98C 3H0RC 3KUYC 4J8WD 3AV1A 1KX4C 3AL0C 4H9QA 4YM6A 4KUDD 5B1MC 1KX5C 1P3IC 2F8NK 2W8SA 1F66A 1M1AB 3A6NA 5AV6C 3X1VD 1P3BB 3MGRD 3MVDD 1P3PC 4E44A 3W96A 1U35A 5GSUC 5DNNB 4CAYB 3AZED 2XD1A 2AROC 3MGPB 5GXQB 4X23C 3AZJD 4WU8A 4NFTA 5CP6B 5CPIA 4J8XB 4XUJB 5JRGA 1P3KA 5C3IC 4J8WC 5B24B 3AFAA 2ZY5A 3AV1D 4QLCA 4YM6D 3X1TB 4Z66A 5E5AB 2Y2QA 2HIOA 2NQBC 1P3OA 1F66D 1S32C 3X1SB 5B2IB 3A6ND 3X1UA 2CWEA 2G5HC 3AZEC 3REIC 4HGAC 1M18B 3B6GA 3W96D 1M19C 3EPKA 3MNNA 1U35D 3REHB 5BNXB 2FJ7A 2Y2PA 3C1BB 3KSYA 5AV8B 1BH8B 3TU4D 3REKB 4J8VC 3C1CB 2IO5C 4WU8D 2G5IC 4WU9C 3LELA 1P3LC 5CPID 5CPKD 3W97B 1BH9B 3A1IA 5JRGD 3AZHC 3AV2A 1TZYC 1P3KD 3WA9C 2ZY2A 3LZ1B 4LD9C 4YM6C 4G91C 4ZUXB 3KWQA 4H9PB 3VH5T 5KDMB 3AZIA 1P3AB 4QLCD 3REJA 2F8NA 3AZGB 3B6FA 5DNMA 5B0YD 4J8UC 3A6NC 3UTAB 4Z66D 4KGCC 3AZFB 2HIOD 3KFUG 1AOIB 3W98A 3KUYA 3UTBD 1P3OD 3UT9B 1KX4A 5AVBC 3O62D 5B1MA 1KX5A 4AWLB 4YS3A 1WWIA 4E45A 5AY8C 5B40B 1P3IA 5FUGB 3B6GD 3MNND 3AZMB 2YFVB 5AV6A 3TU4C 4WU8C 1EQZB 4R8PA 1P3PA 5CPKC 4UUZB 5GSUA 1P3GA 1P3MD 4Z2MG 1KX3A 3W99D 2RVQC 5AV5C 5GT3B 1P3KC 3VH5A 3LELD 1H3OB 4XZQB 2CV5B 4X23A 5JA4A 3WAAB 2LY8A 4WNNA 5B0YC 3KWQD 4Z66C 3AZID 3AYWB 3KXBD 3REJD 1ZLAD 3LZ0B 4J8WA 2DQNC 5DNMD 3MGSB 3UTBC 1HQ3B 4ZBJC 2F8ND 3WKJC 3V9RA 3O62C 5B2JC 1KX4D 3H0MC 2FFFB 3EPJA 3WTPB 5B1MD 1KX5D 5CPJC 4YS3D 2NQBA 4H9NA 5AV9B 1S32A 1P3MC 3H0LC 3W99C 4R8PD 3MGQB 3REIA 3AZEA 5AVCB 1P3PD 3AZLB 1M19A 2JCHA 5GSUD 1P3GD 1KX3D 1F1EA 1BFMA 3NQUA 5B32D 2YFWA 2NZDC 2ZY3A 3KWQC 5BNVB 4X23D 4J8VA 3VH6T 3KXBC 2HUEC 4H9SC 3REJC 4WU9A 1ZLAC 1A7WA 2PYOD 1P3LA 1HTAA 3AZNC 3AZHA 1ULYA 1TZYA 3WA9A 4LD9A 1KU5A 5B1LD 4YS3C 5B33B 1P34B 4Z5TC 3EG5B 4J8UA 4KUDB 4J8XA 4KGCA 5G49B 2NQBD 4R8PC 1N1JA 1S32D 5AVBA 3X1VB 1P3GC 1KX3C 1ID3B 3MGRB 5AY8A 3MVDB 3REID 3VH6A 1M19D 5BS7C 5B32C 3TU4A 2PYOC 4H9RA 5CPKA 4J8VD 3AZJB 5AV5A 2UWXA 5BO0A 4WU9D 1P3BD 1P3LD 3RELB 1JFIA 3B0DC 3AZKA 3AZHD 5DNND 1TZYD 5B1LC 3WTPE 3WA9D 4JJNC 4LD9D 2BYKA 5B0ZB 5B0YA 5B31C 3AV1B 5GT0C 3UTBA 3WKJA 4H9QB 4J8UD 5CP6D 4J8XD 4XUJD 3O62A 4KGCD 5B2JA 2Y2KA 5F99C 3LJAC 1F66B 5AVBD 3A6NB 2Y2IA 2Y2JA 5CPJA 1P3AA 5AY8D 3W96B 1U35B 4CSRA 3NQJA 1M1AC 1P3MA 3W99A 1P3BC 2ZM5A 4H9OA 3A1KA 2BYMA 3B0CT 5DNNC 2RVQD 5AV5D 1TAFA 5CPIB 3MGPC 3AZKD 5JRGB 2NZDA 5GXQC 3KXBA 3AFAB 4H9SA 1ZLAA 5AV8D 4EO5B 5CP6C 4J8XC 1P3FA 3AZNA 4XUJC 3AN2A 4QLCB 3WKJD 5B24C 4Z66B 4WZSB 5B2JD 2HIOB 3EPLA 2CV5A 1P3OB 3WAAA 2F2AC 4Z5TA 2DF4C 4M6BA 3X1TC 5CPJD 3X1UB 1P3AD 2Y2HA 5E5AC 3B6GB 3MNNB 3X1SC 5B2IC 2FJ7B 3AZFD 1AOID 3IP4C 1M18C 2Y2OA 4WV4B 5BS7A 5B32A 3AZKC 4KHAA 3REHC 3LELB 2PYOA 3C1BC 5AV8C 2JSSA 3AV2B 2NZDD 3REKC 3C1CC 1EQZD 3F6TA 1R4VA 3W97C 1P3FD 4G92B 3AZND 3AZIB 3AN2D 2JE5A 5B1LA 3B6FB 5DNMB 4JJNA 3LZ1C 3VH5W 2F8NH 5B31A 2CV5D 4ZUXC 3W98B 1P3AC 3P5JB 3KUYB 1KX4B 3WAAD 5GT0A 4Z5TD 3AZGC 5B1MB 1KX5B 3UTAC 1P3IB 5F99A 3LJAA 3AZFC 1AOIC 3UT9C 3B0BA 2RIQA 5AV6B 4AWLC 1P3PB 2ZY4A 5B40C 5GSUB 3FDDA 3AZMC 1M1AA 3WTPD 1B6WA 2AROB 1P3BA 1EQZC 2BG1A 1P3FC 4X23B 3AN2C 5DNNA 4DQYB 4CAYA 4WNNB 5GT3C 5AVCD 3MGPA 4XZQC 2CV5C 5GXQA 5C3IB 3R45B 4J8WB 3WAAC 4JJND 3V9RB 5CP6A 5B31D 4XUJA 3AYWC 5GT0D 3LZ0C 5B24A 3MGSC 1HQ3C 2Y2MA 5F99D 3LJAD 1PZRA 1WWSA 2NQBB 4H9NB 4WJ3C 1S32B 5BT1C 3X1TA 3WTPC 5E5AA 3REIB 5B33D 3AZEB 4HGAB 1P34D 1M19B 5AV9C 1M1AD 3X1SA 5B2IA 1W2EA 3NQUB 3MGQC 5AVCC 2YFWB 1M18A 3AZLC 4J8VB 2IO5B 3REHA 5BNXA 4WU9B 1ID3D 1P3LB 4NE5A 3MGPD 3C1BA 5AV8A 3VH6W 3AZHB 1BH8A 3REKA 1TZYB 5GXQD 3C1CA 3WA9B 4LD9B 4YM6B 3W97A 4G91B 2Y2LA 4NE3A 1BH9A 5B24D 4J8UB 3LZ1A 3RELD 4KGCB 4ZUXA 4H9PA 5KDMA 1N1JB 5B33C 5AVBB 1P34C 3AZGA 5B0ZD 4KUDC 3X1TD 3UTAA 5E5AD 5AY8B 3AZFA 1AOIA 3UT9A 3X1SD 5B2ID 2L5AA 3TU4B 3X1VC 4WU8B 1ID3C 5B40A 4H9RB 3MVDC 3MGRC 5FUGA 5CPKB 1M18D 3AZMA 2YFVA 3REHD 5BO0B 5AV5B 1P3KB 1EQZA 2Y2NA 4UPKA 3C1BD 1JFIB 3AZKB 4UUZA 3REKD 3C1CD 3AZJC 5GT3A 2BYKB 5B0YB 1H3OA 3W97D 4XZQA 3RELC 2F8NG 1Q9CA 3UTBB 3WKJB 4ZBJB 3LZ1D 5B0ZC 3O62B 5B2JB 4ZUXD 3AYWA 3AV1C 3AFAD 3LZ0A 3AZGD 3MGSA 2XD5A 1HQ3A 3UTAD 5CPJB 3UT9D 1F66C 4CSRB 3NQJB 1P3MB 3WTPA 3W99B 3EPHA 5B40D 4H9OB 3W96C 5AV9A 1U35C 3AZMD 2BYMB 3X1UD 5B32G 2Y2GA 1TAFB 3MGQA 5AVCA 3B0CW 3AZLA 3KWQB 2NZDB 2FJ7D 3KXBB 2HUEB 3REJB 1ZLAB 2F8NB 5GT3D 2VQRA 1B67A 5CPIC 4XZQD 1P3FB 3AZNB 5JRGC 3AN2B 5BNVA 3AFAC 2AROA 4EO5C 3AV2D 4YS3B 3AYWD 4QLCC 5B31G 4Z5TB 3LZ0D 3MGSD 1HQ3D 2HIOC 4R8PB 5B33A 3R45A 1P3OC 3B6FD 1P34A 4KUDA 5BT1D 1P3GB 2J8PA 1KX3B 3X1UC 3W98D 3KUYD 5G49A 3B6GC 5B32B 5AV9D 3MNNC 4KHAB 3X1VA 2FJ7C 5JA4B 1P3ID 3MGQD 2PYOB 4DRAA 3MGRA 1ID3A 3MVDA 4DRBA 3AZLD 5AV6D 5CHLB 3LELC 3B0DB 3AV2C 4Z2MH 5B1LB 3AZJA 4JJNB 2AROD 1T3UA 5B31B 3RELA 4G92C 3AZIC 5GT0B 3B6FC 5DNMC 4NE6A 5B0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 B;  3LJA B;  3W98 C;  3AV1 A;  3KUY C;  4J8W D;  1KX4 C;  4H9Q A;  4YM6 A;  4KUD D;  5B1M C;  1KX5 C;  1P3I C;  2F8N K;  1F66 A;  1M1A B;  3A6N A;  5AV6 C;  3X1V D;  1P3B B;  3MGR D;  3MVD D;  1P3P C;  4E44 A;  3W96 A;  1U35 A;  5GSU C;  5DNN B;  4CAY B;  3AZE D;  2ARO C;  3MGP B;  5GXQ B;  4X23 C;  3AZJ D;  4WU8 A;  4NFT A;  5CP6 B;  5CPI A;  4J8X B;  4XUJ B;  5JRG A;  1P3K A;  5C3I C;  4J8W C;  5B24 B;  3AFA A;  3AV1 D;  4QLC A;  4YM6 D;  3X1T B;  4Z66 A;  5E5A B;  2HIO A;  2NQB C;  1P3O A;  1F66 D;  1S32 C;  3X1S B;  5B2I B;  3A6N D;  3X1U A;  2CWE A;  3AZE C;  3REI C;  4HGA C;  1M18 B;  3B6G A;  3W96 D;  1M19 C;  1U35 D;  3MNN A;  3REH B;  5BNX B;  2FJ7 A;  3C1B B;  3KSY A;  5AV8 B;  1BH8 B;  3TU4 D;  3REK B;  4J8V C;  3C1C B;  2IO5 C;  4WU8 D;  4WU9 C;  3LEL A;  1P3L C;  5CPI D;  5CPK D;  3W97 B;  1BH9 B;  5JRG D;  3AZH C;  3AV2 A;  1TZY C;  1P3K D;  3WA9 C;  3LZ1 B;  4LD9 C;  4YM6 C;  4G91 C;  4ZUX B;  3KWQ A;  4H9P B;  3VH5 T;  5KDM B;  3AZI A;  1P3A B;  4QLC D;  3REJ A;  2F8N A;  3AZG B;  3B6F A;  5DNM A;  5B0Y D;  4J8U C;  3A6N C;  3UTA B;  4Z66 D;  4KGC C;  3AZF B;  2HIO D;  1AOI B;  3W98 A;  3KUY A;  3UTB D;  1P3O D;  3UT9 B;  1KX4 A;  5AVB C;  3O62 D;  5B1M A;  1KX5 A;  4AWL B;  4YS3 A;  1WWI A;  4E45 A;  5AY8 C;  5B40 B;  1P3I A;  5FUG B;  3B6G D;  3MNN D;  3AZM B;  2YFV B;  5AV6 A;  3TU4 C;  4WU8 C;  1EQZ B;  4R8P A;  1P3P A;  5CPK C;  4UUZ B;  5GSU A;  1P3G A;  1P3M D;  4Z2M G;  1KX3 A;  3W99 D;  2RVQ C;  5AV5 C;  5GT3 B;  1P3K C;  3VH5 A;  3LEL D;  1H3O B;  4XZQ B;  2CV5 B;  4X23 A;  5JA4 A;  3WAA B;  2LY8 A;  4WNN A;  5B0Y C;  3KWQ D;  4Z66 C;  3AZI D;  3AYW B;  3KXB D;  3REJ D;  1ZLA D;  3LZ0 B;  4J8W A;  3MGS B;  5DNM D;  3UTB C;  2F8N D;  1HQ3 B;  4ZBJ C;  3WKJ C;  3V9R A;  3O62 C;  5B2J C;  1KX4 D;  3WTP B;  5B1M D;  1KX5 D;  5CPJ C;  4YS3 D;  2NQB A;  4H9N A;  5AV9 B;  1S32 A;  1P3M C;  3W99 C;  4R8P D;  3MGQ B;  3REI A;  3AZE A;  5AVC B;  1P3P D;  3AZL B;  1M19 A;  5GSU D;  1P3G D;  1KX3 D;  1F1E A;  1BFM A;  3NQU A;  5B32 D;  2YFW A;  2NZD C;  3KWQ C;  5BNV B;  4X23 D;  4J8V A;  3VH6 T;  3KXB C;  2HUE C;  4H9S C;  3REJ C;  4WU9 A;  1ZLA C;  1A7W A;  2PYO D;  1P3L A;  1HTA A;  3AZN C;  3AZH A;  1ULY A;  1TZY A;  3WA9 A;  4LD9 A;  1KU5 A;  5B1L D;  4YS3 C;  5B33 B;  1P34 B;  4Z5T C;  4J8U A;  4KUD B;  4J8X A;  4KGC A;  5G49 B;  2NQB D;  4R8P C;  1N1J A;  1S32 D;  5AVB A;  3X1V B;  1P3G C;  1KX3 C;  1ID3 B;  3MGR B;  5AY8 A;  3MVD B;  3REI D;  3VH6 A;  1M19 D;  5BS7 C;  5B32 C;  3TU4 A;  2PYO C;  4H9R A;  5CPK A;  4J8V D;  3AZJ B;  5AV5 A;  5BO0 A;  4WU9 D;  1P3B D;  1P3L D;  3REL B;  1JFI A;  3B0D C;  3AZK A;  3AZH D;  5DNN D;  1TZY D;  5B1L C;  3WTP E;  3WA9 D;  4JJN C;  4LD9 D;  2BYK A;  5B0Z B;  5B0Y A;  5B31 C;  3AV1 B;  5GT0 C;  3UTB A;  3WKJ A;  4H9Q B;  4J8U D;  5CP6 D;  4J8X D;  4XUJ D;  3O62 A;  4KGC D;  5B2J A;  5F99 C;  3LJA C;  1F66 B;  5AVB D;  3A6N B;  5CPJ A;  1P3A A;  5AY8 D;  3W96 B;  1U35 B;  4CSR A;  3NQJ A;  1M1A C;  1P3M A;  3W99 A;  1P3B C;  4H9O A;  2BYM A;  3B0C T;  5DNN C;  2RVQ D;  5AV5 D;  1TAF A;  5CPI B;  3MGP C;  3AZK D;  5JRG B;  2NZD A;  5GXQ C;  3KXB A;  3AFA B;  4H9S A;  1ZLA A;  5AV8 D;  4EO5 B;  5CP6 C;  4J8X C;  1P3F A;  3AZN A;  4XUJ C;  3AN2 A;  4QLC B;  3WKJ D;  5B24 C;  4Z66 B;  4WZS B;  5B2J D;  2HIO B;  2CV5 A;  1P3O B;  3WAA A;  4Z5T A;  4M6B A;  3X1T C;  5CPJ D;  3X1U B;  1P3A D;  5E5A C;  3B6G B;  3MNN B;  3X1S C;  5B2I C;  2FJ7 B;  3AZF D;  1AOI D;  1M18 C;  5BS7 A;  4WV4 B;  5B32 A;  3AZK C;  4KHA A;  3REH C;  3LEL B;  2PYO A;  3C1B C;  5AV8 C;  2JSS A;  3AV2 B;  2NZD D;  3REK C;  3C1C C;  1EQZ D;  1R4V A;  3W97 C;  1P3F D;  4G92 B;  3AZN D;  3AZI B;  3AN2 D;  5B1L A;  3B6F B;  5DNM B;  4JJN A;  3LZ1 C;  3VH5 W;  2F8N H;  5B31 A;  2CV5 D;  4ZUX C;  3W98 B;  1P3A C;  3KUY B;  1KX4 B;  3WAA D;  5GT0 A;  4Z5T D;  3AZG C;  5B1M B;  1KX5 B;  3UTA C;  1P3I B;  5F99 A;  3LJA A;  3AZF C;  1AOI C;  3UT9 C;  3B0B A;  5AV6 B;  4AWL C;  1P3P B;  5B40 C;  5GSU B;  1M1A A;  3AZM C;  3WTP D;  1B6W A;  2ARO B;  1P3B A;  1EQZ C;  1P3F C;  4X23 B;  3AN2 C;  5DNN A;  4CAY A;  4WNN B;  5GT3 C;  5AVC D;  3MGP A;  4XZQ C;  2CV5 C;  5GXQ A;  5C3I B;  3R45 B;  4J8W B;  3WAA C;  4JJN D;  3V9R B;  5CP6 A;  5B31 D;  4XUJ A;  3AYW C;  5GT0 D;  3LZ0 C;  5B24 A;  3MGS C;  1HQ3 C;  5F99 D;  3LJA D;  2NQB B;  1WWS A;  4H9N B;  1S32 B;  5BT1 C;  3X1T A;  3WTP C;  5E5A A;  3REI B;  5B33 D;  3AZE B;  4HGA B;  1P34 D;  1M19 B;  5AV9 C;  1M1A D;  3X1S A;  5B2I A;  3NQU B;  3MGQ C;  5AVC C;  2YFW B;  1M18 A;  3AZL C;  4J8V B;  2IO5 B;  3REH A;  5BNX A;  4WU9 B;  1ID3 D;  1P3L B;  4NE5 A;  3MGP D;  3C1B A;  5AV8 A;  3VH6 W;  3AZH B;  1BH8 A;  3REK A;  1TZY B;  5GXQ D;  3C1C A;  3WA9 B;  4LD9 B;  4YM6 B;  3W97 A;  4G91 B;  4NE3 A;  1BH9 A;  5B24 D;  4J8U B;  3LZ1 A;  3REL D;  4KGC B;  4ZUX A;  4H9P A;  5KDM A;  1N1J B;  5B33 C;  5AVB B;  1P34 C;  3AZG A;  5B0Z D;  4KUD C;  3X1T D;  3UTA A;  5E5A D;  5AY8 B;  3AZF A;  1AOI A;  3UT9 A;  3X1S D;  5B2I D;  2L5A A;  3TU4 B;  3X1V C;  4WU8 B;  1ID3 C;  5B40 A;  4H9R B;  3MVD C;  3MGR C;  5FUG A;  5CPK B;  1M18 D;  3AZM A;  2YFV A;  3REH D;  5BO0 B;  5AV5 B;  1P3K B;  1EQZ A;  3C1B D;  1JFI B;  3AZK B;  4UUZ A;  3REK D;  3C1C D;  3AZJ C;  5GT3 A;  2BYK B;  5B0Y B;  1H3O A;  3W97 D;  4XZQ A;  3REL C;  2F8N G;  1Q9C A;  3UTB B;  3WKJ B;  4ZBJ B;  3LZ1 D;  5B0Z C;  3O62 B;  5B2J B;  4ZUX D;  3AYW A;  3AV1 C;  3AFA D;  3LZ0 A;  3AZG D;  3MGS A;  1HQ3 A;  3UTA D;  5CPJ B;  3UT9 D;  1F66 C;  4CSR B;  3NQJ B;  1P3M B;  3WTP A;  3W99 B;  5B40 D;  4H9O B;  3W96 C;  5AV9 A;  1U35 C;  3AZM D;  2BYM B;  3X1U D;  5B32 G;  1TAF B;  3MGQ A;  5AVC A;  3B0C W;  3AZL A;  3KWQ B;  2NZD B;  2FJ7 D;  3KXB B;  2HUE B;  3REJ B;  1ZLA B;  2F8N B;  5GT3 D;  1B67 A;  5CPI C;  4XZQ D;  1P3F B;  3AZN B;  5JRG C;  3AN2 B;  5BNV A;  3AFA C;  2ARO A;  4EO5 C;  3AV2 D;  4YS3 B;  3AYW D;  4QLC C;  5B31 G;  4Z5T B;  3LZ0 D;  3MGS D;  1HQ3 D;  2HIO C;  4R8P B;  5B33 A;  3R45 A;  1P3O C;  3B6F D;  1P34 A;  4KUD A;  5BT1 D;  1P3G B;  1KX3 B;  3X1U C;  3W98 D;  3KUY D;  5G49 A;  3B6G C;  5B32 B;  5AV9 D;  3MNN C;  4KHA B;  3X1V A;  2FJ7 C;  5JA4 B;  1P3I D;  3MGQ D;  2PYO B;  4DRA A;  3MGR A;  1ID3 A;  3MVD A;  4DRB A;  3AZL D;  5AV6 D;  5CHL B;  3LEL C;  3B0D B;  3AV2 C;  4Z2M H;  5B1L B;  3AZJ A;  4JJN B;  2ARO D;  5B31 B;  3REL A;  4G92 C;  3AZI C;  5GT0 B;  3B6F C;  5DNM C;  4NE6 A;  5B0Z A; 
#chains in the Genus database with same CATH topology
 1Z2C B;  5F99 B;  3LJA B;  3W98 C;  3H0R C;  3KUY C;  4J8W D;  3AV1 A;  1KX4 C;  3AL0 C;  4H9Q A;  4YM6 A;  4KUD D;  5B1M C;  1KX5 C;  1P3I C;  2F8N K;  2W8S A;  1F66 A;  1M1A B;  3A6N A;  5AV6 C;  3X1V D;  1P3B B;  3MGR D;  3MVD D;  1P3P C;  4E44 A;  3W96 A;  1U35 A;  5GSU C;  5DNN B;  4CAY B;  3AZE D;  2XD1 A;  2ARO C;  3MGP B;  5GXQ B;  4X23 C;  3AZJ D;  4WU8 A;  4NFT A;  5CP6 B;  5CPI A;  4J8X B;  4XUJ B;  5JRG A;  1P3K A;  5C3I C;  4J8W C;  5B24 B;  3AFA A;  2ZY5 A;  3AV1 D;  4QLC A;  4YM6 D;  3X1T B;  4Z66 A;  5E5A B;  2Y2Q A;  2HIO A;  2NQB C;  1P3O A;  1F66 D;  1S32 C;  3X1S B;  5B2I B;  3A6N D;  3X1U A;  2CWE A;  2G5H C;  3AZE C;  3REI C;  4HGA C;  1M18 B;  3B6G A;  3W96 D;  1M19 C;  3EPK A;  3MNN A;  1U35 D;  3REH B;  5BNX B;  2FJ7 A;  2Y2P A;  3C1B B;  3KSY A;  5AV8 B;  1BH8 B;  3TU4 D;  3REK B;  4J8V C;  3C1C B;  2IO5 C;  4WU8 D;  2G5I C;  4WU9 C;  3LEL A;  1P3L C;  5CPI D;  5CPK D;  3W97 B;  1BH9 B;  3A1I A;  5JRG D;  3AZH C;  3AV2 A;  1TZY C;  1P3K D;  3WA9 C;  2ZY2 A;  3LZ1 B;  4LD9 C;  4YM6 C;  4G91 C;  4ZUX B;  3KWQ A;  4H9P B;  3VH5 T;  5KDM B;  3AZI A;  1P3A B;  4QLC D;  3REJ A;  2F8N A;  3AZG B;  3B6F A;  5DNM A;  5B0Y D;  4J8U C;  3A6N C;  3UTA B;  4Z66 D;  4KGC C;  3AZF B;  2HIO D;  3KFU G;  1AOI B;  3W98 A;  3KUY A;  3UTB D;  1P3O D;  3UT9 B;  1KX4 A;  5AVB C;  3O62 D;  5B1M A;  1KX5 A;  4AWL B;  4YS3 A;  1WWI A;  4E45 A;  5AY8 C;  5B40 B;  1P3I A;  5FUG B;  3B6G D;  3MNN D;  3AZM B;  2YFV B;  5AV6 A;  3TU4 C;  4WU8 C;  1EQZ B;  4R8P A;  1P3P A;  5CPK C;  4UUZ B;  5GSU A;  1P3G A;  1P3M D;  4Z2M G;  1KX3 A;  3W99 D;  2RVQ C;  5AV5 C;  5GT3 B;  1P3K C;  3VH5 A;  3LEL D;  1H3O B;  4XZQ B;  2CV5 B;  4X23 A;  5JA4 A;  3WAA B;  2LY8 A;  4WNN A;  5B0Y C;  3KWQ D;  4Z66 C;  3AZI D;  3AYW B;  3KXB D;  3REJ D;  1ZLA D;  3LZ0 B;  4J8W A;  2DQN C;  5DNM D;  3MGS B;  3UTB C;  1HQ3 B;  4ZBJ C;  2F8N D;  3WKJ C;  3V9R A;  3O62 C;  5B2J C;  1KX4 D;  3H0M C;  2FFF B;  3EPJ A;  3WTP B;  5B1M D;  1KX5 D;  5CPJ C;  4YS3 D;  2NQB A;  4H9N A;  5AV9 B;  1S32 A;  1P3M C;  3H0L C;  3W99 C;  4R8P D;  3MGQ B;  3REI A;  3AZE A;  5AVC B;  1P3P D;  3AZL B;  1M19 A;  2JCH A;  5GSU D;  1P3G D;  1KX3 D;  1F1E A;  1BFM A;  3NQU A;  5B32 D;  2YFW A;  2NZD C;  2ZY3 A;  3KWQ C;  5BNV B;  4X23 D;  4J8V A;  3VH6 T;  3KXB C;  2HUE C;  4H9S C;  3REJ C;  4WU9 A;  1ZLA C;  1A7W A;  2PYO D;  1P3L A;  1HTA A;  3AZN C;  3AZH A;  1ULY A;  1TZY A;  3WA9 A;  4LD9 A;  1KU5 A;  5B1L D;  4YS3 C;  5B33 B;  1P34 B;  4Z5T C;  3EG5 B;  4J8U A;  4KUD B;  4J8X A;  4KGC A;  5G49 B;  2NQB D;  4R8P C;  1N1J A;  1S32 D;  5AVB A;  3X1V B;  1P3G C;  1KX3 C;  1ID3 B;  3MGR B;  5AY8 A;  3MVD B;  3REI D;  3VH6 A;  1M19 D;  5BS7 C;  5B32 C;  3TU4 A;  2PYO C;  4H9R A;  5CPK A;  4J8V D;  3AZJ B;  5AV5 A;  2UWX A;  5BO0 A;  4WU9 D;  1P3B D;  1P3L D;  3REL B;  1JFI A;  3B0D C;  3AZK A;  3AZH D;  5DNN D;  1TZY D;  5B1L C;  3WTP E;  3WA9 D;  4JJN C;  4LD9 D;  2BYK A;  5B0Z B;  5B0Y A;  5B31 C;  3AV1 B;  5GT0 C;  3UTB A;  3WKJ A;  4H9Q B;  4J8U D;  5CP6 D;  4J8X D;  4XUJ D;  3O62 A;  4KGC D;  5B2J A;  2Y2K A;  5F99 C;  3LJA C;  1F66 B;  5AVB D;  3A6N B;  2Y2I A;  2Y2J A;  5CPJ A;  1P3A A;  5AY8 D;  3W96 B;  1U35 B;  4CSR A;  3NQJ A;  1M1A C;  1P3M A;  3W99 A;  1P3B C;  2ZM5 A;  4H9O A;  3A1K A;  2BYM A;  3B0C T;  5DNN C;  2RVQ D;  5AV5 D;  1TAF A;  5CPI B;  3MGP C;  3AZK D;  5JRG B;  2NZD A;  5GXQ C;  3KXB A;  3AFA B;  4H9S A;  1ZLA A;  5AV8 D;  4EO5 B;  5CP6 C;  4J8X C;  1P3F A;  3AZN A;  4XUJ C;  3AN2 A;  4QLC B;  3WKJ D;  5B24 C;  4Z66 B;  4WZS B;  5B2J D;  2HIO B;  3EPL A;  2CV5 A;  1P3O B;  3WAA A;  2F2A C;  4Z5T A;  2DF4 C;  4M6B A;  3X1T C;  5CPJ D;  3X1U B;  1P3A D;  2Y2H A;  5E5A C;  3B6G B;  3MNN B;  3X1S C;  5B2I C;  2FJ7 B;  3AZF D;  1AOI D;  3IP4 C;  1M18 C;  2Y2O A;  4WV4 B;  5BS7 A;  5B32 A;  3AZK C;  4KHA A;  3REH C;  3LEL B;  2PYO A;  3C1B C;  5AV8 C;  2JSS A;  3AV2 B;  2NZD D;  3REK C;  3C1C C;  1EQZ D;  3F6T A;  1R4V A;  3W97 C;  1P3F D;  4G92 B;  3AZN D;  3AZI B;  3AN2 D;  2JE5 A;  5B1L A;  3B6F B;  5DNM B;  4JJN A;  3LZ1 C;  3VH5 W;  2F8N H;  5B31 A;  2CV5 D;  4ZUX C;  3W98 B;  1P3A C;  3P5J B;  3KUY B;  1KX4 B;  3WAA D;  5GT0 A;  4Z5T D;  3AZG C;  5B1M B;  1KX5 B;  3UTA C;  1P3I B;  5F99 A;  3LJA A;  3AZF C;  1AOI C;  3UT9 C;  3B0B A;  2RIQ A;  5AV6 B;  4AWL C;  1P3P B;  2ZY4 A;  5B40 C;  5GSU B;  3FDD A;  3AZM C;  1M1A A;  3WTP D;  1B6W A;  2ARO B;  1P3B A;  1EQZ C;  2BG1 A;  1P3F C;  4X23 B;  3AN2 C;  5DNN A;  4DQY B;  4CAY A;  4WNN B;  5GT3 C;  5AVC D;  3MGP A;  4XZQ C;  2CV5 C;  5GXQ A;  5C3I B;  3R45 B;  4J8W B;  3WAA C;  4JJN D;  3V9R B;  5CP6 A;  5B31 D;  4XUJ A;  3AYW C;  5GT0 D;  3LZ0 C;  5B24 A;  3MGS C;  1HQ3 C;  2Y2M A;  5F99 D;  3LJA D;  1PZR A;  1WWS A;  2NQB B;  4H9N B;  4WJ3 C;  1S32 B;  5BT1 C;  3X1T A;  3WTP C;  5E5A A;  3REI B;  5B33 D;  3AZE B;  4HGA B;  1P34 D;  1M19 B;  5AV9 C;  1M1A D;  3X1S A;  5B2I A;  1W2E A;  3NQU B;  3MGQ C;  5AVC C;  2YFW B;  1M18 A;  3AZL C;  4J8V B;  2IO5 B;  3REH A;  5BNX A;  4WU9 B;  1ID3 D;  1P3L B;  4NE5 A;  3MGP D;  3C1B A;  5AV8 A;  3VH6 W;  3AZH B;  1BH8 A;  3REK A;  1TZY B;  5GXQ D;  3C1C A;  3WA9 B;  4LD9 B;  4YM6 B;  3W97 A;  4G91 B;  2Y2L A;  4NE3 A;  1BH9 A;  5B24 D;  4J8U B;  3LZ1 A;  3REL D;  4KGC B;  4ZUX A;  4H9P A;  5KDM A;  1N1J B;  5B33 C;  5AVB B;  1P34 C;  3AZG A;  5B0Z D;  4KUD C;  3X1T D;  3UTA A;  5E5A D;  5AY8 B;  3AZF A;  1AOI A;  3UT9 A;  3X1S D;  5B2I D;  2L5A A;  3TU4 B;  3X1V C;  4WU8 B;  1ID3 C;  5B40 A;  4H9R B;  3MVD C;  3MGR C;  5FUG A;  5CPK B;  1M18 D;  3AZM A;  2YFV A;  3REH D;  5BO0 B;  5AV5 B;  1P3K B;  1EQZ A;  2Y2N A;  4UPK A;  3C1B D;  1JFI B;  3AZK B;  4UUZ A;  3REK D;  3C1C D;  3AZJ C;  5GT3 A;  2BYK B;  5B0Y B;  1H3O A;  3W97 D;  4XZQ A;  3REL C;  2F8N G;  1Q9C A;  3UTB B;  3WKJ B;  4ZBJ B;  3LZ1 D;  5B0Z C;  3O62 B;  5B2J B;  4ZUX D;  3AYW A;  3AV1 C;  3AFA D;  3LZ0 A;  3AZG D;  3MGS A;  2XD5 A;  1HQ3 A;  3UTA D;  5CPJ B;  3UT9 D;  1F66 C;  4CSR B;  3NQJ B;  1P3M B;  3WTP A;  3W99 B;  3EPH A;  5B40 D;  4H9O B;  3W96 C;  5AV9 A;  1U35 C;  3AZM D;  2BYM B;  3X1U D;  5B32 G;  2Y2G A;  1TAF B;  3MGQ A;  5AVC A;  3B0C W;  3AZL A;  3KWQ B;  2NZD B;  2FJ7 D;  3KXB B;  2HUE B;  3REJ B;  1ZLA B;  2F8N B;  5GT3 D;  2VQR A;  1B67 A;  5CPI C;  4XZQ D;  1P3F B;  3AZN B;  5JRG C;  3AN2 B;  5BNV A;  3AFA C;  2ARO A;  4EO5 C;  3AV2 D;  4YS3 B;  3AYW D;  4QLC C;  5B31 G;  4Z5T B;  3LZ0 D;  3MGS D;  1HQ3 D;  2HIO C;  4R8P B;  5B33 A;  3R45 A;  1P3O C;  3B6F D;  1P34 A;  4KUD A;  5BT1 D;  1P3G B;  2J8P A;  1KX3 B;  3X1U C;  3W98 D;  3KUY D;  5G49 A;  3B6G C;  5B32 B;  5AV9 D;  3MNN C;  4KHA B;  3X1V A;  2FJ7 C;  5JA4 B;  1P3I D;  3MGQ D;  2PYO B;  4DRA A;  3MGR A;  1ID3 A;  3MVD A;  4DRB A;  3AZL D;  5AV6 D;  5CHL B;  3LEL C;  3B0D B;  3AV2 C;  4Z2M H;  5B1L B;  3AZJ A;  4JJN B;  2ARO D;  1T3U A;  5B31 B;  3REL A;  4G92 C;  3AZI C;  5GT0 B;  3B6F C;  5DNM C;  4NE6 A;  5B0Z A; 
#chains in the Genus database with same CATH homology
 1Z2C B;  5F99 B;  3LJA B;  3W98 C;  3H0R C;  3KUY C;  4J8W D;  3AV1 A;  1KX4 C;  3AL0 C;  4H9Q A;  4YM6 A;  4KUD D;  5B1M C;  1KX5 C;  1P3I C;  2F8N K;  2W8S A;  1F66 A;  1M1A B;  3A6N A;  5AV6 C;  3X1V D;  1P3B B;  3MGR D;  3MVD D;  1P3P C;  4E44 A;  3W96 A;  1U35 A;  5GSU C;  5DNN B;  4CAY B;  3AZE D;  2XD1 A;  2ARO C;  3MGP B;  5GXQ B;  4X23 C;  3AZJ D;  4WU8 A;  4NFT A;  5CP6 B;  5CPI A;  4J8X B;  4XUJ B;  5JRG A;  1P3K A;  5C3I C;  4J8W C;  5B24 B;  3AFA A;  2ZY5 A;  3AV1 D;  4QLC A;  4YM6 D;  3X1T B;  4Z66 A;  5E5A B;  2Y2Q A;  2HIO A;  2NQB C;  1P3O A;  1F66 D;  1S32 C;  3X1S B;  5B2I B;  3A6N D;  3X1U A;  2CWE A;  2G5H C;  3AZE C;  3REI C;  4HGA C;  1M18 B;  3B6G A;  3W96 D;  1M19 C;  3EPK A;  3MNN A;  1U35 D;  3REH B;  5BNX B;  2FJ7 A;  2Y2P A;  3C1B B;  3KSY A;  5AV8 B;  1BH8 B;  3TU4 D;  3REK B;  4J8V C;  3C1C B;  2IO5 C;  4WU8 D;  2G5I C;  4WU9 C;  3LEL A;  1P3L C;  5CPI D;  5CPK D;  3W97 B;  1BH9 B;  3A1I A;  5JRG D;  3AZH C;  3AV2 A;  1TZY C;  1P3K D;  3WA9 C;  2ZY2 A;  3LZ1 B;  4LD9 C;  4YM6 C;  4G91 C;  4ZUX B;  3KWQ A;  4H9P B;  3VH5 T;  5KDM B;  3AZI A;  1P3A B;  4QLC D;  3REJ A;  2F8N A;  3AZG B;  3B6F A;  5DNM A;  5B0Y D;  4J8U C;  3A6N C;  3UTA B;  4Z66 D;  4KGC C;  3AZF B;  2HIO D;  3KFU G;  1AOI B;  3W98 A;  3KUY A;  3UTB D;  1P3O D;  3UT9 B;  1KX4 A;  5AVB C;  3O62 D;  5B1M A;  1KX5 A;  4AWL B;  4YS3 A;  1WWI A;  4E45 A;  5AY8 C;  5B40 B;  1P3I A;  5FUG B;  3B6G D;  3MNN D;  3AZM B;  2YFV B;  5AV6 A;  3TU4 C;  4WU8 C;  1EQZ B;  4R8P A;  1P3P A;  5CPK C;  4UUZ B;  5GSU A;  1P3G A;  1P3M D;  4Z2M G;  1KX3 A;  3W99 D;  2RVQ C;  5AV5 C;  5GT3 B;  1P3K C;  3VH5 A;  3LEL D;  1H3O B;  4XZQ B;  2CV5 B;  4X23 A;  5JA4 A;  3WAA B;  2LY8 A;  4WNN A;  5B0Y C;  3KWQ D;  4Z66 C;  3AZI D;  3AYW B;  3KXB D;  3REJ D;  1ZLA D;  3LZ0 B;  4J8W A;  2DQN C;  5DNM D;  3MGS B;  3UTB C;  1HQ3 B;  4ZBJ C;  2F8N D;  3WKJ C;  3V9R A;  3O62 C;  5B2J C;  1KX4 D;  3H0M C;  2FFF B;  3EPJ A;  3WTP B;  5B1M D;  1KX5 D;  5CPJ C;  4YS3 D;  2NQB A;  4H9N A;  5AV9 B;  1S32 A;  1P3M C;  3H0L C;  3W99 C;  4R8P D;  3MGQ B;  3REI A;  3AZE A;  5AVC B;  1P3P D;  3AZL B;  1M19 A;  2JCH A;  5GSU D;  1P3G D;  1KX3 D;  1F1E A;  1BFM A;  3NQU A;  5B32 D;  2YFW A;  2NZD C;  2ZY3 A;  3KWQ C;  5BNV B;  4X23 D;  4J8V A;  3VH6 T;  3KXB C;  2HUE C;  4H9S C;  3REJ C;  4WU9 A;  1ZLA C;  1A7W A;  2PYO D;  1P3L A;  1HTA A;  3AZN C;  3AZH A;  1ULY A;  1TZY A;  3WA9 A;  4LD9 A;  1KU5 A;  5B1L D;  4YS3 C;  5B33 B;  1P34 B;  4Z5T C;  3EG5 B;  4J8U A;  4KUD B;  4J8X A;  4KGC A;  5G49 B;  2NQB D;  4R8P C;  1N1J A;  1S32 D;  5AVB A;  3X1V B;  1P3G C;  1KX3 C;  1ID3 B;  3MGR B;  5AY8 A;  3MVD B;  3REI D;  3VH6 A;  1M19 D;  5BS7 C;  5B32 C;  3TU4 A;  2PYO C;  4H9R A;  5CPK A;  4J8V D;  3AZJ B;  5AV5 A;  2UWX A;  5BO0 A;  4WU9 D;  1P3B D;  1P3L D;  3REL B;  1JFI A;  3B0D C;  3AZK A;  3AZH D;  5DNN D;  1TZY D;  5B1L C;  3WTP E;  3WA9 D;  4JJN C;  4LD9 D;  2BYK A;  5B0Z B;  5B0Y A;  5B31 C;  3AV1 B;  5GT0 C;  3UTB A;  3WKJ A;  4H9Q B;  4J8U D;  5CP6 D;  4J8X D;  4XUJ D;  3O62 A;  4KGC D;  5B2J A;  2Y2K A;  5F99 C;  3LJA C;  1F66 B;  5AVB D;  3A6N B;  2Y2I A;  2Y2J A;  5CPJ A;  1P3A A;  5AY8 D;  3W96 B;  1U35 B;  4CSR A;  3NQJ A;  1M1A C;  1P3M A;  3W99 A;  1P3B C;  2ZM5 A;  4H9O A;  3A1K A;  2BYM A;  3B0C T;  5DNN C;  2RVQ D;  5AV5 D;  1TAF A;  5CPI B;  3MGP C;  3AZK D;  5JRG B;  2NZD A;  5GXQ C;  3KXB A;  3AFA B;  4H9S A;  1ZLA A;  5AV8 D;  4EO5 B;  5CP6 C;  4J8X C;  1P3F A;  3AZN A;  4XUJ C;  3AN2 A;  4QLC B;  3WKJ D;  5B24 C;  4Z66 B;  4WZS B;  5B2J D;  2HIO B;  3EPL A;  2CV5 A;  1P3O B;  3WAA A;  2F2A C;  4Z5T A;  2DF4 C;  4M6B A;  3X1T C;  5CPJ D;  3X1U B;  1P3A D;  2Y2H A;  5E5A C;  3B6G B;  3MNN B;  3X1S C;  5B2I C;  2FJ7 B;  3AZF D;  1AOI D;  3IP4 C;  1M18 C;  2Y2O A;  4WV4 B;  5BS7 A;  5B32 A;  3AZK C;  4KHA A;  3REH C;  3LEL B;  2PYO A;  3C1B C;  5AV8 C;  2JSS A;  3AV2 B;  2NZD D;  3REK C;  3C1C C;  1EQZ D;  3F6T A;  1R4V A;  3W97 C;  1P3F D;  4G92 B;  3AZN D;  3AZI B;  3AN2 D;  2JE5 A;  5B1L A;  3B6F B;  5DNM B;  4JJN A;  3LZ1 C;  3VH5 W;  2F8N H;  5B31 A;  2CV5 D;  4ZUX C;  3W98 B;  1P3A C;  3P5J B;  3KUY B;  1KX4 B;  3WAA D;  5GT0 A;  4Z5T D;  3AZG C;  5B1M B;  1KX5 B;  3UTA C;  1P3I B;  5F99 A;  3LJA A;  3AZF C;  1AOI C;  3UT9 C;  3B0B A;  2RIQ A;  5AV6 B;  4AWL C;  1P3P B;  2ZY4 A;  5B40 C;  5GSU B;  3FDD A;  3AZM C;  1M1A A;  3WTP D;  1B6W A;  2ARO B;  1P3B A;  1EQZ C;  2BG1 A;  1P3F C;  4X23 B;  3AN2 C;  5DNN A;  4DQY B;  4CAY A;  4WNN B;  5GT3 C;  5AVC D;  3MGP A;  4XZQ C;  2CV5 C;  5GXQ A;  5C3I B;  3R45 B;  4J8W B;  3WAA C;  4JJN D;  3V9R B;  5CP6 A;  5B31 D;  4XUJ A;  3AYW C;  5GT0 D;  3LZ0 C;  5B24 A;  3MGS C;  1HQ3 C;  2Y2M A;  5F99 D;  3LJA D;  1PZR A;  1WWS A;  2NQB B;  4H9N B;  4WJ3 C;  1S32 B;  5BT1 C;  3X1T A;  3WTP C;  5E5A A;  3REI B;  5B33 D;  3AZE B;  4HGA B;  1P34 D;  1M19 B;  5AV9 C;  1M1A D;  3X1S A;  5B2I A;  1W2E A;  3NQU B;  3MGQ C;  5AVC C;  2YFW B;  1M18 A;  3AZL C;  4J8V B;  2IO5 B;  3REH A;  5BNX A;  4WU9 B;  1ID3 D;  1P3L B;  4NE5 A;  3MGP D;  3C1B A;  5AV8 A;  3VH6 W;  3AZH B;  1BH8 A;  3REK A;  1TZY B;  5GXQ D;  3C1C A;  3WA9 B;  4LD9 B;  4YM6 B;  3W97 A;  4G91 B;  2Y2L A;  4NE3 A;  1BH9 A;  5B24 D;  4J8U B;  3LZ1 A;  3REL D;  4KGC B;  4ZUX A;  4H9P A;  5KDM A;  1N1J B;  5B33 C;  5AVB B;  1P34 C;  3AZG A;  5B0Z D;  4KUD C;  3X1T D;  3UTA A;  5E5A D;  5AY8 B;  3AZF A;  1AOI A;  3UT9 A;  3X1S D;  5B2I D;  2L5A A;  3TU4 B;  3X1V C;  4WU8 B;  1ID3 C;  5B40 A;  4H9R B;  3MVD C;  3MGR C;  5FUG A;  5CPK B;  1M18 D;  3AZM A;  2YFV A;  3REH D;  5BO0 B;  5AV5 B;  1P3K B;  1EQZ A;  2Y2N A;  4UPK A;  3C1B D;  1JFI B;  3AZK B;  4UUZ A;  3REK D;  3C1C D;  3AZJ C;  5GT3 A;  2BYK B;  5B0Y B;  1H3O A;  3W97 D;  4XZQ A;  3REL C;  2F8N G;  1Q9C A;  3UTB B;  3WKJ B;  4ZBJ B;  3LZ1 D;  5B0Z C;  3O62 B;  5B2J B;  4ZUX D;  3AYW A;  3AV1 C;  3AFA D;  3LZ0 A;  3AZG D;  3MGS A;  2XD5 A;  1HQ3 A;  3UTA D;  5CPJ B;  3UT9 D;  1F66 C;  4CSR B;  3NQJ B;  1P3M B;  3WTP A;  3W99 B;  3EPH A;  5B40 D;  4H9O B;  3W96 C;  5AV9 A;  1U35 C;  3AZM D;  2BYM B;  3X1U D;  5B32 G;  2Y2G A;  1TAF B;  3MGQ A;  5AVC A;  3B0C W;  3AZL A;  3KWQ B;  2NZD B;  2FJ7 D;  3KXB B;  2HUE B;  3REJ B;  1ZLA B;  2F8N B;  5GT3 D;  2VQR A;  1B67 A;  5CPI C;  4XZQ D;  1P3F B;  3AZN B;  5JRG C;  3AN2 B;  5BNV A;  3AFA C;  2ARO A;  4EO5 C;  3AV2 D;  4YS3 B;  3AYW D;  4QLC C;  5B31 G;  4Z5T B;  3LZ0 D;  3MGS D;  1HQ3 D;  2HIO C;  4R8P B;  5B33 A;  3R45 A;  1P3O C;  3B6F D;  1P34 A;  4KUD A;  5BT1 D;  1P3G B;  2J8P A;  1KX3 B;  3X1U C;  3W98 D;  3KUY D;  5G49 A;  3B6G C;  5B32 B;  5AV9 D;  3MNN C;  4KHA B;  3X1V A;  2FJ7 C;  5JA4 B;  1P3I D;  3MGQ D;  2PYO B;  4DRA A;  3MGR A;  1ID3 A;  3MVD A;  4DRB A;  3AZL D;  5AV6 D;  5CHL B;  3LEL C;  3B0D B;  3AV2 C;  4Z2M H;  5B1L B;  3AZJ A;  4JJN B;  2ARO D;  1T3U A;  5B31 B;  3REL A;  4G92 C;  3AZI C;  5GT0 B;  3B6F C;  5DNM C;  4NE6 A;  5B0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...