3MGQB

Binding of nickel ions to the nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqB00
5AV9A 5BNXB 1P3IA 5C3IC 5GT0A 4WU8A 3W96C 1WWIA 5B33A 3VH5W 4EO5B 2HIOA 2FJ7B 3AV2C 3AZLA 5B31A 3NQJB 3REHB 5CPJA 5G49B 3TU4A 5GT3B 3KXBC 5CPKA 5B24B 5AV5B 1M1AD 3AV1B 3AZMB 4NE3A 5B40A 3REIB 4WU9C 4J8VC 1TZYD 2RVQC 3KUYB 3LJAD 3WKJA 2YFWA 2NQBC 4YS3A 3KWQA 3AZHD 3X1UC 3WA9D 4Z66B 3O62B 4ZUXC 2F8NA 5AV9B 3REJC 1BH8A 3W99C 5GT0B 1P3MC 5B33B 3NQUA 1HQ3C 3W97D 5JRGB 5CPJB 5CPKB 3W96D 1TAFA 3R45B 3X1TA 5B1MC 1U35C 1M1AA 2F8NG 5B2JB 2CV5D 4R8PC 1P3IC 1P3OB 3AZKB 4WU8C 3RELD 1U35A 3WKJB 1P34C 2HIOC 1TZYA 3AZLC 5B31C 3KWQB 1M18C 4J8VD 3TU4C 4AWLC 3AZHA 3B0DC 3WA9A 1BH8B 4WZSB 1S32D 5B40C 5DNMC 3LZ0D 3VH5A 1EQZD 4M6BA 5GSUD 3MVDA 4KHAA 4QLCB 4ZUXD 3REJD 4H9RA 3W97A 3W99D 3LELD 1P3MD 1HQ3D 4YS3C 5AVCD 5AY8C 3W96A 3X1SB 2JSSA 1P3PB 1M1AB 4KGCC 5AV8C 2CV5A 1P3FC 1P3BD 4DRAA 3WTPC 5B1MD 3C1CA 1U35D 1TZYB 4Z2MH 4UUZA 5JA4A 3RELA 4R8PD 3LJAB 2F8NK 3AZIA 3X1VC 2HUEC 3X1TC 4J8VA 1P34D 3WA9B 5B32B 1M18D 3A6ND 3WTPE 5BO0A 4KHAB 1S32A 1HTAA 3LZ0A 3UT9B 1EQZA 4H9RB 5GSUA 4G92B 5BS7A 5DNMD 1H3OA 5C3IB 3LELA 3W96B 1HQ3A 5AVCA 3AZHC 3AV2B 4NFTA 4YS3D 3REKA 4H9PA 3KXBB 5AY8D 5FUGA 3MVDC 4NE5A 5JA4B 2F8ND 4KGCD 1P3BA 3W97C 5B1MA 4WU9B 5AV8D 3V9RB 1P3FD 1BFMA 4H9QA 4R8PA 4YM6D 3WTPD 4J8VB 1ID3C 2NZDC 2PYOD 1P34A 2NQBB 5E5AD 3X1VD 3X1TD 1JFIB 1M18A 3X1UB 4KUDD 5CP6D 3A6NA 1EQZB 2CV5C 4ZUXB 3C1CC 3MGSC 3REJB 3RELC 3W99B 1P3LA 1P3MB 3AZIC 5DNMA 3MGRD 2BYKA 1HQ3B 4J8XD 5AVCB 3UTAC 5B2IC 5B0ZA 2YFVB 4H9PB 1S32C 1P3GD 5AV6A 3AYWC 4NE6A 3LZ0C 1EQZC 3AZJA 5AY8A 5B1MB 3VH5T 3VH6W 5GSUC 1U35B 3W98D 5BS7C 4KGCA 2LY8A 4R8PB 1P3IB 1KX3A 1M19D 4H9OA 3LELC 3MVDD 5AV8A 4WU8B 5DNNA 1KX4D 2BYMA 1P3FA 4YM6A 5AVCC 3WTPA 1P34B 2HIOB 3AZLB 1Q9CA 5B31B 4J8WC 1M18B 3REKC 2PYOA 3AZNA 1ID3D 3TU4B 5E5AA 4AWLB 3X1VA 2NZDD 3B0DB 4KUDA 5CP6A 1P3BC 1P3AD 4LD9C 5B40B 5DNMB 2BYKB 1P3KC 1F66D 3B6GA 3B6FA 5F99C 4CAYA 3C1CD 3MGSD 3MGRA 4J8XA 3C1BA 3AZID 2YFWB 5GXQD 3WAAD 4HGAC 3UTAD 4YS3B 5B2ID 4X23A 3A6NC 4Z5TC 5AY8B 4CSRA 5B0YA 5CPIA 1P3GA 2F8NB 4E44A 4KGCB 1P3LC 2AROD 5AV8B 3W98A 3AYWD 2BYMB 3AFAD 1P3FB 3NQUB 1B6WA 4JJNC 1M19A 3AZED 3WTPB 4XZQA 5B0ZC 1KU5A 1KX4A 4H9SA 5E5AB 1TAFB 2HUEB 3X1TB 3X1VB 5CP6B 5AV6C 1ID3A 1ZLAD 3AZJC 2NZDA 4J8WD 1BH9A 3REKD 3KSYA 1P3AA 1KX3C 4J8UA 5DNNC 1F66A 4LD9D 4YM6C 3AZGC 3REHD 3MGSA 1AOIA 1P3KD 2PYOC 3AZNC 5F99D 5E5AC 5GXQA 3VH6A 3WAAA 3UTAA 3AZHB 5B2IA 4KUDC 5CP6C 3MNNC 3MGQA 3W98B 4Z5TD 3B6FC 3B0CW 3B6GC 3MVDB 3KUYD 2AROA 4WV4B 3AYWA 3AFAA 1KX4B 3MGRC 4J8XC 3C1BC 3AZEA 3W97B 5B32G 1P3LD 5KDMA 4JJND 5B0ZD 4X23C 4Z66D 1ID3B 3UTBA 2NZDB 5CPIC 5B0YC 1P3GC 1ZLAA 3AZFD 5BNXA 4J8WA 3W98C 5AV6D 2CV5B 3AZJD 1M19C 4XZQC 5BT1C 3C1CB 3MGSB 4UUZB 1KX4C 2FJ7A 3RELB 3AN2D 1KX3D 4LD9A 3AZIB 3NQJA 4H9SC 5GXQB 3REHA 5G49A 5DNND 1P3KA 3UTAB 5B2IB 5AV5A 5F99A 3AZGD 5B2JD 5BNVA 3AZMA 3AZND 5BO0B 1P3AC 4Z2MG 4J8UC 1S32B 3AYWB 4WNNA 3LZ0B 4Z5TA 1F66C 3MNND 5GSUB 1B67A 5AVBC 3KUYA 1AOIC 1H3OB 3B6FD 3B6GD 3LELB 4ZBJC 3WAAC 5GXQC 4JJNA 4XUJC 3C1BD 4Z66A 3O62A 3MGQC 4J8WB 3REKB 1N1JA 4X23D 4QLCD 3AZFA 2IO5C 5FUGB 5B0YD 5CPID 2AROC 2F8NH 5JRGA 3AFAC 1P3BB 4LD9B 3AZEC 3MGPC 1P3KB 3AN2A 4H9QB 3R45A 3X1SD 5F99B 4XZQD 5BT1D 3LZ1D 4G91C 1P3PD 3UTBC 5B1LC 1KX5C 5BNVB 3AZGA 5B2JA 1ZLAC 4HGAB 4WNNB 1P3OA 3A6NB 3AZKA 4Z5TB 4EO5C 2FJ7C 3MNNA 5B31G 1P3LB 4J8UD 3REHC 4JJNB 5GT3C 5B24C 5B0ZB 5B32D 5AV5C 5AVBD 5CHLB 1AOID 3AV1C 1N1JB 3VH6T 3AZMC 3REIC 3AZFB 3UT9D 1WWSA 4XUJD 5AV6B 4QLCA 3AZJB 3MGQD 3KUYC 3AN2B 1KX3B 4H9OB 5DNNB 3B0BA 3AV2D 4YM6B 3X1SA 3LZ1A 3MGPD 1P3PA 4Z66C 3O62C 3AZGB 5AV9C 3KXBD 2PYOB 3AZNB 5GT0C 3UTBD 5B1LD 5B33C 3AZFC 1KX5D 4KUDB 5JRGC 4WU9D 3MNNB 4H9NA 3LJAA 5CPJC 5CPKC 3B6FB 3AN2C 3B6GB 2RVQD 4CAYB 3MGRB 2FJ7D 4J8XB 3C1BB 2NQBD 2L5AA 5B32A 5AVBA 3X1UD 5B2JC 5GT3D 5B24D 1P3OC 4X23B 5AV5D 3AZKC 3UT9A 4CSRB 5B0YB 5CPIB 4XUJA 1P3GB 3AV1D 3AZMD 3WKJC 3REID 3KWQC 1M19B 3LZ1B 4XZQB 3AV2A 3MGPA 3KXBA 4QLCC 3O62D 5B1LA 5AV9D 4H9NB 1KX5A 1P3ID 4E45A 1BH9B 4WU9A 1F1EA 2CWEA 5GT0D 3V9RA 4WU8D 4J8UB 5B33D 1P3AB 5JRGD 2HIOD 1F66B 3AZLD 5B31D 5AVBB 3X1SC 3LZ1C 1P3PC 1M1AC 1ULYA 5CPJD 1AOIB 3TU4D 5CPKD 2NQBA 1JFIA 4ZBJB 3X1UA 3WAAB 5GT3A 3B0CT 4DRBA 4XUJB 5B24A 5B40D 4ZUXA 1TZYC 3REJA 3MGQB 1R4VA 3W99A 3LJAC 3AV1A 1P3OD 1P3MA 3AZKD 3REIA 2IO5B 2AROB 2YFVA 3AFAB 3WKJD 3WA9C 3AZEB 3MGPB 5B32C 3KWQD 5KDMB 1A7WA 4G91B 3UTBB 5B1LB 1KX5B 3UT9C 4G92C 1ZLAB
chains in the Genus database with same CATH superfamily
5AV9A 5BNXB 1P3IA 5C3IC 5GT0A 4WU8A 3W96C 1WWIA 5B33A 3VH5W 4EO5B 2HIOA 2FJ7B 2ZY3A 3AV2C 3AZLA 5B31A 3NQJB 3REHB 5CPJA 5G49B 3TU4A 5GT3B 3KXBC 5CPKA 5B24B 5AV5B 1M1AD 2ZY5A 3AV1B 3EPLA 3AZMB 4NE3A 5B40A 3REIB 4WU9C 4J8VC 1TZYD 2RVQC 3KUYB 3LJAD 3WKJA 2YFWA 2NQBC 2JCHA 4YS3A 3KWQA 3AZHD 3X1UC 3WA9D 4Z66B 3O62B 4ZUXC 2F8NA 5AV9B 3REJC 1BH8A 3W99C 2W8SA 5GT0B 1P3MC 5B33B 3NQUA 1HQ3C 3W97D 5JRGB 5CPJB 5CPKB 3W96D 1TAFA 3R45B 3X1TA 5B1MC 1U35C 1M1AA 2F8NG 5B2JB 2CV5D 4R8PC 1P3IC 1P3OB 3AZKB 4WU8C 3RELD 1U35A 3WKJB 1P34C 2HIOC 1TZYA 3AZLC 5B31C 3KWQB 1M18C 4J8VD 3TU4C 4AWLC 2RIQA 3AZHA 3B0DC 3WA9A 1BH8B 4WZSB 1S32D 5B40C 5DNMC 3LZ0D 3VH5A 1EQZD 4M6BA 5GSUD 3MVDA 4KHAA 4QLCB 4ZUXD 3REJD 4H9RA 3W97A 3W99D 3LELD 1P3MD 1HQ3D 4YS3C 5AVCD 2Y2NA 5AY8C 3W96A 3X1SB 2JSSA 1P3PB 1M1AB 4KGCC 5AV8C 2CV5A 1P3FC 1P3BD 1W2EA 4DRAA 3WTPC 5B1MD 3C1CA 1U35D 1TZYB 4Z2MH 4UUZA 5JA4A 3RELA 4R8PD 3LJAB 2F8NK 3AZIA 3X1VC 2HUEC 3X1TC 4J8VA 1P34D 3WA9B 5B32B 1M18D 3A6ND 3WTPE 3P5JB 5BO0A 4KHAB 1S32A 1HTAA 3LZ0A 3UT9B 1EQZA 4H9RB 5GSUA 4G92B 5BS7A 5DNMD 1H3OA 5C3IB 3LELA 1Z2CB 3W96B 1PZRA 1HQ3A 5AVCA 3AZHC 3AV2B 2Y2PA 4NFTA 4YS3D 3REKA 4H9PA 3KXBB 5AY8D 5FUGA 3MVDC 4NE5A 5JA4B 2F8ND 4KGCD 1P3BA 2Y2HA 3W97C 4WJ3C 5B1MA 4WU9B 5AV8D 3V9RB 1P3FD 1BFMA 4H9QA 4R8PA 4YM6D 3WTPD 4J8VB 1ID3C 2NZDC 2PYOD 1P34A 3EPHA 5E5AD 2NQBB 3X1VD 3X1TD 2G5HC 1JFIB 1M18A 3X1UB 4KUDD 2Y2JA 5CP6D 3A6NA 2CV5C 1EQZB 4ZUXB 3C1CC 3MGSC 3REJB 3RELC 3W99B 2Y2QA 1P3LA 2Y2MA 1P3MB 3AZIC 5DNMA 2J8PA 3MGRD 2BYKA 1HQ3B 4J8XD 5AVCB 3UTAC 5B2IC 5B0ZA 2YFVB 4H9PB 1T3UA 1S32C 3EG5B 1P3GD 5AV6A 3AYWC 4NE6A 3LZ0C 1EQZC 3AZJA 5AY8A 5B1MB 3VH5T 3VH6W 5GSUC 2Y2GA 1U35B 3W98D 5BS7C 4KGCA 2LY8A 4R8PB 1P3IB 1KX3A 1M19D 4H9OA 3LELC 3MVDD 5AV8A 4WU8B 5DNNA 1KX4D 2BYMA 1P3FA 4YM6A 5AVCC 3WTPA 1P34B 2HIOB 3AZLB 1Q9CA 5B31B 4J8WC 1M18B 3REKC 2PYOA 3AZNA 1ID3D 3TU4B 5E5AA 4UPKA 4AWLB 3X1VA 2NZDD 3B0DB 4KUDA 5CP6A 3H0RC 1P3BC 1P3AD 4LD9C 5B40B 5DNMB 2BYKB 1P3KC 1F66D 3B6GA 3B6FA 2G5IC 4CAYA 5F99C 3C1CD 3MGSD 3MGRA 4J8XA 3C1BA 2JE5A 3AZID 2YFWB 5GXQD 3WAAD 4HGAC 3UTAD 4YS3B 5B2ID 4X23A 3A6NC 4Z5TC 5AY8B 4CSRA 5B0YA 5CPIA 1P3GA 2F8NB 4E44A 4KGCB 1P3LC 2AROD 5AV8B 3W98A 3AYWD 3AL0C 2BYMB 3AFAD 1P3FB 3NQUB 1B6WA 4JJNC 1M19A 3AZED 3WTPB 4XZQA 5B0ZC 1KU5A 1KX4A 4H9SA 5E5AB 1TAFB 2HUEB 3X1TB 3X1VB 5CP6B 5AV6C 4DQYB 1ID3A 1ZLAD 3AZJC 2NZDA 4J8WD 1BH9A 3REKD 3KSYA 1P3AA 1KX3C 4J8UA 2UWXA 5DNNC 1F66A 2F2AC 4LD9D 4YM6C 3AZGC 3REHD 3MGSA 1AOIA 1P3KD 2PYOC 3AZNC 5F99D 5E5AC 5GXQA 3VH6A 3WAAA 3UTAA 3AZHB 5B2IA 4KUDC 5CP6C 3MNNC 3MGQA 3W98B 2DF4C 4Z5TD 3B6FC 3B0CW 3B6GC 3MVDB 3KUYD 2AROA 4WV4B 3AYWA 3AFAA 1KX4B 3MGRC 4J8XC 3C1BC 3AZEA 3W97B 2Y2LA 5B32G 1P3LD 5KDMA 4JJND 5B0ZD 4X23C 3A1IA 4Z66D 1ID3B 3UTBA 2NZDB 5CPIC 5B0YC 1P3GC 1ZLAA 3AZFD 5BNXA 4J8WA 3IP4C 3W98C 5AV6D 3H0LC 2CV5B 2VQRA 2Y2KA 3AZJD 1M19C 4XZQC 5BT1C 3C1CB 3MGSB 4UUZB 1KX4C 2FJ7A 3RELB 3AN2D 1KX3D 4LD9A 2XD1A 3AZIB 3NQJA 4H9SC 5GXQB 3REHA 5G49A 5DNND 1P3KA 3UTAB 3FDDA 5B2IB 5AV5A 5F99A 3AZGD 5B2JD 5BNVA 3AZMA 3AZND 2BG1A 5BO0B 1P3AC 4Z2MG 4J8UC 1S32B 3AYWB 4WNNA 3LZ0B 4Z5TA 1F66C 3MNND 5GSUB 1B67A 5AVBC 3KUYA 2ZY4A 1AOIC 1H3OB 3B6FD 3B6GD 3LELB 3H0MC 4ZBJC 3WAAC 5GXQC 4JJNA 4XUJC 3C1BD 4Z66A 3O62A 3MGQC 4J8WB 3A1KA 3REKB 1N1JA 4X23D 4QLCD 2DQNC 3AZFA 2IO5C 5FUGB 5B0YD 5CPID 2AROC 2F8NH 5JRGA 3AFAC 1P3BB 4LD9B 3AZEC 2ZM5A 3MGPC 1P3KB 3AN2A 4H9QB 3R45A 3X1SD 5F99B 4XZQD 5BT1D 3LZ1D 4G91C 1P3PD 3UTBC 5B1LC 1KX5C 5BNVB 3AZGA 5B2JA 1ZLAC 2ZY2A 4HGAB 4WNNB 1P3OA 3A6NB 3AZKA 4Z5TB 4EO5C 2FJ7C 3MNNA 5B31G 1P3LB 4J8UD 3EPKA 3REHC 4JJNB 5GT3C 5B24C 5B0ZB 5B32D 5AV5C 5AVBD 3F6TA 5CHLB 1AOID 3AV1C 1N1JB 3VH6T 3AZMC 3REIC 3AZFB 3UT9D 1WWSA 4XUJD 5AV6B 4QLCA 3AZJB 3MGQD 3KUYC 3AN2B 1KX3B 4H9OB 5DNNB 3B0BA 3AV2D 4YM6B 3X1SA 3LZ1A 3MGPD 1P3PA 4Z66C 3O62C 3AZGB 5AV9C 3KXBD 2PYOB 3AZNB 5GT0C 3UTBD 5B1LD 5B33C 3AZFC 1KX5D 4KUDB 5JRGC 4WU9D 3MNNB 4H9NA 3LJAA 5CPJC 5CPKC 3B6FB 3AN2C 3B6GB 2RVQD 4CAYB 3MGRB 2FJ7D 4J8XB 3C1BB 2NQBD 2XD5A 2L5AA 5B32A 5AVBA 3X1UD 5B2JC 5GT3D 5B24D 1P3OC 4X23B 5AV5D 3AZKC 3UT9A 4CSRB 5B0YB 5CPIB 4XUJA 1P3GB 3AV1D 3EPJA 3AZMD 3WKJC 3REID 3KWQC 1M19B 2Y2IA 3LZ1B 4XZQB 3AV2A 2FFFB 3MGPA 3KFUG 3KXBA 4QLCC 3O62D 5B1LA 5AV9D 4H9NB 1KX5A 1P3ID 4E45A 1BH9B 4WU9A 1F1EA 2CWEA 5GT0D 3V9RA 4WU8D 4J8UB 5B33D 1P3AB 5JRGD 2HIOD 1F66B 2Y2OA 3AZLD 5B31D 5AVBB 3X1SC 3LZ1C 1P3PC 1M1AC 1ULYA 5CPJD 1AOIB 3TU4D 5CPKD 2NQBA 1JFIA 4ZBJB 3X1UA 3WAAB 5GT3A 3B0CT 4DRBA 4XUJB 5B24A 5B40D 4ZUXA 1TZYC 3REJA 3MGQB 1R4VA 3W99A 3LJAC 3AV1A 1P3OD 1P3MA 3AZKD 3REIA 2IO5B 2AROB 2YFVA 3AFAB 3WKJD 3WA9C 3AZEB 3MGPB 5B32C 3KWQD 5KDMB 1A7WA 4G91B 3UTBB 5B1LB 1KX5B 3UT9C 4G92C 1ZLAB
chains in the Genus database with same CATH topology
5AV9A 5BNXB 1P3IA 5C3IC 5GT0A 4WU8A 3W96C 1WWIA 5B33A 3VH5W 4EO5B 2HIOA 2FJ7B 2ZY3A 3AV2C 3AZLA 5B31A 3NQJB 3REHB 5CPJA 5G49B 3TU4A 5GT3B 3KXBC 5CPKA 5B24B 5AV5B 1M1AD 2ZY5A 3AV1B 3EPLA 3AZMB 4NE3A 5B40A 3REIB 4WU9C 4J8VC 1TZYD 2RVQC 3KUYB 3LJAD 3WKJA 2YFWA 2NQBC 2JCHA 4YS3A 3KWQA 3AZHD 3X1UC 3WA9D 4Z66B 3O62B 4ZUXC 2F8NA 5AV9B 3REJC 1BH8A 3W99C 2W8SA 5GT0B 1P3MC 5B33B 3NQUA 1HQ3C 3W97D 5JRGB 5CPJB 5CPKB 3W96D 1TAFA 3R45B 3X1TA 5B1MC 1U35C 1M1AA 2F8NG 5B2JB 2CV5D 4R8PC 1P3IC 1P3OB 3AZKB 4WU8C 3RELD 1U35A 3WKJB 1P34C 2HIOC 1TZYA 3AZLC 5B31C 3KWQB 1M18C 4J8VD 3TU4C 4AWLC 2RIQA 3AZHA 3B0DC 3WA9A 1BH8B 4WZSB 1S32D 5B40C 5DNMC 3LZ0D 3VH5A 1EQZD 4M6BA 5GSUD 3MVDA 4KHAA 4QLCB 4ZUXD 3REJD 4H9RA 3W97A 3W99D 3LELD 1P3MD 1HQ3D 4YS3C 5AVCD 2Y2NA 5AY8C 3W96A 3X1SB 2JSSA 1P3PB 1M1AB 4KGCC 5AV8C 2CV5A 1P3FC 1P3BD 1W2EA 4DRAA 3WTPC 5B1MD 3C1CA 1U35D 1TZYB 4Z2MH 4UUZA 5JA4A 3RELA 4R8PD 3LJAB 2F8NK 3AZIA 3X1VC 2HUEC 3X1TC 4J8VA 1P34D 3WA9B 5B32B 1M18D 3A6ND 3WTPE 3P5JB 5BO0A 4KHAB 1S32A 1HTAA 3LZ0A 3UT9B 1EQZA 4H9RB 5GSUA 4G92B 5BS7A 5DNMD 1H3OA 5C3IB 3LELA 1Z2CB 3W96B 1PZRA 1HQ3A 5AVCA 3AZHC 3AV2B 2Y2PA 4NFTA 4YS3D 3REKA 4H9PA 3KXBB 5AY8D 5FUGA 3MVDC 4NE5A 5JA4B 2F8ND 4KGCD 1P3BA 2Y2HA 3W97C 4WJ3C 5B1MA 4WU9B 5AV8D 3V9RB 1P3FD 1BFMA 4H9QA 4R8PA 4YM6D 3WTPD 4J8VB 1ID3C 2NZDC 2PYOD 1P34A 3EPHA 5E5AD 2NQBB 3X1VD 3X1TD 2G5HC 1JFIB 1M18A 3X1UB 4KUDD 2Y2JA 5CP6D 3A6NA 2CV5C 1EQZB 4ZUXB 3C1CC 3MGSC 3REJB 3RELC 3W99B 2Y2QA 1P3LA 2Y2MA 1P3MB 3AZIC 5DNMA 2J8PA 3MGRD 2BYKA 1HQ3B 4J8XD 5AVCB 3UTAC 5B2IC 5B0ZA 2YFVB 4H9PB 1T3UA 1S32C 3EG5B 1P3GD 5AV6A 3AYWC 4NE6A 3LZ0C 1EQZC 3AZJA 5AY8A 5B1MB 3VH5T 3VH6W 5GSUC 2Y2GA 1U35B 3W98D 5BS7C 4KGCA 2LY8A 4R8PB 1P3IB 1KX3A 1M19D 4H9OA 3LELC 3MVDD 5AV8A 4WU8B 5DNNA 1KX4D 2BYMA 1P3FA 4YM6A 5AVCC 3WTPA 1P34B 2HIOB 3AZLB 1Q9CA 5B31B 4J8WC 1M18B 3REKC 2PYOA 3AZNA 1ID3D 3TU4B 5E5AA 4UPKA 4AWLB 3X1VA 2NZDD 3B0DB 4KUDA 5CP6A 3H0RC 1P3BC 1P3AD 4LD9C 5B40B 5DNMB 2BYKB 1P3KC 1F66D 3B6GA 3B6FA 2G5IC 4CAYA 5F99C 3C1CD 3MGSD 3MGRA 4J8XA 3C1BA 2JE5A 3AZID 2YFWB 5GXQD 3WAAD 4HGAC 3UTAD 4YS3B 5B2ID 4X23A 3A6NC 4Z5TC 5AY8B 4CSRA 5B0YA 5CPIA 1P3GA 2F8NB 4E44A 4KGCB 1P3LC 2AROD 5AV8B 3W98A 3AYWD 3AL0C 2BYMB 3AFAD 1P3FB 3NQUB 1B6WA 4JJNC 1M19A 3AZED 3WTPB 4XZQA 5B0ZC 1KU5A 1KX4A 4H9SA 5E5AB 1TAFB 2HUEB 3X1TB 3X1VB 5CP6B 5AV6C 4DQYB 1ID3A 1ZLAD 3AZJC 2NZDA 4J8WD 1BH9A 3REKD 3KSYA 1P3AA 1KX3C 4J8UA 2UWXA 5DNNC 1F66A 2F2AC 4LD9D 4YM6C 3AZGC 3REHD 3MGSA 1AOIA 1P3KD 2PYOC 3AZNC 5F99D 5E5AC 5GXQA 3VH6A 3WAAA 3UTAA 3AZHB 5B2IA 4KUDC 5CP6C 3MNNC 3MGQA 3W98B 2DF4C 4Z5TD 3B6FC 3B0CW 3B6GC 3MVDB 3KUYD 2AROA 4WV4B 3AYWA 3AFAA 1KX4B 3MGRC 4J8XC 3C1BC 3AZEA 3W97B 2Y2LA 5B32G 1P3LD 5KDMA 4JJND 5B0ZD 4X23C 3A1IA 4Z66D 1ID3B 3UTBA 2NZDB 5CPIC 5B0YC 1P3GC 1ZLAA 3AZFD 5BNXA 4J8WA 3IP4C 3W98C 5AV6D 3H0LC 2CV5B 2VQRA 2Y2KA 3AZJD 1M19C 4XZQC 5BT1C 3C1CB 3MGSB 4UUZB 1KX4C 2FJ7A 3RELB 3AN2D 1KX3D 4LD9A 2XD1A 3AZIB 3NQJA 4H9SC 5GXQB 3REHA 5G49A 5DNND 1P3KA 3UTAB 3FDDA 5B2IB 5AV5A 5F99A 3AZGD 5B2JD 5BNVA 3AZMA 3AZND 2BG1A 5BO0B 1P3AC 4Z2MG 4J8UC 1S32B 3AYWB 4WNNA 3LZ0B 4Z5TA 1F66C 3MNND 5GSUB 1B67A 5AVBC 3KUYA 2ZY4A 1AOIC 1H3OB 3B6FD 3B6GD 3LELB 3H0MC 4ZBJC 3WAAC 5GXQC 4JJNA 4XUJC 3C1BD 4Z66A 3O62A 3MGQC 4J8WB 3A1KA 3REKB 1N1JA 4X23D 4QLCD 2DQNC 3AZFA 2IO5C 5FUGB 5B0YD 5CPID 2AROC 2F8NH 5JRGA 3AFAC 1P3BB 4LD9B 3AZEC 2ZM5A 3MGPC 1P3KB 3AN2A 4H9QB 3R45A 3X1SD 5F99B 4XZQD 5BT1D 3LZ1D 4G91C 1P3PD 3UTBC 5B1LC 1KX5C 5BNVB 3AZGA 5B2JA 1ZLAC 2ZY2A 4HGAB 4WNNB 1P3OA 3A6NB 3AZKA 4Z5TB 4EO5C 2FJ7C 3MNNA 5B31G 1P3LB 4J8UD 3EPKA 3REHC 4JJNB 5GT3C 5B24C 5B0ZB 5B32D 5AV5C 5AVBD 3F6TA 5CHLB 1AOID 3AV1C 1N1JB 3VH6T 3AZMC 3REIC 3AZFB 3UT9D 1WWSA 4XUJD 5AV6B 4QLCA 3AZJB 3MGQD 3KUYC 3AN2B 1KX3B 4H9OB 5DNNB 3B0BA 3AV2D 4YM6B 3X1SA 3LZ1A 3MGPD 1P3PA 4Z66C 3O62C 3AZGB 5AV9C 3KXBD 2PYOB 3AZNB 5GT0C 3UTBD 5B1LD 5B33C 3AZFC 1KX5D 4KUDB 5JRGC 4WU9D 3MNNB 4H9NA 3LJAA 5CPJC 5CPKC 3B6FB 3AN2C 3B6GB 2RVQD 4CAYB 3MGRB 2FJ7D 4J8XB 3C1BB 2NQBD 2XD5A 2L5AA 5B32A 5AVBA 3X1UD 5B2JC 5GT3D 5B24D 1P3OC 4X23B 5AV5D 3AZKC 3UT9A 4CSRB 5B0YB 5CPIB 4XUJA 1P3GB 3AV1D 3EPJA 3AZMD 3WKJC 3REID 3KWQC 1M19B 2Y2IA 3LZ1B 4XZQB 3AV2A 2FFFB 3MGPA 3KFUG 3KXBA 4QLCC 3O62D 5B1LA 5AV9D 4H9NB 1KX5A 1P3ID 4E45A 1BH9B 4WU9A 1F1EA 2CWEA 5GT0D 3V9RA 4WU8D 4J8UB 5B33D 1P3AB 5JRGD 2HIOD 1F66B 2Y2OA 3AZLD 5B31D 5AVBB 3X1SC 3LZ1C 1P3PC 1M1AC 1ULYA 5CPJD 1AOIB 3TU4D 5CPKD 2NQBA 1JFIA 4ZBJB 3X1UA 3WAAB 5GT3A 3B0CT 4DRBA 4XUJB 5B24A 5B40D 4ZUXA 1TZYC 3REJA 3MGQB 1R4VA 3W99A 3LJAC 3AV1A 1P3OD 1P3MA 3AZKD 3REIA 2IO5B 2AROB 2YFVA 3AFAB 3WKJD 3WA9C 3AZEB 3MGPB 5B32C 3KWQD 5KDMB 1A7WA 4G91B 3UTBB 5B1LB 1KX5B 3UT9C 4G92C 1ZLAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 A;  5BNX B;  1P3I A;  5C3I C;  5GT0 A;  4WU8 A;  3W96 C;  1WWI A;  5B33 A;  3VH5 W;  4EO5 B;  2HIO A;  2FJ7 B;  3AV2 C;  3AZL A;  5B31 A;  3NQJ B;  3REH B;  5CPJ A;  5G49 B;  3TU4 A;  5GT3 B;  3KXB C;  5CPK A;  5B24 B;  5AV5 B;  1M1A D;  3AV1 B;  3AZM B;  4NE3 A;  5B40 A;  3REI B;  4WU9 C;  4J8V C;  1TZY D;  2RVQ C;  3KUY B;  3LJA D;  3WKJ A;  2YFW A;  2NQB C;  4YS3 A;  3KWQ A;  3AZH D;  3X1U C;  3WA9 D;  4Z66 B;  3O62 B;  4ZUX C;  2F8N A;  5AV9 B;  3REJ C;  1BH8 A;  3W99 C;  5GT0 B;  1P3M C;  5B33 B;  3NQU A;  1HQ3 C;  3W97 D;  5JRG B;  5CPJ B;  5CPK B;  3W96 D;  1TAF A;  3R45 B;  3X1T A;  5B1M C;  1U35 C;  1M1A A;  2F8N G;  5B2J B;  2CV5 D;  4R8P C;  1P3I C;  1P3O B;  3AZK B;  4WU8 C;  3REL D;  1U35 A;  3WKJ B;  1P34 C;  2HIO C;  1TZY A;  3AZL C;  5B31 C;  3KWQ B;  1M18 C;  4J8V D;  3TU4 C;  4AWL C;  3AZH A;  3B0D C;  3WA9 A;  1BH8 B;  4WZS B;  1S32 D;  5B40 C;  5DNM C;  3LZ0 D;  3VH5 A;  1EQZ D;  4M6B A;  5GSU D;  3MVD A;  4KHA A;  4QLC B;  4ZUX D;  3REJ D;  4H9R A;  3W97 A;  3W99 D;  3LEL D;  1P3M D;  1HQ3 D;  4YS3 C;  5AVC D;  5AY8 C;  3W96 A;  3X1S B;  2JSS A;  1P3P B;  1M1A B;  4KGC C;  5AV8 C;  2CV5 A;  1P3F C;  1P3B D;  4DRA A;  3WTP C;  5B1M D;  3C1C A;  1U35 D;  1TZY B;  4Z2M H;  4UUZ A;  5JA4 A;  3REL A;  4R8P D;  3LJA B;  2F8N K;  3AZI A;  3X1V C;  2HUE C;  3X1T C;  4J8V A;  1P34 D;  3WA9 B;  5B32 B;  1M18 D;  3A6N D;  3WTP E;  5BO0 A;  4KHA B;  1S32 A;  1HTA A;  3LZ0 A;  3UT9 B;  1EQZ A;  4H9R B;  5GSU A;  4G92 B;  5BS7 A;  5DNM D;  1H3O A;  5C3I B;  3LEL A;  3W96 B;  1HQ3 A;  5AVC A;  3AZH C;  3AV2 B;  4NFT A;  4YS3 D;  3REK A;  4H9P A;  3KXB B;  5AY8 D;  5FUG A;  3MVD C;  4NE5 A;  5JA4 B;  2F8N D;  4KGC D;  1P3B A;  3W97 C;  5B1M A;  4WU9 B;  5AV8 D;  3V9R B;  1P3F D;  1BFM A;  4H9Q A;  4R8P A;  4YM6 D;  3WTP D;  4J8V B;  1ID3 C;  2NZD C;  2PYO D;  1P34 A;  2NQB B;  5E5A D;  3X1V D;  3X1T D;  1JFI B;  1M18 A;  3X1U B;  4KUD D;  5CP6 D;  3A6N A;  1EQZ B;  2CV5 C;  4ZUX B;  3C1C C;  3MGS C;  3REJ B;  3REL C;  3W99 B;  1P3L A;  1P3M B;  3AZI C;  5DNM A;  3MGR D;  2BYK A;  1HQ3 B;  4J8X D;  5AVC B;  3UTA C;  5B2I C;  5B0Z A;  2YFV B;  4H9P B;  1S32 C;  1P3G D;  5AV6 A;  3AYW C;  4NE6 A;  3LZ0 C;  1EQZ C;  3AZJ A;  5AY8 A;  5B1M B;  3VH5 T;  3VH6 W;  5GSU C;  1U35 B;  3W98 D;  5BS7 C;  4KGC A;  2LY8 A;  4R8P B;  1P3I B;  1KX3 A;  1M19 D;  4H9O A;  3LEL C;  3MVD D;  5AV8 A;  4WU8 B;  5DNN A;  1KX4 D;  2BYM A;  1P3F A;  4YM6 A;  5AVC C;  3WTP A;  1P34 B;  2HIO B;  3AZL B;  1Q9C A;  5B31 B;  4J8W C;  1M18 B;  3REK C;  2PYO A;  3AZN A;  1ID3 D;  3TU4 B;  5E5A A;  4AWL B;  3X1V A;  2NZD D;  3B0D B;  4KUD A;  5CP6 A;  1P3B C;  1P3A D;  4LD9 C;  5B40 B;  5DNM B;  2BYK B;  1P3K C;  1F66 D;  3B6G A;  3B6F A;  5F99 C;  4CAY A;  3C1C D;  3MGS D;  3MGR A;  4J8X A;  3C1B A;  3AZI D;  2YFW B;  5GXQ D;  3WAA D;  4HGA C;  3UTA D;  4YS3 B;  5B2I D;  4X23 A;  3A6N C;  4Z5T C;  5AY8 B;  4CSR A;  5B0Y A;  5CPI A;  1P3G A;  2F8N B;  4E44 A;  4KGC B;  1P3L C;  2ARO D;  5AV8 B;  3W98 A;  3AYW D;  2BYM B;  3AFA D;  1P3F B;  3NQU B;  1B6W A;  4JJN C;  1M19 A;  3AZE D;  3WTP B;  4XZQ A;  5B0Z C;  1KU5 A;  1KX4 A;  4H9S A;  5E5A B;  1TAF B;  2HUE B;  3X1T B;  3X1V B;  5CP6 B;  5AV6 C;  1ID3 A;  1ZLA D;  3AZJ C;  2NZD A;  4J8W D;  1BH9 A;  3REK D;  3KSY A;  1P3A A;  1KX3 C;  4J8U A;  5DNN C;  1F66 A;  4LD9 D;  4YM6 C;  3AZG C;  3REH D;  3MGS A;  1AOI A;  1P3K D;  2PYO C;  3AZN C;  5F99 D;  5E5A C;  5GXQ A;  3VH6 A;  3WAA A;  3UTA A;  3AZH B;  5B2I A;  4KUD C;  5CP6 C;  3MNN C;  3MGQ A;  3W98 B;  4Z5T D;  3B6F C;  3B0C W;  3B6G C;  3MVD B;  3KUY D;  2ARO A;  4WV4 B;  3AYW A;  3AFA A;  1KX4 B;  3MGR C;  4J8X C;  3C1B C;  3AZE A;  3W97 B;  5B32 G;  1P3L D;  5KDM A;  4JJN D;  5B0Z D;  4X23 C;  4Z66 D;  1ID3 B;  3UTB A;  2NZD B;  5CPI C;  5B0Y C;  1P3G C;  1ZLA A;  3AZF D;  5BNX A;  4J8W A;  3W98 C;  5AV6 D;  2CV5 B;  3AZJ D;  1M19 C;  4XZQ C;  5BT1 C;  3C1C B;  3MGS B;  4UUZ B;  1KX4 C;  2FJ7 A;  3REL B;  3AN2 D;  1KX3 D;  4LD9 A;  3AZI B;  3NQJ A;  4H9S C;  5GXQ B;  3REH A;  5G49 A;  5DNN D;  1P3K A;  3UTA B;  5B2I B;  5AV5 A;  5F99 A;  3AZG D;  5B2J D;  5BNV A;  3AZM A;  3AZN D;  5BO0 B;  1P3A C;  4Z2M G;  4J8U C;  1S32 B;  3AYW B;  4WNN A;  3LZ0 B;  4Z5T A;  1F66 C;  3MNN D;  5GSU B;  1B67 A;  5AVB C;  3KUY A;  1AOI C;  1H3O B;  3B6F D;  3B6G D;  3LEL B;  4ZBJ C;  3WAA C;  5GXQ C;  4JJN A;  4XUJ C;  3C1B D;  4Z66 A;  3O62 A;  3MGQ C;  4J8W B;  3REK B;  1N1J A;  4X23 D;  4QLC D;  3AZF A;  2IO5 C;  5FUG B;  5B0Y D;  5CPI D;  2ARO C;  2F8N H;  5JRG A;  3AFA C;  1P3B B;  4LD9 B;  3AZE C;  3MGP C;  1P3K B;  3AN2 A;  4H9Q B;  3R45 A;  3X1S D;  5F99 B;  4XZQ D;  5BT1 D;  3LZ1 D;  4G91 C;  1P3P D;  3UTB C;  5B1L C;  1KX5 C;  5BNV B;  3AZG A;  5B2J A;  1ZLA C;  4HGA B;  4WNN B;  1P3O A;  3A6N B;  3AZK A;  4Z5T B;  4EO5 C;  2FJ7 C;  3MNN A;  5B31 G;  1P3L B;  4J8U D;  3REH C;  4JJN B;  5GT3 C;  5B24 C;  5B0Z B;  5B32 D;  5AV5 C;  5AVB D;  5CHL B;  1AOI D;  3AV1 C;  1N1J B;  3VH6 T;  3AZM C;  3REI C;  3AZF B;  3UT9 D;  1WWS A;  4XUJ D;  5AV6 B;  4QLC A;  3AZJ B;  3MGQ D;  3KUY C;  3AN2 B;  1KX3 B;  4H9O B;  5DNN B;  3B0B A;  3AV2 D;  4YM6 B;  3X1S A;  3LZ1 A;  3MGP D;  1P3P A;  4Z66 C;  3O62 C;  3AZG B;  5AV9 C;  3KXB D;  2PYO B;  3AZN B;  5GT0 C;  3UTB D;  5B1L D;  5B33 C;  3AZF C;  1KX5 D;  4KUD B;  5JRG C;  4WU9 D;  3MNN B;  4H9N A;  3LJA A;  5CPJ C;  5CPK C;  3B6F B;  3AN2 C;  3B6G B;  2RVQ D;  4CAY B;  3MGR B;  2FJ7 D;  4J8X B;  3C1B B;  2NQB D;  2L5A A;  5B32 A;  5AVB A;  3X1U D;  5B2J C;  5GT3 D;  5B24 D;  1P3O C;  4X23 B;  5AV5 D;  3AZK C;  3UT9 A;  4CSR B;  5B0Y B;  5CPI B;  4XUJ A;  1P3G B;  3AV1 D;  3AZM D;  3WKJ C;  3REI D;  3KWQ C;  1M19 B;  3LZ1 B;  4XZQ B;  3AV2 A;  3MGP A;  3KXB A;  4QLC C;  3O62 D;  5B1L A;  5AV9 D;  4H9N B;  1KX5 A;  1P3I D;  4E45 A;  1BH9 B;  4WU9 A;  1F1E A;  2CWE A;  5GT0 D;  3V9R A;  4WU8 D;  4J8U B;  5B33 D;  1P3A B;  5JRG D;  2HIO D;  1F66 B;  3AZL D;  5B31 D;  5AVB B;  3X1S C;  3LZ1 C;  1P3P C;  1M1A C;  1ULY A;  5CPJ D;  1AOI B;  3TU4 D;  5CPK D;  2NQB A;  1JFI A;  4ZBJ B;  3X1U A;  3WAA B;  5GT3 A;  3B0C T;  4DRB A;  4XUJ B;  5B24 A;  5B40 D;  4ZUX A;  1TZY C;  3REJ A;  3MGQ B;  1R4V A;  3W99 A;  3LJA C;  3AV1 A;  1P3O D;  1P3M A;  3AZK D;  3REI A;  2IO5 B;  2ARO B;  2YFV A;  3AFA B;  3WKJ D;  3WA9 C;  3AZE B;  3MGP B;  5B32 C;  3KWQ D;  5KDM B;  1A7W A;  4G91 B;  3UTB B;  5B1L B;  1KX5 B;  3UT9 C;  4G92 C;  1ZLA B; 
#chains in the Genus database with same CATH topology
 5AV9 A;  5BNX B;  1P3I A;  5C3I C;  5GT0 A;  4WU8 A;  3W96 C;  1WWI A;  5B33 A;  3VH5 W;  4EO5 B;  2HIO A;  2FJ7 B;  2ZY3 A;  3AV2 C;  3AZL A;  5B31 A;  3NQJ B;  3REH B;  5CPJ A;  5G49 B;  3TU4 A;  5GT3 B;  3KXB C;  5CPK A;  5B24 B;  5AV5 B;  1M1A D;  2ZY5 A;  3AV1 B;  3EPL A;  3AZM B;  4NE3 A;  5B40 A;  3REI B;  4WU9 C;  4J8V C;  1TZY D;  2RVQ C;  3KUY B;  3LJA D;  3WKJ A;  2YFW A;  2NQB C;  2JCH A;  4YS3 A;  3KWQ A;  3AZH D;  3X1U C;  3WA9 D;  4Z66 B;  3O62 B;  4ZUX C;  2F8N A;  5AV9 B;  3REJ C;  1BH8 A;  3W99 C;  2W8S A;  5GT0 B;  1P3M C;  5B33 B;  3NQU A;  1HQ3 C;  3W97 D;  5JRG B;  5CPJ B;  5CPK B;  3W96 D;  1TAF A;  3R45 B;  3X1T A;  5B1M C;  1U35 C;  1M1A A;  2F8N G;  5B2J B;  2CV5 D;  4R8P C;  1P3I C;  1P3O B;  3AZK B;  4WU8 C;  3REL D;  1U35 A;  3WKJ B;  1P34 C;  2HIO C;  1TZY A;  3AZL C;  5B31 C;  3KWQ B;  1M18 C;  4J8V D;  3TU4 C;  4AWL C;  2RIQ A;  3AZH A;  3B0D C;  3WA9 A;  1BH8 B;  4WZS B;  1S32 D;  5B40 C;  5DNM C;  3LZ0 D;  3VH5 A;  1EQZ D;  4M6B A;  5GSU D;  3MVD A;  4KHA A;  4QLC B;  4ZUX D;  3REJ D;  4H9R A;  3W97 A;  3W99 D;  3LEL D;  1P3M D;  1HQ3 D;  4YS3 C;  5AVC D;  2Y2N A;  5AY8 C;  3W96 A;  3X1S B;  2JSS A;  1P3P B;  1M1A B;  4KGC C;  5AV8 C;  2CV5 A;  1P3F C;  1P3B D;  1W2E A;  4DRA A;  3WTP C;  5B1M D;  3C1C A;  1U35 D;  1TZY B;  4Z2M H;  4UUZ A;  5JA4 A;  3REL A;  4R8P D;  3LJA B;  2F8N K;  3AZI A;  3X1V C;  2HUE C;  3X1T C;  4J8V A;  1P34 D;  3WA9 B;  5B32 B;  1M18 D;  3A6N D;  3WTP E;  3P5J B;  5BO0 A;  4KHA B;  1S32 A;  1HTA A;  3LZ0 A;  3UT9 B;  1EQZ A;  4H9R B;  5GSU A;  4G92 B;  5BS7 A;  5DNM D;  1H3O A;  5C3I B;  3LEL A;  1Z2C B;  3W96 B;  1PZR A;  1HQ3 A;  5AVC A;  3AZH C;  3AV2 B;  2Y2P A;  4NFT A;  4YS3 D;  3REK A;  4H9P A;  3KXB B;  5AY8 D;  5FUG A;  3MVD C;  4NE5 A;  5JA4 B;  2F8N D;  4KGC D;  1P3B A;  2Y2H A;  3W97 C;  4WJ3 C;  5B1M A;  4WU9 B;  5AV8 D;  3V9R B;  1P3F D;  1BFM A;  4H9Q A;  4R8P A;  4YM6 D;  3WTP D;  4J8V B;  1ID3 C;  2NZD C;  2PYO D;  1P34 A;  3EPH A;  5E5A D;  2NQB B;  3X1V D;  3X1T D;  2G5H C;  1JFI B;  1M18 A;  3X1U B;  4KUD D;  2Y2J A;  5CP6 D;  3A6N A;  2CV5 C;  1EQZ B;  4ZUX B;  3C1C C;  3MGS C;  3REJ B;  3REL C;  3W99 B;  2Y2Q A;  1P3L A;  2Y2M A;  1P3M B;  3AZI C;  5DNM A;  2J8P A;  3MGR D;  2BYK A;  1HQ3 B;  4J8X D;  5AVC B;  3UTA C;  5B2I C;  5B0Z A;  2YFV B;  4H9P B;  1T3U A;  1S32 C;  3EG5 B;  1P3G D;  5AV6 A;  3AYW C;  4NE6 A;  3LZ0 C;  1EQZ C;  3AZJ A;  5AY8 A;  5B1M B;  3VH5 T;  3VH6 W;  5GSU C;  2Y2G A;  1U35 B;  3W98 D;  5BS7 C;  4KGC A;  2LY8 A;  4R8P B;  1P3I B;  1KX3 A;  1M19 D;  4H9O A;  3LEL C;  3MVD D;  5AV8 A;  4WU8 B;  5DNN A;  1KX4 D;  2BYM A;  1P3F A;  4YM6 A;  5AVC C;  3WTP A;  1P34 B;  2HIO B;  3AZL B;  1Q9C A;  5B31 B;  4J8W C;  1M18 B;  3REK C;  2PYO A;  3AZN A;  1ID3 D;  3TU4 B;  5E5A A;  4UPK A;  4AWL B;  3X1V A;  2NZD D;  3B0D B;  4KUD A;  5CP6 A;  3H0R C;  1P3B C;  1P3A D;  4LD9 C;  5B40 B;  5DNM B;  2BYK B;  1P3K C;  1F66 D;  3B6G A;  3B6F A;  2G5I C;  4CAY A;  5F99 C;  3C1C D;  3MGS D;  3MGR A;  4J8X A;  3C1B A;  2JE5 A;  3AZI D;  2YFW B;  5GXQ D;  3WAA D;  4HGA C;  3UTA D;  4YS3 B;  5B2I D;  4X23 A;  3A6N C;  4Z5T C;  5AY8 B;  4CSR A;  5B0Y A;  5CPI A;  1P3G A;  2F8N B;  4E44 A;  4KGC B;  1P3L C;  2ARO D;  5AV8 B;  3W98 A;  3AYW D;  3AL0 C;  2BYM B;  3AFA D;  1P3F B;  3NQU B;  1B6W A;  4JJN C;  1M19 A;  3AZE D;  3WTP B;  4XZQ A;  5B0Z C;  1KU5 A;  1KX4 A;  4H9S A;  5E5A B;  1TAF B;  2HUE B;  3X1T B;  3X1V B;  5CP6 B;  5AV6 C;  4DQY B;  1ID3 A;  1ZLA D;  3AZJ C;  2NZD A;  4J8W D;  1BH9 A;  3REK D;  3KSY A;  1P3A A;  1KX3 C;  4J8U A;  2UWX A;  5DNN C;  1F66 A;  2F2A C;  4LD9 D;  4YM6 C;  3AZG C;  3REH D;  3MGS A;  1AOI A;  1P3K D;  2PYO C;  3AZN C;  5F99 D;  5E5A C;  5GXQ A;  3VH6 A;  3WAA A;  3UTA A;  3AZH B;  5B2I A;  4KUD C;  5CP6 C;  3MNN C;  3MGQ A;  3W98 B;  2DF4 C;  4Z5T D;  3B6F C;  3B0C W;  3B6G C;  3MVD B;  3KUY D;  2ARO A;  4WV4 B;  3AYW A;  3AFA A;  1KX4 B;  3MGR C;  4J8X C;  3C1B C;  3AZE A;  3W97 B;  2Y2L A;  5B32 G;  1P3L D;  5KDM A;  4JJN D;  5B0Z D;  4X23 C;  3A1I A;  4Z66 D;  1ID3 B;  3UTB A;  2NZD B;  5CPI C;  5B0Y C;  1P3G C;  1ZLA A;  3AZF D;  5BNX A;  4J8W A;  3IP4 C;  3W98 C;  5AV6 D;  3H0L C;  2CV5 B;  2VQR A;  2Y2K A;  3AZJ D;  1M19 C;  4XZQ C;  5BT1 C;  3C1C B;  3MGS B;  4UUZ B;  1KX4 C;  2FJ7 A;  3REL B;  3AN2 D;  1KX3 D;  4LD9 A;  2XD1 A;  3AZI B;  3NQJ A;  4H9S C;  5GXQ B;  3REH A;  5G49 A;  5DNN D;  1P3K A;  3UTA B;  3FDD A;  5B2I B;  5AV5 A;  5F99 A;  3AZG D;  5B2J D;  5BNV A;  3AZM A;  3AZN D;  2BG1 A;  5BO0 B;  1P3A C;  4Z2M G;  4J8U C;  1S32 B;  3AYW B;  4WNN A;  3LZ0 B;  4Z5T A;  1F66 C;  3MNN D;  5GSU B;  1B67 A;  5AVB C;  3KUY A;  2ZY4 A;  1AOI C;  1H3O B;  3B6F D;  3B6G D;  3LEL B;  3H0M C;  4ZBJ C;  3WAA C;  5GXQ C;  4JJN A;  4XUJ C;  3C1B D;  4Z66 A;  3O62 A;  3MGQ C;  4J8W B;  3A1K A;  3REK B;  1N1J A;  4X23 D;  4QLC D;  2DQN C;  3AZF A;  2IO5 C;  5FUG B;  5B0Y D;  5CPI D;  2ARO C;  2F8N H;  5JRG A;  3AFA C;  1P3B B;  4LD9 B;  3AZE C;  2ZM5 A;  3MGP C;  1P3K B;  3AN2 A;  4H9Q B;  3R45 A;  3X1S D;  5F99 B;  4XZQ D;  5BT1 D;  3LZ1 D;  4G91 C;  1P3P D;  3UTB C;  5B1L C;  1KX5 C;  5BNV B;  3AZG A;  5B2J A;  1ZLA C;  2ZY2 A;  4HGA B;  4WNN B;  1P3O A;  3A6N B;  3AZK A;  4Z5T B;  4EO5 C;  2FJ7 C;  3MNN A;  5B31 G;  1P3L B;  4J8U D;  3EPK A;  3REH C;  4JJN B;  5GT3 C;  5B24 C;  5B0Z B;  5B32 D;  5AV5 C;  5AVB D;  3F6T A;  5CHL B;  1AOI D;  3AV1 C;  1N1J B;  3VH6 T;  3AZM C;  3REI C;  3AZF B;  3UT9 D;  1WWS A;  4XUJ D;  5AV6 B;  4QLC A;  3AZJ B;  3MGQ D;  3KUY C;  3AN2 B;  1KX3 B;  4H9O B;  5DNN B;  3B0B A;  3AV2 D;  4YM6 B;  3X1S A;  3LZ1 A;  3MGP D;  1P3P A;  4Z66 C;  3O62 C;  3AZG B;  5AV9 C;  3KXB D;  2PYO B;  3AZN B;  5GT0 C;  3UTB D;  5B1L D;  5B33 C;  3AZF C;  1KX5 D;  4KUD B;  5JRG C;  4WU9 D;  3MNN B;  4H9N A;  3LJA A;  5CPJ C;  5CPK C;  3B6F B;  3AN2 C;  3B6G B;  2RVQ D;  4CAY B;  3MGR B;  2FJ7 D;  4J8X B;  3C1B B;  2NQB D;  2XD5 A;  2L5A A;  5B32 A;  5AVB A;  3X1U D;  5B2J C;  5GT3 D;  5B24 D;  1P3O C;  4X23 B;  5AV5 D;  3AZK C;  3UT9 A;  4CSR B;  5B0Y B;  5CPI B;  4XUJ A;  1P3G B;  3AV1 D;  3EPJ A;  3AZM D;  3WKJ C;  3REI D;  3KWQ C;  1M19 B;  2Y2I A;  3LZ1 B;  4XZQ B;  3AV2 A;  2FFF B;  3MGP A;  3KFU G;  3KXB A;  4QLC C;  3O62 D;  5B1L A;  5AV9 D;  4H9N B;  1KX5 A;  1P3I D;  4E45 A;  1BH9 B;  4WU9 A;  1F1E A;  2CWE A;  5GT0 D;  3V9R A;  4WU8 D;  4J8U B;  5B33 D;  1P3A B;  5JRG D;  2HIO D;  1F66 B;  2Y2O A;  3AZL D;  5B31 D;  5AVB B;  3X1S C;  3LZ1 C;  1P3P C;  1M1A C;  1ULY A;  5CPJ D;  1AOI B;  3TU4 D;  5CPK D;  2NQB A;  1JFI A;  4ZBJ B;  3X1U A;  3WAA B;  5GT3 A;  3B0C T;  4DRB A;  4XUJ B;  5B24 A;  5B40 D;  4ZUX A;  1TZY C;  3REJ A;  3MGQ B;  1R4V A;  3W99 A;  3LJA C;  3AV1 A;  1P3O D;  1P3M A;  3AZK D;  3REI A;  2IO5 B;  2ARO B;  2YFV A;  3AFA B;  3WKJ D;  3WA9 C;  3AZE B;  3MGP B;  5B32 C;  3KWQ D;  5KDM B;  1A7W A;  4G91 B;  3UTB B;  5B1L B;  1KX5 B;  3UT9 C;  4G92 C;  1ZLA B; 
#chains in the Genus database with same CATH homology
 5AV9 A;  5BNX B;  1P3I A;  5C3I C;  5GT0 A;  4WU8 A;  3W96 C;  1WWI A;  5B33 A;  3VH5 W;  4EO5 B;  2HIO A;  2FJ7 B;  2ZY3 A;  3AV2 C;  3AZL A;  5B31 A;  3NQJ B;  3REH B;  5CPJ A;  5G49 B;  3TU4 A;  5GT3 B;  3KXB C;  5CPK A;  5B24 B;  5AV5 B;  1M1A D;  2ZY5 A;  3AV1 B;  3EPL A;  3AZM B;  4NE3 A;  5B40 A;  3REI B;  4WU9 C;  4J8V C;  1TZY D;  2RVQ C;  3KUY B;  3LJA D;  3WKJ A;  2YFW A;  2NQB C;  2JCH A;  4YS3 A;  3KWQ A;  3AZH D;  3X1U C;  3WA9 D;  4Z66 B;  3O62 B;  4ZUX C;  2F8N A;  5AV9 B;  3REJ C;  1BH8 A;  3W99 C;  2W8S A;  5GT0 B;  1P3M C;  5B33 B;  3NQU A;  1HQ3 C;  3W97 D;  5JRG B;  5CPJ B;  5CPK B;  3W96 D;  1TAF A;  3R45 B;  3X1T A;  5B1M C;  1U35 C;  1M1A A;  2F8N G;  5B2J B;  2CV5 D;  4R8P C;  1P3I C;  1P3O B;  3AZK B;  4WU8 C;  3REL D;  1U35 A;  3WKJ B;  1P34 C;  2HIO C;  1TZY A;  3AZL C;  5B31 C;  3KWQ B;  1M18 C;  4J8V D;  3TU4 C;  4AWL C;  2RIQ A;  3AZH A;  3B0D C;  3WA9 A;  1BH8 B;  4WZS B;  1S32 D;  5B40 C;  5DNM C;  3LZ0 D;  3VH5 A;  1EQZ D;  4M6B A;  5GSU D;  3MVD A;  4KHA A;  4QLC B;  4ZUX D;  3REJ D;  4H9R A;  3W97 A;  3W99 D;  3LEL D;  1P3M D;  1HQ3 D;  4YS3 C;  5AVC D;  2Y2N A;  5AY8 C;  3W96 A;  3X1S B;  2JSS A;  1P3P B;  1M1A B;  4KGC C;  5AV8 C;  2CV5 A;  1P3F C;  1P3B D;  1W2E A;  4DRA A;  3WTP C;  5B1M D;  3C1C A;  1U35 D;  1TZY B;  4Z2M H;  4UUZ A;  5JA4 A;  3REL A;  4R8P D;  3LJA B;  2F8N K;  3AZI A;  3X1V C;  2HUE C;  3X1T C;  4J8V A;  1P34 D;  3WA9 B;  5B32 B;  1M18 D;  3A6N D;  3WTP E;  3P5J B;  5BO0 A;  4KHA B;  1S32 A;  1HTA A;  3LZ0 A;  3UT9 B;  1EQZ A;  4H9R B;  5GSU A;  4G92 B;  5BS7 A;  5DNM D;  1H3O A;  5C3I B;  3LEL A;  1Z2C B;  3W96 B;  1PZR A;  1HQ3 A;  5AVC A;  3AZH C;  3AV2 B;  2Y2P A;  4NFT A;  4YS3 D;  3REK A;  4H9P A;  3KXB B;  5AY8 D;  5FUG A;  3MVD C;  4NE5 A;  5JA4 B;  2F8N D;  4KGC D;  1P3B A;  2Y2H A;  3W97 C;  4WJ3 C;  5B1M A;  4WU9 B;  5AV8 D;  3V9R B;  1P3F D;  1BFM A;  4H9Q A;  4R8P A;  4YM6 D;  3WTP D;  4J8V B;  1ID3 C;  2NZD C;  2PYO D;  1P34 A;  3EPH A;  5E5A D;  2NQB B;  3X1V D;  3X1T D;  2G5H C;  1JFI B;  1M18 A;  3X1U B;  4KUD D;  2Y2J A;  5CP6 D;  3A6N A;  2CV5 C;  1EQZ B;  4ZUX B;  3C1C C;  3MGS C;  3REJ B;  3REL C;  3W99 B;  2Y2Q A;  1P3L A;  2Y2M A;  1P3M B;  3AZI C;  5DNM A;  2J8P A;  3MGR D;  2BYK A;  1HQ3 B;  4J8X D;  5AVC B;  3UTA C;  5B2I C;  5B0Z A;  2YFV B;  4H9P B;  1T3U A;  1S32 C;  3EG5 B;  1P3G D;  5AV6 A;  3AYW C;  4NE6 A;  3LZ0 C;  1EQZ C;  3AZJ A;  5AY8 A;  5B1M B;  3VH5 T;  3VH6 W;  5GSU C;  2Y2G A;  1U35 B;  3W98 D;  5BS7 C;  4KGC A;  2LY8 A;  4R8P B;  1P3I B;  1KX3 A;  1M19 D;  4H9O A;  3LEL C;  3MVD D;  5AV8 A;  4WU8 B;  5DNN A;  1KX4 D;  2BYM A;  1P3F A;  4YM6 A;  5AVC C;  3WTP A;  1P34 B;  2HIO B;  3AZL B;  1Q9C A;  5B31 B;  4J8W C;  1M18 B;  3REK C;  2PYO A;  3AZN A;  1ID3 D;  3TU4 B;  5E5A A;  4UPK A;  4AWL B;  3X1V A;  2NZD D;  3B0D B;  4KUD A;  5CP6 A;  3H0R C;  1P3B C;  1P3A D;  4LD9 C;  5B40 B;  5DNM B;  2BYK B;  1P3K C;  1F66 D;  3B6G A;  3B6F A;  2G5I C;  4CAY A;  5F99 C;  3C1C D;  3MGS D;  3MGR A;  4J8X A;  3C1B A;  2JE5 A;  3AZI D;  2YFW B;  5GXQ D;  3WAA D;  4HGA C;  3UTA D;  4YS3 B;  5B2I D;  4X23 A;  3A6N C;  4Z5T C;  5AY8 B;  4CSR A;  5B0Y A;  5CPI A;  1P3G A;  2F8N B;  4E44 A;  4KGC B;  1P3L C;  2ARO D;  5AV8 B;  3W98 A;  3AYW D;  3AL0 C;  2BYM B;  3AFA D;  1P3F B;  3NQU B;  1B6W A;  4JJN C;  1M19 A;  3AZE D;  3WTP B;  4XZQ A;  5B0Z C;  1KU5 A;  1KX4 A;  4H9S A;  5E5A B;  1TAF B;  2HUE B;  3X1T B;  3X1V B;  5CP6 B;  5AV6 C;  4DQY B;  1ID3 A;  1ZLA D;  3AZJ C;  2NZD A;  4J8W D;  1BH9 A;  3REK D;  3KSY A;  1P3A A;  1KX3 C;  4J8U A;  2UWX A;  5DNN C;  1F66 A;  2F2A C;  4LD9 D;  4YM6 C;  3AZG C;  3REH D;  3MGS A;  1AOI A;  1P3K D;  2PYO C;  3AZN C;  5F99 D;  5E5A C;  5GXQ A;  3VH6 A;  3WAA A;  3UTA A;  3AZH B;  5B2I A;  4KUD C;  5CP6 C;  3MNN C;  3MGQ A;  3W98 B;  2DF4 C;  4Z5T D;  3B6F C;  3B0C W;  3B6G C;  3MVD B;  3KUY D;  2ARO A;  4WV4 B;  3AYW A;  3AFA A;  1KX4 B;  3MGR C;  4J8X C;  3C1B C;  3AZE A;  3W97 B;  2Y2L A;  5B32 G;  1P3L D;  5KDM A;  4JJN D;  5B0Z D;  4X23 C;  3A1I A;  4Z66 D;  1ID3 B;  3UTB A;  2NZD B;  5CPI C;  5B0Y C;  1P3G C;  1ZLA A;  3AZF D;  5BNX A;  4J8W A;  3IP4 C;  3W98 C;  5AV6 D;  3H0L C;  2CV5 B;  2VQR A;  2Y2K A;  3AZJ D;  1M19 C;  4XZQ C;  5BT1 C;  3C1C B;  3MGS B;  4UUZ B;  1KX4 C;  2FJ7 A;  3REL B;  3AN2 D;  1KX3 D;  4LD9 A;  2XD1 A;  3AZI B;  3NQJ A;  4H9S C;  5GXQ B;  3REH A;  5G49 A;  5DNN D;  1P3K A;  3UTA B;  3FDD A;  5B2I B;  5AV5 A;  5F99 A;  3AZG D;  5B2J D;  5BNV A;  3AZM A;  3AZN D;  2BG1 A;  5BO0 B;  1P3A C;  4Z2M G;  4J8U C;  1S32 B;  3AYW B;  4WNN A;  3LZ0 B;  4Z5T A;  1F66 C;  3MNN D;  5GSU B;  1B67 A;  5AVB C;  3KUY A;  2ZY4 A;  1AOI C;  1H3O B;  3B6F D;  3B6G D;  3LEL B;  3H0M C;  4ZBJ C;  3WAA C;  5GXQ C;  4JJN A;  4XUJ C;  3C1B D;  4Z66 A;  3O62 A;  3MGQ C;  4J8W B;  3A1K A;  3REK B;  1N1J A;  4X23 D;  4QLC D;  2DQN C;  3AZF A;  2IO5 C;  5FUG B;  5B0Y D;  5CPI D;  2ARO C;  2F8N H;  5JRG A;  3AFA C;  1P3B B;  4LD9 B;  3AZE C;  2ZM5 A;  3MGP C;  1P3K B;  3AN2 A;  4H9Q B;  3R45 A;  3X1S D;  5F99 B;  4XZQ D;  5BT1 D;  3LZ1 D;  4G91 C;  1P3P D;  3UTB C;  5B1L C;  1KX5 C;  5BNV B;  3AZG A;  5B2J A;  1ZLA C;  2ZY2 A;  4HGA B;  4WNN B;  1P3O A;  3A6N B;  3AZK A;  4Z5T B;  4EO5 C;  2FJ7 C;  3MNN A;  5B31 G;  1P3L B;  4J8U D;  3EPK A;  3REH C;  4JJN B;  5GT3 C;  5B24 C;  5B0Z B;  5B32 D;  5AV5 C;  5AVB D;  3F6T A;  5CHL B;  1AOI D;  3AV1 C;  1N1J B;  3VH6 T;  3AZM C;  3REI C;  3AZF B;  3UT9 D;  1WWS A;  4XUJ D;  5AV6 B;  4QLC A;  3AZJ B;  3MGQ D;  3KUY C;  3AN2 B;  1KX3 B;  4H9O B;  5DNN B;  3B0B A;  3AV2 D;  4YM6 B;  3X1S A;  3LZ1 A;  3MGP D;  1P3P A;  4Z66 C;  3O62 C;  3AZG B;  5AV9 C;  3KXB D;  2PYO B;  3AZN B;  5GT0 C;  3UTB D;  5B1L D;  5B33 C;  3AZF C;  1KX5 D;  4KUD B;  5JRG C;  4WU9 D;  3MNN B;  4H9N A;  3LJA A;  5CPJ C;  5CPK C;  3B6F B;  3AN2 C;  3B6G B;  2RVQ D;  4CAY B;  3MGR B;  2FJ7 D;  4J8X B;  3C1B B;  2NQB D;  2XD5 A;  2L5A A;  5B32 A;  5AVB A;  3X1U D;  5B2J C;  5GT3 D;  5B24 D;  1P3O C;  4X23 B;  5AV5 D;  3AZK C;  3UT9 A;  4CSR B;  5B0Y B;  5CPI B;  4XUJ A;  1P3G B;  3AV1 D;  3EPJ A;  3AZM D;  3WKJ C;  3REI D;  3KWQ C;  1M19 B;  2Y2I A;  3LZ1 B;  4XZQ B;  3AV2 A;  2FFF B;  3MGP A;  3KFU G;  3KXB A;  4QLC C;  3O62 D;  5B1L A;  5AV9 D;  4H9N B;  1KX5 A;  1P3I D;  4E45 A;  1BH9 B;  4WU9 A;  1F1E A;  2CWE A;  5GT0 D;  3V9R A;  4WU8 D;  4J8U B;  5B33 D;  1P3A B;  5JRG D;  2HIO D;  1F66 B;  2Y2O A;  3AZL D;  5B31 D;  5AVB B;  3X1S C;  3LZ1 C;  1P3P C;  1M1A C;  1ULY A;  5CPJ D;  1AOI B;  3TU4 D;  5CPK D;  2NQB A;  1JFI A;  4ZBJ B;  3X1U A;  3WAA B;  5GT3 A;  3B0C T;  4DRB A;  4XUJ B;  5B24 A;  5B40 D;  4ZUX A;  1TZY C;  3REJ A;  3MGQ B;  1R4V A;  3W99 A;  3LJA C;  3AV1 A;  1P3O D;  1P3M A;  3AZK D;  3REI A;  2IO5 B;  2ARO B;  2YFV A;  3AFA B;  3WKJ D;  3WA9 C;  3AZE B;  3MGP B;  5B32 C;  3KWQ D;  5KDM B;  1A7W A;  4G91 B;  3UTB B;  5B1L B;  1KX5 B;  3UT9 C;  4G92 C;  1ZLA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...