3MGQB

Binding of nickel ions to the nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqB00
5BNXA 5B32C 5CPKB 3W97B 1KX3B 1P3BB 4ZBJB 1HQ3D 4YS3D 3AZMA 1U35C 5B33B 3AYWB 2F8NB 2L5AA 5GSUB 3TU4B 4WU8B 3AN2B 3W97C 1P3BC 4WU9A 4Z5TB 5B33C 3MVDA 3MGSA 5B1MD 3WTPE 3AZED 3TU4C 3LZ1A 5E5AB 4R8PD 5GT0C 1P3PA 3AZKA 1P3ID 1P3MA 5B40C 4KHAA 4J8XB 3REKA 3AZFC 5G49B 2FJ7A 3UTAB 1ID3C 3MGPB 5B31G 3W96C 3UTBB 1M1AD 1R4VA 5AVBC 3O62A 5AV8B 1H3OA 3REJA 3AZID 3X1VB 5CPIB 1S32D 3MNNB 5F99B 3UTBC 2CV5D 5B0YA 4HGAC 4H9SC 5GXQB 4J8WB 3MGRB 4J8UD 3KWQB 4LD9C 5B32D 3REIC 3B6FB 3LELC 2YFWA 5B1LB 5AV9D 2AROB 2BYKA 4QLCA 4NE5A 4X23D 4E45A 3REHA 3X1UB 5AVCB 5GT0D 4M6BA 1M18D 3LZ0A 5B0ZA 5B40D 5DNMA 1KX4C 3WTPB 1KU5A 3VH6T 3VH6W 3AZFD 3X1UC 4JJNC 4G91B 4XUJB 1BFMA 3WTPC 3C1BA 3WKJC 2RVQC 5BS7C 3AV2A 5AVBD 4G91C 3AZLC 3LJAC 1HTAA 2F8NG 2NZDB 4CAYA 3AZJA 3C1CC 4LD9D 3REID 3MVDD 3MGSD 3AZHC 1P3LC 3LELD 4XZQB 1EQZB 5DNNB 1P3FA 1P3PD 3R45B 1P3AB 3WA9C 5B31A 1P3GB 4Z66A 5GT3A 3REKD 2PYOA 2FJ7D 2HIOA 2LY8A 4KGCC 3AFAA 3VH5A 1P3KC 1HQ3B 4YS3B 2YFVA 1KX4D 5BT1D 1KX5C 1BH9B 5C3IB 4JJND 3O62D 1HQ3C 4YS3C 4WV4B 3AZEB 5B1MB 3WKJD 3WAAC 5B0YD 3AV1C 5AV6A 4R8PB 1P3IB 5B1MC 1TZYA 4UUZB 3W98A 3RELA 3LJAD 5JRGA 4R8PC 3MGQC 4J8VB 3C1CD 5AY8B 3NQUB 2HUEB 1M19C 1P34A 3AZHD 3AZNA 4Z2MH 1M1AB 5AV5C 3REHD 2F8NK 2HUEC 3B0BA 3LZ0D 1S32B 3AZIB 5DNMD 1AOIC 3WA9D 2CV5B 1M1AC 3X1SC 4J8UB 3B6GC 3KXBA 4KGCD 5B32B 5CPJA 5CP6C 1U35B 2CV5C 1P3KD 3AV2D 5CPKA 1BH8B 4WNNB 1KX3A 5AV9B 1JFIB 3AYWA 2F8NA 5GSUA 4WU8A 4X23B 3AN2A 3WAAD 3AV1D 4Z5TA 5AV9C 5GT0B 4AWLC 1M18B 4X23C 5B40B 5E5AA 3AZFB 3MGQD 4G92B 1ID3B 1M18C 4J8XA 1P3OA 3AZGA 5G49A 5B2JC 3UTAA 1M19D 3W96B 3KUYC 3MGPA 5B24A 4G92C 5B31D 5AVBB 5AV5D 4YM6A 5BNXB 3AFAD 3A6NC 1AOID 5AV8A 4HGAB 3X1SD 5CPIA 3B6GD 3X1VA 3MNNA 5F99A 3W99A 4LD9B 3AZMC 4EO5B 3REIB 4DRBA 3MVDB 5CP6D 5GXQA 3MGSB 3MGRA 4J8WA 3KWQA 3UT9A 3LELB 4WU9C 4EO5C 1TAFA 1P3PB 3MVDC 3MGSC 3B6FA 1WWSA 5B1LA 3LZ1C 2AROA 2NQBA 5KDMA 2FJ7B 4H9PB 5B2IA 3AZKC 1P3MC 1P3PC 1P34D 1KX4B 5AVCA 3REKC 2FJ7C 5BNVA 4JJNB 4H9OA 3O62B 5BT1C 3WKJB 5B2JD 1Q9CA 3NQJA 3KUYD 3X1TA 1B67A 3O62C 4XUJA 4NFTA 3AZLB 3REJC 3A6ND 5B0YC 3LJAB 1F66A 4CSRB 2YFWB 3C1CB 5CHLB 3AZMD 2NZDA 5GSUD 3AZHB 3AN2D 1P3LB 4H9NB 4WU9D 4QLCC 3LZ0B 5FUGB 1ZLAA 3WA9B 4XZQA 1EQZA 3LZ1D 5DNNA 5JA4A 3REHC 3R45A 3AZKD 1P3AA 1P3MD 3LZ0C 4J8XD 5B0ZC 4KGCB 5DNMC 1N1JA 1P3GA 3AZGD 1P3KB 1P3OD 4KUDA 3UTAD 5B24D 3AV2B 1KX5B 4YM6D 3C1BC 1BH9A 3AV2C 4ZUXA 3WAAB 3AV1B 5CPID 4H9QA 3W99D 3REJD 5GXQD 5BO0B 3MGRD 3V9RB 3KWQD 3UT9D 1P3IA 3MGQB 3AZJC 4UUZA 1ZLAC 1M19B 4J8VA 5AY8A 2NQBD 5B31B 5AV5B 1P3FC 5B2ID 4QLCD 3AFAB 2YFVB 1AOIB 5B31C 2PYOC 4Z66C 5GT3C 3X1SB 2HIOC 3AZIA 1S32A 3B6GB 3AFAC 5B0ZD 5CP6B 4J8UA 3X1TD 3VH5T 3VH5W 1U35A 3C1BD 1F66D 3W97A 5AV6C 1P3BA 5B33A 2BYMB 1TZYC 3TU4A 4AWLB 3W98C 3RELC 5JRGC 3B0DC 1P34B 5GT0A 5B40A 3AZJD 2IO5C 1P34C 3AZFA 1ZLAD 5B2JB 3AZNC 4H9RB 1ID3A 3KUYB 1P3FD 3W96A 1P3AD 3A6NB 4KUDD 5AVBA 2PYOD 4Z66D 5GT3D 3KXBC 2HIOD 3UTBA 5CPJC 3AZMB 4H9SA 5CPKC 4ZUXD 1KX3C 4LD9A 4ZBJC 3B0CT 3B0CW 3REIA 3AYWC 4WU9B 5GSUC 4WU8C 3AN2C 3LELA 4E44A 3LZ1B 5AV6D 4Z5TC 3AZKB 1P3MB 1TZYD 3W98D 4KHAB 3RELD 2CWEA 5E5AC 3AZGB 1P3OB 5JRGD 4H9PA 3VH6A 3REKB 4J8VD 5B24B 5AY8D 4J8XC 4YM6B 1P3OC 3AZGC 1KX4A 3UTAC 3X1UA 3AZND 4NE6A 5B24C 3MGPC 4JJNA 4YM6C 3WTPA 3WKJA 1H3OB 3REJB 3W99B 5BS7A 5B0YB 5AV8C 3UT9B 3AZLA 5CPIC 3X1VC 4WZSB 3KXBD 3MNNC 5F99C 3W99C 5B32G 1U35D 3LJAA 1TAFB 5CPJD 5GXQC 4J8WC 3MGRC 4CSRA 3KWQC 3UT9C 3C1CA 5CPKD 1KX3D 1P3BD 3W97D 2NQBB 5KDMB 5B33D 2BYKB 5B2IB 3AYWD 3AZHA 2F8ND 3B6FC 4QLCB 3TU4D 1P3LA 4WU8D 5B1LC 4H9NA 2AROC 2NQBC 4Z5TD 5B2IC 3REHB 5FUGA 5BNVB 4H9OB 3WA9A 5B0ZB 5DNMB 5E5AD 5AVCC 1ID3D 4KGCA 1A7WA 3NQJB 3X1TB 4Z2MG 1P3KA 3W96D 3C1BB 1KX5A 3MGPD 3KSYA 3X1TC 4NE3A 1F66B 4XUJC 1HQ3A 4YS3A 4DRAA 3UTBD 3WAAA 3AV1A 1F66C 1F1EA 5AV8D 4CAYB 3AZEA 5B1MA 3X1VD 3AZJB 3MNND 5F99D 2JSSA 5BO0A 3V9RA 2NZDC 4J8WD 4R8PA 1ZLAB 3MGQA 5JA4B 1P3FB 1M19A 3B6FD 1ULYA 1B6WA 1N1JB 5B1LD 4XZQC 1EQZC 4KUDB 2AROD 5AV5A 5DNNC 2PYOB 3NQUA 4Z66B 5GT3B 2HIOB 1P3AC 1AOIA 1P3GC 1M1AA 4KUDC 3X1SA 3X1UD 5AVCD 3B6GA 4ZUXB 5CP6A 2CV5A 3WTPD 4H9QB 2RVQD 5C3IC 4ZUXC 5B32A 5AV6B 3AZLD 2F8NH 4XUJD 3AZEC 1WWIA 1TZYB 3W98B 1BH8A 4WNNA 3RELB 5JRGB 5AV9A 2BYMA 3B0DB 1P3IC 1JFIA 4X23A 2NZDD 2IO5B 1P3LD 3AZNB 4J8VC 5AY8C 1M18A 5B2JA 4H9RA 3KUYA 4XZQD 1EQZD 5DNND 1S32C 3AZIC 3KXBB 3A6NA 1P3GD 5CPJB 4J8UC 1KX5D
chains in the Genus database with same CATH superfamily
5BNXA 5B32C 5CPKB 3EPLA 1KX3B 1P3BB 3W97B 4ZBJB 1HQ3D 4YS3D 3AZMA 1U35C 5B33B 3AYWB 2F8NB 2L5AA 3H0LC 5GSUB 3TU4B 4WU8B 3AN2B 3W97C 1P3BC 4WU9A 4Z5TB 5B33C 3MVDA 3MGSA 5B1MD 3WTPE 3AZED 3TU4C 3LZ1A 5E5AB 4R8PD 5GT0C 1P3PA 3AZKA 1P3ID 1P3MA 5B40C 4KHAA 4J8XB 2JE5A 3REKA 3AZFC 5G49B 2FJ7A 3UTAB 1ID3C 3MGPB 5B31G 2G5HC 3W96C 3UTBB 1M1AD 1R4VA 5AVBC 3O62A 5AV8B 1H3OA 3REJA 3AZID 3X1VB 5CPIB 1S32D 3MNNB 5F99B 3UTBC 2CV5D 5B0YA 4HGAC 4H9SC 5GXQB 4J8WB 3MGRB 4J8UD 3KWQB 4LD9C 5B32D 3REIC 2FFFB 3B6FB 3LELC 2YFWA 5B1LB 5AV9D 2AROB 2BYKA 1W2EA 4QLCA 4NE5A 4X23D 4E45A 3REHA 3X1UB 5AVCB 5GT0D 4M6BA 1M18D 3LZ0A 5B0ZA 5B40D 5DNMA 1KX4C 1PZRA 3WTPB 1KU5A 3VH6T 3VH6W 3AZFD 3X1UC 4JJNC 4G91B 4XUJB 1BFMA 3WTPC 3C1BA 3WKJC 2RVQC 5BS7C 3AV2A 2DF4C 5AVBD 4G91C 3AZLC 3LJAC 1HTAA 2F8NG 2NZDB 4CAYA 3AZJA 3C1CC 4LD9D 3REID 3MVDD 3MGSD 3AZHC 1P3LC 3LELD 4XZQB 1EQZB 5DNNB 1P3FA 1P3PD 3R45B 1P3AB 3WA9C 5B31A 1P3GB 4Z66A 5GT3A 3REKD 2PYOA 2FJ7D 2HIOA 2LY8A 4KGCC 3AFAA 3VH5A 1P3KC 1HQ3B 4YS3B 2YFVA 1KX4D 5BT1D 1KX5C 1BH9B 5C3IB 4JJND 3O62D 1T3UA 1HQ3C 4YS3C 4WV4B 3AZEB 5B1MB 3WKJD 3WAAC 5B0YD 3AV1C 5AV6A 4R8PB 2Y2HA 1P3IB 2Y2OA 5B1MC 1TZYA 4UUZB 3W98A 3RELA 3LJAD 5JRGA 4R8PC 3MGQC 4J8VB 3C1CD 5AY8B 3NQUB 2HUEB 1M19C 1P34A 3AZHD 3AZNA 4Z2MH 1M1AB 5AV5C 3REHD 2F8NK 2HUEC 3B0BA 3LZ0D 1S32B 3AZIB 5DNMD 1AOIC 3WA9D 2CV5B 1M1AC 3X1SC 4J8UB 3B6GC 3KXBA 4KGCD 3F6TA 5B32B 5CPJA 5CP6C 1U35B 2CV5C 1P3KD 3AV2D 5CPKA 1BH8B 4WNNB 1KX3A 5AV9B 1JFIB 3AYWA 2F8NA 5GSUA 4WU8A 4X23B 3AN2A 3WAAD 3AV1D 4Z5TA 5AV9C 3EG5B 5GT0B 4AWLC 1M18B 4X23C 5B40B 5E5AA 3AZFB 3MGQD 4G92B 1ID3B 1M18C 4J8XA 3IP4C 1P3OA 3AZGA 5G49A 5B2JC 3UTAA 1M19D 2BG1A 3W96B 2Y2JA 3KUYC 3MGPA 5B24A 4G92C 5B31D 5AVBB 5AV5D 4YM6A 5BNXB 3AFAD 3A6NC 1AOID 3H0RC 5AV8A 4HGAB 3X1SD 5CPIA 3B6GD 2Y2LA 3X1VA 3MNNA 5F99A 3W99A 4LD9B 3AZMC 4EO5B 3REIB 4DRBA 3MVDB 5CP6D 5GXQA 3MGSB 3MGRA 4J8WA 3KWQA 3UT9A 3LELB 4WU9C 4EO5C 1TAFA 1P3PB 3MVDC 3MGSC 3B6FA 1WWSA 5B1LA 3LZ1C 2AROA 2NQBA 5KDMA 2FJ7B 2Y2QA 4H9PB 5B2IA 3AZKC 1P3MC 1P3PC 2J8PA 2Y2IA 1P34D 1KX4B 5AVCA 3REKC 2FJ7C 5BNVA 4JJNB 4H9OA 3O62B 2ZM5A 5BT1C 3WKJB 5B2JD 1Q9CA 3NQJA 3KUYD 3X1TA 1B67A 3O62C 4XUJA 4NFTA 2ZY5A 3AZLB 3REJC 3A6ND 5B0YC 3LJAB 1F66A 4CSRB 2YFWB 3C1CB 5CHLB 3AZMD 2NZDA 5GSUD 3AZHB 3AN2D 1P3LB 4H9NB 2ZY2A 4WU9D 4QLCC 3LZ0B 5FUGB 1ZLAA 3WA9B 4XZQA 1EQZA 3LZ1D 5DNNA 5JA4A 3REHC 3R45A 3AZKD 1P3AA 1P3MD 3LZ0C 4J8XD 5B0ZC 4KGCB 5DNMC 1N1JA 1P3GA 2Y2GA 3AZGD 1P3KB 1P3OD 4KUDA 3UTAD 2Y2KA 5B24D 3AV2B 1KX5B 4YM6D 3C1BC 1BH9A 3AV2C 4ZUXA 3WAAB 3AV1B 5CPID 4H9QA 3W99D 3REJD 5GXQD 5BO0B 3MGRD 3V9RB 3KWQD 3UT9D 1P3IA 3MGQB 3AZJC 4UUZA 1ZLAC 1M19B 3KFUG 4J8VA 5AY8A 2NQBD 5B31B 5AV5B 1P3FC 5B2ID 4QLCD 3AFAB 2YFVB 1AOIB 5B31C 2PYOC 4Z66C 5GT3C 3P5JB 3X1SB 2HIOC 3AZIA 1S32A 3B6GB 3AFAC 5B0ZD 3EPJA 2VQRA 5CP6B 4J8UA 3X1TD 3VH5T 3VH5W 2ZY3A 1U35A 3C1BD 1F66D 3W97A 5AV6C 1P3BA 3FDDA 5B33A 2BYMB 1TZYC 3TU4A 4AWLB 3W98C 3RELC 5JRGC 3B0DC 1P34B 5GT0A 5B40A 3AZJD 2IO5C 1P34C 3AZFA 1ZLAD 5B2JB 3AZNC 4H9RB 1ID3A 3KUYB 2UWXA 1P3FD 3W96A 1P3AD 3A6NB 4KUDD 5AVBA 2PYOD 4Z66D 5GT3D 2DQNC 3KXBC 2HIOD 3UTBA 5CPJC 3AZMB 4H9SA 5CPKC 4ZUXD 1KX3C 4LD9A 4ZBJC 3B0CT 3B0CW 3REIA 3AYWC 4WU9B 5GSUC 2Y2NA 4WU8C 3AN2C 3LELA 4E44A 3LZ1B 5AV6D 4Z5TC 3AZKB 1P3MB 4WJ3C 1TZYD 3W98D 4KHAB 3RELD 2CWEA 5E5AC 3AZGB 1P3OB 5JRGD 4H9PA 3VH6A 3REKB 4J8VD 3EPHA 5B24B 5AY8D 4J8XC 4YM6B 1P3OC 3AZGC 1KX4A 2XD1A 3UTAC 3X1UA 3AZND 4NE6A 5B24C 3MGPC 4JJNA 4YM6C 3WTPA 3WKJA 1H3OB 3REJB 3W99B 5BS7A 5B0YB 5AV8C 3UT9B 3AZLA 5CPIC 1Z2CB 3X1VC 4WZSB 3KXBD 3MNNC 5F99C 3W99C 5B32G 1U35D 3LJAA 1TAFB 5CPJD 5GXQC 4J8WC 3MGRC 4CSRA 3KWQC 3UT9C 3C1CA 5CPKD 1KX3D 1P3BD 3W97D 2NQBB 5KDMB 5B33D 2BYKB 5B2IB 3AYWD 3AZHA 3A1KA 2F8ND 4QLCB 3TU4D 3B6FC 1P3LA 4WU8D 5B1LC 4H9NA 2AROC 2NQBC 2JCHA 4Z5TD 3H0MC 5B2IC 3REHB 5FUGA 5BNVB 4H9OB 3WA9A 5B0ZB 5DNMB 5E5AD 5AVCC 1ID3D 4KGCA 1A7WA 3NQJB 3X1TB 4Z2MG 1P3KA 3W96D 2Y2MA 3C1BB 1KX5A 3MGPD 3KSYA 3X1TC 4NE3A 1F66B 4XUJC 1HQ3A 4YS3A 4DRAA 3AL0C 3UTBD 3WAAA 3AV1A 1F66C 1F1EA 5AV8D 4CAYB 3AZEA 5B1MA 3X1VD 3AZJB 3MNND 5F99D 2JSSA 5BO0A 2G5IC 3V9RA 2NZDC 4J8WD 4R8PA 1ZLAB 3MGQA 5JA4B 1P3FB 1M19A 3B6FD 1ULYA 1B6WA 1N1JB 5B1LD 4XZQC 1EQZC 4KUDB 2AROD 5AV5A 5DNNC 2PYOB 3NQUA 4Z66B 5GT3B 2HIOB 1P3AC 1AOIA 1P3GC 2RIQA 2F2AC 1M1AA 4KUDC 3X1SA 3X1UD 5AVCD 3B6GA 4ZUXB 5CP6A 2CV5A 3WTPD 2Y2PA 4H9QB 2RVQD 5C3IC 4ZUXC 5B32A 5AV6B 3AZLD 4UPKA 2F8NH 2ZY4A 4XUJD 3AZEC 1WWIA 1TZYB 3W98B 1BH8A 4WNNA 3RELB 5JRGB 5AV9A 3EPKA 2BYMA 3B0DB 2W8SA 1P3IC 1JFIA 4X23A 2NZDD 2IO5B 1P3LD 3AZNB 4J8VC 4DQYB 5AY8C 3A1IA 1M18A 5B2JA 4H9RA 3KUYA 4XZQD 1EQZD 5DNND 1S32C 3AZIC 3KXBB 3A6NA 1P3GD 5CPJB 4J8UC 2XD5A 1KX5D
chains in the Genus database with same CATH topology
5BNXA 5B32C 5CPKB 3EPLA 1KX3B 1P3BB 3W97B 4ZBJB 1HQ3D 4YS3D 3AZMA 1U35C 5B33B 3AYWB 2F8NB 2L5AA 3H0LC 5GSUB 3TU4B 4WU8B 3AN2B 3W97C 1P3BC 4WU9A 4Z5TB 5B33C 3MVDA 3MGSA 5B1MD 3WTPE 3AZED 3TU4C 3LZ1A 5E5AB 4R8PD 5GT0C 1P3PA 3AZKA 1P3ID 1P3MA 5B40C 4KHAA 4J8XB 2JE5A 3REKA 3AZFC 5G49B 2FJ7A 3UTAB 1ID3C 3MGPB 5B31G 2G5HC 3W96C 3UTBB 1M1AD 1R4VA 5AVBC 3O62A 5AV8B 1H3OA 3REJA 3AZID 3X1VB 5CPIB 1S32D 3MNNB 5F99B 3UTBC 2CV5D 5B0YA 4HGAC 4H9SC 5GXQB 4J8WB 3MGRB 4J8UD 3KWQB 4LD9C 5B32D 3REIC 2FFFB 3B6FB 3LELC 2YFWA 5B1LB 5AV9D 2AROB 2BYKA 1W2EA 4QLCA 4NE5A 4X23D 4E45A 3REHA 3X1UB 5AVCB 5GT0D 4M6BA 1M18D 3LZ0A 5B0ZA 5B40D 5DNMA 1KX4C 1PZRA 3WTPB 1KU5A 3VH6T 3VH6W 3AZFD 3X1UC 4JJNC 4G91B 4XUJB 1BFMA 3WTPC 3C1BA 3WKJC 2RVQC 5BS7C 3AV2A 2DF4C 5AVBD 4G91C 3AZLC 3LJAC 1HTAA 2F8NG 2NZDB 4CAYA 3AZJA 3C1CC 4LD9D 3REID 3MVDD 3MGSD 3AZHC 1P3LC 3LELD 4XZQB 1EQZB 5DNNB 1P3FA 1P3PD 3R45B 1P3AB 3WA9C 5B31A 1P3GB 4Z66A 5GT3A 3REKD 2PYOA 2FJ7D 2HIOA 2LY8A 4KGCC 3AFAA 3VH5A 1P3KC 1HQ3B 4YS3B 2YFVA 1KX4D 5BT1D 1KX5C 1BH9B 5C3IB 4JJND 3O62D 1T3UA 1HQ3C 4YS3C 4WV4B 3AZEB 5B1MB 3WKJD 3WAAC 5B0YD 3AV1C 5AV6A 4R8PB 2Y2HA 1P3IB 2Y2OA 5B1MC 1TZYA 4UUZB 3W98A 3RELA 3LJAD 5JRGA 4R8PC 3MGQC 4J8VB 3C1CD 5AY8B 3NQUB 2HUEB 1M19C 1P34A 3AZHD 3AZNA 4Z2MH 1M1AB 5AV5C 3REHD 2F8NK 2HUEC 3B0BA 3LZ0D 1S32B 3AZIB 5DNMD 1AOIC 3WA9D 2CV5B 1M1AC 3X1SC 4J8UB 3B6GC 3KXBA 4KGCD 3F6TA 5B32B 5CPJA 5CP6C 1U35B 2CV5C 1P3KD 3AV2D 5CPKA 1BH8B 4WNNB 1KX3A 5AV9B 1JFIB 3AYWA 2F8NA 5GSUA 4WU8A 4X23B 3AN2A 3WAAD 3AV1D 4Z5TA 5AV9C 3EG5B 5GT0B 4AWLC 1M18B 4X23C 5B40B 5E5AA 3AZFB 3MGQD 4G92B 1ID3B 1M18C 4J8XA 3IP4C 1P3OA 3AZGA 5G49A 5B2JC 3UTAA 1M19D 2BG1A 3W96B 2Y2JA 3KUYC 3MGPA 5B24A 4G92C 5B31D 5AVBB 5AV5D 4YM6A 5BNXB 3AFAD 3A6NC 1AOID 3H0RC 5AV8A 4HGAB 3X1SD 5CPIA 3B6GD 2Y2LA 3X1VA 3MNNA 5F99A 3W99A 4LD9B 3AZMC 4EO5B 3REIB 4DRBA 3MVDB 5CP6D 5GXQA 3MGSB 3MGRA 4J8WA 3KWQA 3UT9A 3LELB 4WU9C 4EO5C 1TAFA 1P3PB 3MVDC 3MGSC 3B6FA 1WWSA 5B1LA 3LZ1C 2AROA 2NQBA 5KDMA 2FJ7B 2Y2QA 4H9PB 5B2IA 3AZKC 1P3MC 1P3PC 2J8PA 2Y2IA 1P34D 1KX4B 5AVCA 3REKC 2FJ7C 5BNVA 4JJNB 4H9OA 3O62B 2ZM5A 5BT1C 3WKJB 5B2JD 1Q9CA 3NQJA 3KUYD 3X1TA 1B67A 3O62C 4XUJA 4NFTA 2ZY5A 3AZLB 3REJC 3A6ND 5B0YC 3LJAB 1F66A 4CSRB 2YFWB 3C1CB 5CHLB 3AZMD 2NZDA 5GSUD 3AZHB 3AN2D 1P3LB 4H9NB 2ZY2A 4WU9D 4QLCC 3LZ0B 5FUGB 1ZLAA 3WA9B 4XZQA 1EQZA 3LZ1D 5DNNA 5JA4A 3REHC 3R45A 3AZKD 1P3AA 1P3MD 3LZ0C 4J8XD 5B0ZC 4KGCB 5DNMC 1N1JA 1P3GA 2Y2GA 3AZGD 1P3KB 1P3OD 4KUDA 3UTAD 2Y2KA 5B24D 3AV2B 1KX5B 4YM6D 3C1BC 1BH9A 3AV2C 4ZUXA 3WAAB 3AV1B 5CPID 4H9QA 3W99D 3REJD 5GXQD 5BO0B 3MGRD 3V9RB 3KWQD 3UT9D 1P3IA 3MGQB 3AZJC 4UUZA 1ZLAC 1M19B 3KFUG 4J8VA 5AY8A 2NQBD 5B31B 5AV5B 1P3FC 5B2ID 4QLCD 3AFAB 2YFVB 1AOIB 5B31C 2PYOC 4Z66C 5GT3C 3P5JB 3X1SB 2HIOC 3AZIA 1S32A 3B6GB 3AFAC 5B0ZD 3EPJA 2VQRA 5CP6B 4J8UA 3X1TD 3VH5T 3VH5W 2ZY3A 1U35A 3C1BD 1F66D 3W97A 5AV6C 1P3BA 3FDDA 5B33A 2BYMB 1TZYC 3TU4A 4AWLB 3W98C 3RELC 5JRGC 3B0DC 1P34B 5GT0A 5B40A 3AZJD 2IO5C 1P34C 3AZFA 1ZLAD 5B2JB 3AZNC 4H9RB 1ID3A 3KUYB 2UWXA 1P3FD 3W96A 1P3AD 3A6NB 4KUDD 5AVBA 2PYOD 4Z66D 5GT3D 2DQNC 3KXBC 2HIOD 3UTBA 5CPJC 3AZMB 4H9SA 5CPKC 4ZUXD 1KX3C 4LD9A 4ZBJC 3B0CT 3B0CW 3REIA 3AYWC 4WU9B 5GSUC 2Y2NA 4WU8C 3AN2C 3LELA 4E44A 3LZ1B 5AV6D 4Z5TC 3AZKB 1P3MB 4WJ3C 1TZYD 3W98D 4KHAB 3RELD 2CWEA 5E5AC 3AZGB 1P3OB 5JRGD 4H9PA 3VH6A 3REKB 4J8VD 3EPHA 5B24B 5AY8D 4J8XC 4YM6B 1P3OC 3AZGC 1KX4A 2XD1A 3UTAC 3X1UA 3AZND 4NE6A 5B24C 3MGPC 4JJNA 4YM6C 3WTPA 3WKJA 1H3OB 3REJB 3W99B 5BS7A 5B0YB 5AV8C 3UT9B 3AZLA 5CPIC 1Z2CB 3X1VC 4WZSB 3KXBD 3MNNC 5F99C 3W99C 5B32G 1U35D 3LJAA 1TAFB 5CPJD 5GXQC 4J8WC 3MGRC 4CSRA 3KWQC 3UT9C 3C1CA 5CPKD 1KX3D 1P3BD 3W97D 2NQBB 5KDMB 5B33D 2BYKB 5B2IB 3AYWD 3AZHA 3A1KA 2F8ND 4QLCB 3TU4D 3B6FC 1P3LA 4WU8D 5B1LC 4H9NA 2AROC 2NQBC 2JCHA 4Z5TD 3H0MC 5B2IC 3REHB 5FUGA 5BNVB 4H9OB 3WA9A 5B0ZB 5DNMB 5E5AD 5AVCC 1ID3D 4KGCA 1A7WA 3NQJB 3X1TB 4Z2MG 1P3KA 3W96D 2Y2MA 3C1BB 1KX5A 3MGPD 3KSYA 3X1TC 4NE3A 1F66B 4XUJC 1HQ3A 4YS3A 4DRAA 3AL0C 3UTBD 3WAAA 3AV1A 1F66C 1F1EA 5AV8D 4CAYB 3AZEA 5B1MA 3X1VD 3AZJB 3MNND 5F99D 2JSSA 5BO0A 2G5IC 3V9RA 2NZDC 4J8WD 4R8PA 1ZLAB 3MGQA 5JA4B 1P3FB 1M19A 3B6FD 1ULYA 1B6WA 1N1JB 5B1LD 4XZQC 1EQZC 4KUDB 2AROD 5AV5A 5DNNC 2PYOB 3NQUA 4Z66B 5GT3B 2HIOB 1P3AC 1AOIA 1P3GC 2RIQA 2F2AC 1M1AA 4KUDC 3X1SA 3X1UD 5AVCD 3B6GA 4ZUXB 5CP6A 2CV5A 3WTPD 2Y2PA 4H9QB 2RVQD 5C3IC 4ZUXC 5B32A 5AV6B 3AZLD 4UPKA 2F8NH 2ZY4A 4XUJD 3AZEC 1WWIA 1TZYB 3W98B 1BH8A 4WNNA 3RELB 5JRGB 5AV9A 3EPKA 2BYMA 3B0DB 2W8SA 1P3IC 1JFIA 4X23A 2NZDD 2IO5B 1P3LD 3AZNB 4J8VC 4DQYB 5AY8C 3A1IA 1M18A 5B2JA 4H9RA 3KUYA 4XZQD 1EQZD 5DNND 1S32C 3AZIC 3KXBB 3A6NA 1P3GD 5CPJB 4J8UC 2XD5A 1KX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX A;  5B32 C;  5CPK B;  3W97 B;  1KX3 B;  1P3B B;  4ZBJ B;  1HQ3 D;  4YS3 D;  3AZM A;  1U35 C;  5B33 B;  3AYW B;  2F8N B;  2L5A A;  5GSU B;  3TU4 B;  4WU8 B;  3AN2 B;  3W97 C;  1P3B C;  4WU9 A;  4Z5T B;  5B33 C;  3MVD A;  3MGS A;  5B1M D;  3WTP E;  3AZE D;  3TU4 C;  3LZ1 A;  5E5A B;  4R8P D;  5GT0 C;  1P3P A;  3AZK A;  1P3I D;  1P3M A;  5B40 C;  4KHA A;  4J8X B;  3REK A;  3AZF C;  5G49 B;  2FJ7 A;  3UTA B;  1ID3 C;  3MGP B;  5B31 G;  3W96 C;  3UTB B;  1M1A D;  1R4V A;  5AVB C;  3O62 A;  5AV8 B;  1H3O A;  3REJ A;  3AZI D;  3X1V B;  5CPI B;  1S32 D;  3MNN B;  5F99 B;  3UTB C;  2CV5 D;  5B0Y A;  4HGA C;  4H9S C;  5GXQ B;  4J8W B;  3MGR B;  4J8U D;  3KWQ B;  4LD9 C;  5B32 D;  3REI C;  3B6F B;  3LEL C;  2YFW A;  5B1L B;  5AV9 D;  2ARO B;  2BYK A;  4QLC A;  4NE5 A;  4X23 D;  4E45 A;  3REH A;  3X1U B;  5AVC B;  5GT0 D;  4M6B A;  1M18 D;  3LZ0 A;  5B0Z A;  5B40 D;  5DNM A;  1KX4 C;  3WTP B;  1KU5 A;  3VH6 T;  3VH6 W;  3AZF D;  3X1U C;  4JJN C;  4G91 B;  4XUJ B;  1BFM A;  3WTP C;  3C1B A;  3WKJ C;  2RVQ C;  5BS7 C;  3AV2 A;  5AVB D;  4G91 C;  3AZL C;  3LJA C;  1HTA A;  2F8N G;  2NZD B;  4CAY A;  3AZJ A;  3C1C C;  4LD9 D;  3REI D;  3MVD D;  3MGS D;  3AZH C;  1P3L C;  3LEL D;  4XZQ B;  1EQZ B;  5DNN B;  1P3F A;  1P3P D;  3R45 B;  1P3A B;  3WA9 C;  5B31 A;  1P3G B;  4Z66 A;  5GT3 A;  3REK D;  2PYO A;  2FJ7 D;  2HIO A;  2LY8 A;  4KGC C;  3AFA A;  3VH5 A;  1P3K C;  1HQ3 B;  4YS3 B;  2YFV A;  1KX4 D;  5BT1 D;  1KX5 C;  1BH9 B;  5C3I B;  4JJN D;  3O62 D;  1HQ3 C;  4YS3 C;  4WV4 B;  3AZE B;  5B1M B;  3WKJ D;  3WAA C;  5B0Y D;  3AV1 C;  5AV6 A;  4R8P B;  1P3I B;  5B1M C;  1TZY A;  4UUZ B;  3W98 A;  3REL A;  3LJA D;  5JRG A;  4R8P C;  3MGQ C;  4J8V B;  3C1C D;  5AY8 B;  3NQU B;  2HUE B;  1M19 C;  1P34 A;  3AZH D;  3AZN A;  4Z2M H;  1M1A B;  5AV5 C;  3REH D;  2F8N K;  2HUE C;  3B0B A;  3LZ0 D;  1S32 B;  3AZI B;  5DNM D;  1AOI C;  3WA9 D;  2CV5 B;  1M1A C;  3X1S C;  4J8U B;  3B6G C;  3KXB A;  4KGC D;  5B32 B;  5CPJ A;  5CP6 C;  1U35 B;  2CV5 C;  1P3K D;  3AV2 D;  5CPK A;  1BH8 B;  4WNN B;  1KX3 A;  5AV9 B;  1JFI B;  3AYW A;  2F8N A;  5GSU A;  4WU8 A;  4X23 B;  3AN2 A;  3WAA D;  3AV1 D;  4Z5T A;  5AV9 C;  5GT0 B;  4AWL C;  1M18 B;  4X23 C;  5B40 B;  5E5A A;  3AZF B;  3MGQ D;  4G92 B;  1ID3 B;  1M18 C;  4J8X A;  1P3O A;  3AZG A;  5G49 A;  5B2J C;  3UTA A;  1M19 D;  3W96 B;  3KUY C;  3MGP A;  5B24 A;  4G92 C;  5B31 D;  5AVB B;  5AV5 D;  4YM6 A;  5BNX B;  3AFA D;  3A6N C;  1AOI D;  5AV8 A;  4HGA B;  3X1S D;  5CPI A;  3B6G D;  3X1V A;  3MNN A;  5F99 A;  3W99 A;  4LD9 B;  3AZM C;  4EO5 B;  3REI B;  4DRB A;  3MVD B;  5CP6 D;  5GXQ A;  3MGS B;  3MGR A;  4J8W A;  3KWQ A;  3UT9 A;  3LEL B;  4WU9 C;  4EO5 C;  1TAF A;  1P3P B;  3MVD C;  3MGS C;  3B6F A;  1WWS A;  5B1L A;  3LZ1 C;  2ARO A;  2NQB A;  5KDM A;  2FJ7 B;  4H9P B;  5B2I A;  3AZK C;  1P3M C;  1P3P C;  1P34 D;  1KX4 B;  5AVC A;  3REK C;  2FJ7 C;  5BNV A;  4JJN B;  4H9O A;  3O62 B;  5BT1 C;  3WKJ B;  5B2J D;  1Q9C A;  3NQJ A;  3KUY D;  3X1T A;  1B67 A;  3O62 C;  4XUJ A;  4NFT A;  3AZL B;  3REJ C;  3A6N D;  5B0Y C;  3LJA B;  1F66 A;  4CSR B;  2YFW B;  3C1C B;  5CHL B;  3AZM D;  2NZD A;  5GSU D;  3AZH B;  3AN2 D;  1P3L B;  4H9N B;  4WU9 D;  4QLC C;  3LZ0 B;  5FUG B;  1ZLA A;  3WA9 B;  4XZQ A;  1EQZ A;  3LZ1 D;  5DNN A;  5JA4 A;  3REH C;  3R45 A;  3AZK D;  1P3A A;  1P3M D;  3LZ0 C;  4J8X D;  5B0Z C;  4KGC B;  5DNM C;  1N1J A;  1P3G A;  3AZG D;  1P3K B;  1P3O D;  4KUD A;  3UTA D;  5B24 D;  3AV2 B;  1KX5 B;  4YM6 D;  3C1B C;  1BH9 A;  3AV2 C;  4ZUX A;  3WAA B;  3AV1 B;  5CPI D;  4H9Q A;  3W99 D;  3REJ D;  5GXQ D;  5BO0 B;  3MGR D;  3V9R B;  3KWQ D;  3UT9 D;  1P3I A;  3MGQ B;  3AZJ C;  4UUZ A;  1ZLA C;  1M19 B;  4J8V A;  5AY8 A;  2NQB D;  5B31 B;  5AV5 B;  1P3F C;  5B2I D;  4QLC D;  3AFA B;  2YFV B;  1AOI B;  5B31 C;  2PYO C;  4Z66 C;  5GT3 C;  3X1S B;  2HIO C;  3AZI A;  1S32 A;  3B6G B;  3AFA C;  5B0Z D;  5CP6 B;  4J8U A;  3X1T D;  3VH5 T;  3VH5 W;  1U35 A;  3C1B D;  1F66 D;  3W97 A;  5AV6 C;  1P3B A;  5B33 A;  2BYM B;  1TZY C;  3TU4 A;  4AWL B;  3W98 C;  3REL C;  5JRG C;  3B0D C;  1P34 B;  5GT0 A;  5B40 A;  3AZJ D;  2IO5 C;  1P34 C;  3AZF A;  1ZLA D;  5B2J B;  3AZN C;  4H9R B;  1ID3 A;  3KUY B;  1P3F D;  3W96 A;  1P3A D;  3A6N B;  4KUD D;  5AVB A;  2PYO D;  4Z66 D;  5GT3 D;  3KXB C;  2HIO D;  3UTB A;  5CPJ C;  3AZM B;  4H9S A;  5CPK C;  4ZUX D;  1KX3 C;  4LD9 A;  4ZBJ C;  3B0C T;  3B0C W;  3REI A;  3AYW C;  4WU9 B;  5GSU C;  4WU8 C;  3AN2 C;  3LEL A;  4E44 A;  3LZ1 B;  5AV6 D;  4Z5T C;  3AZK B;  1P3M B;  1TZY D;  3W98 D;  4KHA B;  3REL D;  2CWE A;  5E5A C;  3AZG B;  1P3O B;  5JRG D;  4H9P A;  3VH6 A;  3REK B;  4J8V D;  5B24 B;  5AY8 D;  4J8X C;  4YM6 B;  1P3O C;  3AZG C;  1KX4 A;  3UTA C;  3X1U A;  3AZN D;  4NE6 A;  5B24 C;  3MGP C;  4JJN A;  4YM6 C;  3WTP A;  3WKJ A;  1H3O B;  3REJ B;  3W99 B;  5BS7 A;  5B0Y B;  5AV8 C;  3UT9 B;  3AZL A;  5CPI C;  3X1V C;  4WZS B;  3KXB D;  3MNN C;  5F99 C;  3W99 C;  5B32 G;  1U35 D;  3LJA A;  1TAF B;  5CPJ D;  5GXQ C;  4J8W C;  3MGR C;  4CSR A;  3KWQ C;  3UT9 C;  3C1C A;  5CPK D;  1KX3 D;  1P3B D;  3W97 D;  2NQB B;  5KDM B;  5B33 D;  2BYK B;  5B2I B;  3AYW D;  3AZH A;  2F8N D;  3B6F C;  4QLC B;  3TU4 D;  1P3L A;  4WU8 D;  5B1L C;  4H9N A;  2ARO C;  2NQB C;  4Z5T D;  5B2I C;  3REH B;  5FUG A;  5BNV B;  4H9O B;  3WA9 A;  5B0Z B;  5DNM B;  5E5A D;  5AVC C;  1ID3 D;  4KGC A;  1A7W A;  3NQJ B;  3X1T B;  4Z2M G;  1P3K A;  3W96 D;  3C1B B;  1KX5 A;  3MGP D;  3KSY A;  3X1T C;  4NE3 A;  1F66 B;  4XUJ C;  1HQ3 A;  4YS3 A;  4DRA A;  3UTB D;  3WAA A;  3AV1 A;  1F66 C;  1F1E A;  5AV8 D;  4CAY B;  3AZE A;  5B1M A;  3X1V D;  3AZJ B;  3MNN D;  5F99 D;  2JSS A;  5BO0 A;  3V9R A;  2NZD C;  4J8W D;  4R8P A;  1ZLA B;  3MGQ A;  5JA4 B;  1P3F B;  1M19 A;  3B6F D;  1ULY A;  1B6W A;  1N1J B;  5B1L D;  4XZQ C;  1EQZ C;  4KUD B;  2ARO D;  5AV5 A;  5DNN C;  2PYO B;  3NQU A;  4Z66 B;  5GT3 B;  2HIO B;  1P3A C;  1AOI A;  1P3G C;  1M1A A;  4KUD C;  3X1S A;  3X1U D;  5AVC D;  3B6G A;  4ZUX B;  5CP6 A;  2CV5 A;  3WTP D;  4H9Q B;  2RVQ D;  5C3I C;  4ZUX C;  5B32 A;  5AV6 B;  3AZL D;  2F8N H;  4XUJ D;  3AZE C;  1WWI A;  1TZY B;  3W98 B;  1BH8 A;  4WNN A;  3REL B;  5JRG B;  5AV9 A;  2BYM A;  3B0D B;  1P3I C;  1JFI A;  4X23 A;  2NZD D;  2IO5 B;  1P3L D;  3AZN B;  4J8V C;  5AY8 C;  1M18 A;  5B2J A;  4H9R A;  3KUY A;  4XZQ D;  1EQZ D;  5DNN D;  1S32 C;  3AZI C;  3KXB B;  3A6N A;  1P3G D;  5CPJ B;  4J8U C;  1KX5 D; 
#chains in the Genus database with same CATH topology
 5BNX A;  5B32 C;  5CPK B;  3EPL A;  1KX3 B;  1P3B B;  3W97 B;  4ZBJ B;  1HQ3 D;  4YS3 D;  3AZM A;  1U35 C;  5B33 B;  3AYW B;  2F8N B;  2L5A A;  3H0L C;  5GSU B;  3TU4 B;  4WU8 B;  3AN2 B;  3W97 C;  1P3B C;  4WU9 A;  4Z5T B;  5B33 C;  3MVD A;  3MGS A;  5B1M D;  3WTP E;  3AZE D;  3TU4 C;  3LZ1 A;  5E5A B;  4R8P D;  5GT0 C;  1P3P A;  3AZK A;  1P3I D;  1P3M A;  5B40 C;  4KHA A;  4J8X B;  2JE5 A;  3REK A;  3AZF C;  5G49 B;  2FJ7 A;  3UTA B;  1ID3 C;  3MGP B;  5B31 G;  2G5H C;  3W96 C;  3UTB B;  1M1A D;  1R4V A;  5AVB C;  3O62 A;  5AV8 B;  1H3O A;  3REJ A;  3AZI D;  3X1V B;  5CPI B;  1S32 D;  3MNN B;  5F99 B;  3UTB C;  2CV5 D;  5B0Y A;  4HGA C;  4H9S C;  5GXQ B;  4J8W B;  3MGR B;  4J8U D;  3KWQ B;  4LD9 C;  5B32 D;  3REI C;  2FFF B;  3B6F B;  3LEL C;  2YFW A;  5B1L B;  5AV9 D;  2ARO B;  2BYK A;  1W2E A;  4QLC A;  4NE5 A;  4X23 D;  4E45 A;  3REH A;  3X1U B;  5AVC B;  5GT0 D;  4M6B A;  1M18 D;  3LZ0 A;  5B0Z A;  5B40 D;  5DNM A;  1KX4 C;  1PZR A;  3WTP B;  1KU5 A;  3VH6 T;  3VH6 W;  3AZF D;  3X1U C;  4JJN C;  4G91 B;  4XUJ B;  1BFM A;  3WTP C;  3C1B A;  3WKJ C;  2RVQ C;  5BS7 C;  3AV2 A;  2DF4 C;  5AVB D;  4G91 C;  3AZL C;  3LJA C;  1HTA A;  2F8N G;  2NZD B;  4CAY A;  3AZJ A;  3C1C C;  4LD9 D;  3REI D;  3MVD D;  3MGS D;  3AZH C;  1P3L C;  3LEL D;  4XZQ B;  1EQZ B;  5DNN B;  1P3F A;  1P3P D;  3R45 B;  1P3A B;  3WA9 C;  5B31 A;  1P3G B;  4Z66 A;  5GT3 A;  3REK D;  2PYO A;  2FJ7 D;  2HIO A;  2LY8 A;  4KGC C;  3AFA A;  3VH5 A;  1P3K C;  1HQ3 B;  4YS3 B;  2YFV A;  1KX4 D;  5BT1 D;  1KX5 C;  1BH9 B;  5C3I B;  4JJN D;  3O62 D;  1T3U A;  1HQ3 C;  4YS3 C;  4WV4 B;  3AZE B;  5B1M B;  3WKJ D;  3WAA C;  5B0Y D;  3AV1 C;  5AV6 A;  4R8P B;  2Y2H A;  1P3I B;  2Y2O A;  5B1M C;  1TZY A;  4UUZ B;  3W98 A;  3REL A;  3LJA D;  5JRG A;  4R8P C;  3MGQ C;  4J8V B;  3C1C D;  5AY8 B;  3NQU B;  2HUE B;  1M19 C;  1P34 A;  3AZH D;  3AZN A;  4Z2M H;  1M1A B;  5AV5 C;  3REH D;  2F8N K;  2HUE C;  3B0B A;  3LZ0 D;  1S32 B;  3AZI B;  5DNM D;  1AOI C;  3WA9 D;  2CV5 B;  1M1A C;  3X1S C;  4J8U B;  3B6G C;  3KXB A;  4KGC D;  3F6T A;  5B32 B;  5CPJ A;  5CP6 C;  1U35 B;  2CV5 C;  1P3K D;  3AV2 D;  5CPK A;  1BH8 B;  4WNN B;  1KX3 A;  5AV9 B;  1JFI B;  3AYW A;  2F8N A;  5GSU A;  4WU8 A;  4X23 B;  3AN2 A;  3WAA D;  3AV1 D;  4Z5T A;  5AV9 C;  3EG5 B;  5GT0 B;  4AWL C;  1M18 B;  4X23 C;  5B40 B;  5E5A A;  3AZF B;  3MGQ D;  4G92 B;  1ID3 B;  1M18 C;  4J8X A;  3IP4 C;  1P3O A;  3AZG A;  5G49 A;  5B2J C;  3UTA A;  1M19 D;  2BG1 A;  3W96 B;  2Y2J A;  3KUY C;  3MGP A;  5B24 A;  4G92 C;  5B31 D;  5AVB B;  5AV5 D;  4YM6 A;  5BNX B;  3AFA D;  3A6N C;  1AOI D;  3H0R C;  5AV8 A;  4HGA B;  3X1S D;  5CPI A;  3B6G D;  2Y2L A;  3X1V A;  3MNN A;  5F99 A;  3W99 A;  4LD9 B;  3AZM C;  4EO5 B;  3REI B;  4DRB A;  3MVD B;  5CP6 D;  5GXQ A;  3MGS B;  3MGR A;  4J8W A;  3KWQ A;  3UT9 A;  3LEL B;  4WU9 C;  4EO5 C;  1TAF A;  1P3P B;  3MVD C;  3MGS C;  3B6F A;  1WWS A;  5B1L A;  3LZ1 C;  2ARO A;  2NQB A;  5KDM A;  2FJ7 B;  2Y2Q A;  4H9P B;  5B2I A;  3AZK C;  1P3M C;  1P3P C;  2J8P A;  2Y2I A;  1P34 D;  1KX4 B;  5AVC A;  3REK C;  2FJ7 C;  5BNV A;  4JJN B;  4H9O A;  3O62 B;  2ZM5 A;  5BT1 C;  3WKJ B;  5B2J D;  1Q9C A;  3NQJ A;  3KUY D;  3X1T A;  1B67 A;  3O62 C;  4XUJ A;  4NFT A;  2ZY5 A;  3AZL B;  3REJ C;  3A6N D;  5B0Y C;  3LJA B;  1F66 A;  4CSR B;  2YFW B;  3C1C B;  5CHL B;  3AZM D;  2NZD A;  5GSU D;  3AZH B;  3AN2 D;  1P3L B;  4H9N B;  2ZY2 A;  4WU9 D;  4QLC C;  3LZ0 B;  5FUG B;  1ZLA A;  3WA9 B;  4XZQ A;  1EQZ A;  3LZ1 D;  5DNN A;  5JA4 A;  3REH C;  3R45 A;  3AZK D;  1P3A A;  1P3M D;  3LZ0 C;  4J8X D;  5B0Z C;  4KGC B;  5DNM C;  1N1J A;  1P3G A;  2Y2G A;  3AZG D;  1P3K B;  1P3O D;  4KUD A;  3UTA D;  2Y2K A;  5B24 D;  3AV2 B;  1KX5 B;  4YM6 D;  3C1B C;  1BH9 A;  3AV2 C;  4ZUX A;  3WAA B;  3AV1 B;  5CPI D;  4H9Q A;  3W99 D;  3REJ D;  5GXQ D;  5BO0 B;  3MGR D;  3V9R B;  3KWQ D;  3UT9 D;  1P3I A;  3MGQ B;  3AZJ C;  4UUZ A;  1ZLA C;  1M19 B;  3KFU G;  4J8V A;  5AY8 A;  2NQB D;  5B31 B;  5AV5 B;  1P3F C;  5B2I D;  4QLC D;  3AFA B;  2YFV B;  1AOI B;  5B31 C;  2PYO C;  4Z66 C;  5GT3 C;  3P5J B;  3X1S B;  2HIO C;  3AZI A;  1S32 A;  3B6G B;  3AFA C;  5B0Z D;  3EPJ A;  2VQR A;  5CP6 B;  4J8U A;  3X1T D;  3VH5 T;  3VH5 W;  2ZY3 A;  1U35 A;  3C1B D;  1F66 D;  3W97 A;  5AV6 C;  1P3B A;  3FDD A;  5B33 A;  2BYM B;  1TZY C;  3TU4 A;  4AWL B;  3W98 C;  3REL C;  5JRG C;  3B0D C;  1P34 B;  5GT0 A;  5B40 A;  3AZJ D;  2IO5 C;  1P34 C;  3AZF A;  1ZLA D;  5B2J B;  3AZN C;  4H9R B;  1ID3 A;  3KUY B;  2UWX A;  1P3F D;  3W96 A;  1P3A D;  3A6N B;  4KUD D;  5AVB A;  2PYO D;  4Z66 D;  5GT3 D;  2DQN C;  3KXB C;  2HIO D;  3UTB A;  5CPJ C;  3AZM B;  4H9S A;  5CPK C;  4ZUX D;  1KX3 C;  4LD9 A;  4ZBJ C;  3B0C T;  3B0C W;  3REI A;  3AYW C;  4WU9 B;  5GSU C;  2Y2N A;  4WU8 C;  3AN2 C;  3LEL A;  4E44 A;  3LZ1 B;  5AV6 D;  4Z5T C;  3AZK B;  1P3M B;  4WJ3 C;  1TZY D;  3W98 D;  4KHA B;  3REL D;  2CWE A;  5E5A C;  3AZG B;  1P3O B;  5JRG D;  4H9P A;  3VH6 A;  3REK B;  4J8V D;  3EPH A;  5B24 B;  5AY8 D;  4J8X C;  4YM6 B;  1P3O C;  3AZG C;  1KX4 A;  2XD1 A;  3UTA C;  3X1U A;  3AZN D;  4NE6 A;  5B24 C;  3MGP C;  4JJN A;  4YM6 C;  3WTP A;  3WKJ A;  1H3O B;  3REJ B;  3W99 B;  5BS7 A;  5B0Y B;  5AV8 C;  3UT9 B;  3AZL A;  5CPI C;  1Z2C B;  3X1V C;  4WZS B;  3KXB D;  3MNN C;  5F99 C;  3W99 C;  5B32 G;  1U35 D;  3LJA A;  1TAF B;  5CPJ D;  5GXQ C;  4J8W C;  3MGR C;  4CSR A;  3KWQ C;  3UT9 C;  3C1C A;  5CPK D;  1KX3 D;  1P3B D;  3W97 D;  2NQB B;  5KDM B;  5B33 D;  2BYK B;  5B2I B;  3AYW D;  3AZH A;  3A1K A;  2F8N D;  4QLC B;  3TU4 D;  3B6F C;  1P3L A;  4WU8 D;  5B1L C;  4H9N A;  2ARO C;  2NQB C;  2JCH A;  4Z5T D;  3H0M C;  5B2I C;  3REH B;  5FUG A;  5BNV B;  4H9O B;  3WA9 A;  5B0Z B;  5DNM B;  5E5A D;  5AVC C;  1ID3 D;  4KGC A;  1A7W A;  3NQJ B;  3X1T B;  4Z2M G;  1P3K A;  3W96 D;  2Y2M A;  3C1B B;  1KX5 A;  3MGP D;  3KSY A;  3X1T C;  4NE3 A;  1F66 B;  4XUJ C;  1HQ3 A;  4YS3 A;  4DRA A;  3AL0 C;  3UTB D;  3WAA A;  3AV1 A;  1F66 C;  1F1E A;  5AV8 D;  4CAY B;  3AZE A;  5B1M A;  3X1V D;  3AZJ B;  3MNN D;  5F99 D;  2JSS A;  5BO0 A;  2G5I C;  3V9R A;  2NZD C;  4J8W D;  4R8P A;  1ZLA B;  3MGQ A;  5JA4 B;  1P3F B;  1M19 A;  3B6F D;  1ULY A;  1B6W A;  1N1J B;  5B1L D;  4XZQ C;  1EQZ C;  4KUD B;  2ARO D;  5AV5 A;  5DNN C;  2PYO B;  3NQU A;  4Z66 B;  5GT3 B;  2HIO B;  1P3A C;  1AOI A;  1P3G C;  2RIQ A;  2F2A C;  1M1A A;  4KUD C;  3X1S A;  3X1U D;  5AVC D;  3B6G A;  4ZUX B;  5CP6 A;  2CV5 A;  3WTP D;  2Y2P A;  4H9Q B;  2RVQ D;  5C3I C;  4ZUX C;  5B32 A;  5AV6 B;  3AZL D;  4UPK A;  2F8N H;  2ZY4 A;  4XUJ D;  3AZE C;  1WWI A;  1TZY B;  3W98 B;  1BH8 A;  4WNN A;  3REL B;  5JRG B;  5AV9 A;  3EPK A;  2BYM A;  3B0D B;  2W8S A;  1P3I C;  1JFI A;  4X23 A;  2NZD D;  2IO5 B;  1P3L D;  3AZN B;  4J8V C;  4DQY B;  5AY8 C;  3A1I A;  1M18 A;  5B2J A;  4H9R A;  3KUY A;  4XZQ D;  1EQZ D;  5DNN D;  1S32 C;  3AZI C;  3KXB B;  3A6N A;  1P3G D;  5CPJ B;  4J8U C;  2XD5 A;  1KX5 D; 
#chains in the Genus database with same CATH homology
 5BNX A;  5B32 C;  5CPK B;  3EPL A;  1KX3 B;  1P3B B;  3W97 B;  4ZBJ B;  1HQ3 D;  4YS3 D;  3AZM A;  1U35 C;  5B33 B;  3AYW B;  2F8N B;  2L5A A;  3H0L C;  5GSU B;  3TU4 B;  4WU8 B;  3AN2 B;  3W97 C;  1P3B C;  4WU9 A;  4Z5T B;  5B33 C;  3MVD A;  3MGS A;  5B1M D;  3WTP E;  3AZE D;  3TU4 C;  3LZ1 A;  5E5A B;  4R8P D;  5GT0 C;  1P3P A;  3AZK A;  1P3I D;  1P3M A;  5B40 C;  4KHA A;  4J8X B;  2JE5 A;  3REK A;  3AZF C;  5G49 B;  2FJ7 A;  3UTA B;  1ID3 C;  3MGP B;  5B31 G;  2G5H C;  3W96 C;  3UTB B;  1M1A D;  1R4V A;  5AVB C;  3O62 A;  5AV8 B;  1H3O A;  3REJ A;  3AZI D;  3X1V B;  5CPI B;  1S32 D;  3MNN B;  5F99 B;  3UTB C;  2CV5 D;  5B0Y A;  4HGA C;  4H9S C;  5GXQ B;  4J8W B;  3MGR B;  4J8U D;  3KWQ B;  4LD9 C;  5B32 D;  3REI C;  2FFF B;  3B6F B;  3LEL C;  2YFW A;  5B1L B;  5AV9 D;  2ARO B;  2BYK A;  1W2E A;  4QLC A;  4NE5 A;  4X23 D;  4E45 A;  3REH A;  3X1U B;  5AVC B;  5GT0 D;  4M6B A;  1M18 D;  3LZ0 A;  5B0Z A;  5B40 D;  5DNM A;  1KX4 C;  1PZR A;  3WTP B;  1KU5 A;  3VH6 T;  3VH6 W;  3AZF D;  3X1U C;  4JJN C;  4G91 B;  4XUJ B;  1BFM A;  3WTP C;  3C1B A;  3WKJ C;  2RVQ C;  5BS7 C;  3AV2 A;  2DF4 C;  5AVB D;  4G91 C;  3AZL C;  3LJA C;  1HTA A;  2F8N G;  2NZD B;  4CAY A;  3AZJ A;  3C1C C;  4LD9 D;  3REI D;  3MVD D;  3MGS D;  3AZH C;  1P3L C;  3LEL D;  4XZQ B;  1EQZ B;  5DNN B;  1P3F A;  1P3P D;  3R45 B;  1P3A B;  3WA9 C;  5B31 A;  1P3G B;  4Z66 A;  5GT3 A;  3REK D;  2PYO A;  2FJ7 D;  2HIO A;  2LY8 A;  4KGC C;  3AFA A;  3VH5 A;  1P3K C;  1HQ3 B;  4YS3 B;  2YFV A;  1KX4 D;  5BT1 D;  1KX5 C;  1BH9 B;  5C3I B;  4JJN D;  3O62 D;  1T3U A;  1HQ3 C;  4YS3 C;  4WV4 B;  3AZE B;  5B1M B;  3WKJ D;  3WAA C;  5B0Y D;  3AV1 C;  5AV6 A;  4R8P B;  2Y2H A;  1P3I B;  2Y2O A;  5B1M C;  1TZY A;  4UUZ B;  3W98 A;  3REL A;  3LJA D;  5JRG A;  4R8P C;  3MGQ C;  4J8V B;  3C1C D;  5AY8 B;  3NQU B;  2HUE B;  1M19 C;  1P34 A;  3AZH D;  3AZN A;  4Z2M H;  1M1A B;  5AV5 C;  3REH D;  2F8N K;  2HUE C;  3B0B A;  3LZ0 D;  1S32 B;  3AZI B;  5DNM D;  1AOI C;  3WA9 D;  2CV5 B;  1M1A C;  3X1S C;  4J8U B;  3B6G C;  3KXB A;  4KGC D;  3F6T A;  5B32 B;  5CPJ A;  5CP6 C;  1U35 B;  2CV5 C;  1P3K D;  3AV2 D;  5CPK A;  1BH8 B;  4WNN B;  1KX3 A;  5AV9 B;  1JFI B;  3AYW A;  2F8N A;  5GSU A;  4WU8 A;  4X23 B;  3AN2 A;  3WAA D;  3AV1 D;  4Z5T A;  5AV9 C;  3EG5 B;  5GT0 B;  4AWL C;  1M18 B;  4X23 C;  5B40 B;  5E5A A;  3AZF B;  3MGQ D;  4G92 B;  1ID3 B;  1M18 C;  4J8X A;  3IP4 C;  1P3O A;  3AZG A;  5G49 A;  5B2J C;  3UTA A;  1M19 D;  2BG1 A;  3W96 B;  2Y2J A;  3KUY C;  3MGP A;  5B24 A;  4G92 C;  5B31 D;  5AVB B;  5AV5 D;  4YM6 A;  5BNX B;  3AFA D;  3A6N C;  1AOI D;  3H0R C;  5AV8 A;  4HGA B;  3X1S D;  5CPI A;  3B6G D;  2Y2L A;  3X1V A;  3MNN A;  5F99 A;  3W99 A;  4LD9 B;  3AZM C;  4EO5 B;  3REI B;  4DRB A;  3MVD B;  5CP6 D;  5GXQ A;  3MGS B;  3MGR A;  4J8W A;  3KWQ A;  3UT9 A;  3LEL B;  4WU9 C;  4EO5 C;  1TAF A;  1P3P B;  3MVD C;  3MGS C;  3B6F A;  1WWS A;  5B1L A;  3LZ1 C;  2ARO A;  2NQB A;  5KDM A;  2FJ7 B;  2Y2Q A;  4H9P B;  5B2I A;  3AZK C;  1P3M C;  1P3P C;  2J8P A;  2Y2I A;  1P34 D;  1KX4 B;  5AVC A;  3REK C;  2FJ7 C;  5BNV A;  4JJN B;  4H9O A;  3O62 B;  2ZM5 A;  5BT1 C;  3WKJ B;  5B2J D;  1Q9C A;  3NQJ A;  3KUY D;  3X1T A;  1B67 A;  3O62 C;  4XUJ A;  4NFT A;  2ZY5 A;  3AZL B;  3REJ C;  3A6N D;  5B0Y C;  3LJA B;  1F66 A;  4CSR B;  2YFW B;  3C1C B;  5CHL B;  3AZM D;  2NZD A;  5GSU D;  3AZH B;  3AN2 D;  1P3L B;  4H9N B;  2ZY2 A;  4WU9 D;  4QLC C;  3LZ0 B;  5FUG B;  1ZLA A;  3WA9 B;  4XZQ A;  1EQZ A;  3LZ1 D;  5DNN A;  5JA4 A;  3REH C;  3R45 A;  3AZK D;  1P3A A;  1P3M D;  3LZ0 C;  4J8X D;  5B0Z C;  4KGC B;  5DNM C;  1N1J A;  1P3G A;  2Y2G A;  3AZG D;  1P3K B;  1P3O D;  4KUD A;  3UTA D;  2Y2K A;  5B24 D;  3AV2 B;  1KX5 B;  4YM6 D;  3C1B C;  1BH9 A;  3AV2 C;  4ZUX A;  3WAA B;  3AV1 B;  5CPI D;  4H9Q A;  3W99 D;  3REJ D;  5GXQ D;  5BO0 B;  3MGR D;  3V9R B;  3KWQ D;  3UT9 D;  1P3I A;  3MGQ B;  3AZJ C;  4UUZ A;  1ZLA C;  1M19 B;  3KFU G;  4J8V A;  5AY8 A;  2NQB D;  5B31 B;  5AV5 B;  1P3F C;  5B2I D;  4QLC D;  3AFA B;  2YFV B;  1AOI B;  5B31 C;  2PYO C;  4Z66 C;  5GT3 C;  3P5J B;  3X1S B;  2HIO C;  3AZI A;  1S32 A;  3B6G B;  3AFA C;  5B0Z D;  3EPJ A;  2VQR A;  5CP6 B;  4J8U A;  3X1T D;  3VH5 T;  3VH5 W;  2ZY3 A;  1U35 A;  3C1B D;  1F66 D;  3W97 A;  5AV6 C;  1P3B A;  3FDD A;  5B33 A;  2BYM B;  1TZY C;  3TU4 A;  4AWL B;  3W98 C;  3REL C;  5JRG C;  3B0D C;  1P34 B;  5GT0 A;  5B40 A;  3AZJ D;  2IO5 C;  1P34 C;  3AZF A;  1ZLA D;  5B2J B;  3AZN C;  4H9R B;  1ID3 A;  3KUY B;  2UWX A;  1P3F D;  3W96 A;  1P3A D;  3A6N B;  4KUD D;  5AVB A;  2PYO D;  4Z66 D;  5GT3 D;  2DQN C;  3KXB C;  2HIO D;  3UTB A;  5CPJ C;  3AZM B;  4H9S A;  5CPK C;  4ZUX D;  1KX3 C;  4LD9 A;  4ZBJ C;  3B0C T;  3B0C W;  3REI A;  3AYW C;  4WU9 B;  5GSU C;  2Y2N A;  4WU8 C;  3AN2 C;  3LEL A;  4E44 A;  3LZ1 B;  5AV6 D;  4Z5T C;  3AZK B;  1P3M B;  4WJ3 C;  1TZY D;  3W98 D;  4KHA B;  3REL D;  2CWE A;  5E5A C;  3AZG B;  1P3O B;  5JRG D;  4H9P A;  3VH6 A;  3REK B;  4J8V D;  3EPH A;  5B24 B;  5AY8 D;  4J8X C;  4YM6 B;  1P3O C;  3AZG C;  1KX4 A;  2XD1 A;  3UTA C;  3X1U A;  3AZN D;  4NE6 A;  5B24 C;  3MGP C;  4JJN A;  4YM6 C;  3WTP A;  3WKJ A;  1H3O B;  3REJ B;  3W99 B;  5BS7 A;  5B0Y B;  5AV8 C;  3UT9 B;  3AZL A;  5CPI C;  1Z2C B;  3X1V C;  4WZS B;  3KXB D;  3MNN C;  5F99 C;  3W99 C;  5B32 G;  1U35 D;  3LJA A;  1TAF B;  5CPJ D;  5GXQ C;  4J8W C;  3MGR C;  4CSR A;  3KWQ C;  3UT9 C;  3C1C A;  5CPK D;  1KX3 D;  1P3B D;  3W97 D;  2NQB B;  5KDM B;  5B33 D;  2BYK B;  5B2I B;  3AYW D;  3AZH A;  3A1K A;  2F8N D;  4QLC B;  3TU4 D;  3B6F C;  1P3L A;  4WU8 D;  5B1L C;  4H9N A;  2ARO C;  2NQB C;  2JCH A;  4Z5T D;  3H0M C;  5B2I C;  3REH B;  5FUG A;  5BNV B;  4H9O B;  3WA9 A;  5B0Z B;  5DNM B;  5E5A D;  5AVC C;  1ID3 D;  4KGC A;  1A7W A;  3NQJ B;  3X1T B;  4Z2M G;  1P3K A;  3W96 D;  2Y2M A;  3C1B B;  1KX5 A;  3MGP D;  3KSY A;  3X1T C;  4NE3 A;  1F66 B;  4XUJ C;  1HQ3 A;  4YS3 A;  4DRA A;  3AL0 C;  3UTB D;  3WAA A;  3AV1 A;  1F66 C;  1F1E A;  5AV8 D;  4CAY B;  3AZE A;  5B1M A;  3X1V D;  3AZJ B;  3MNN D;  5F99 D;  2JSS A;  5BO0 A;  2G5I C;  3V9R A;  2NZD C;  4J8W D;  4R8P A;  1ZLA B;  3MGQ A;  5JA4 B;  1P3F B;  1M19 A;  3B6F D;  1ULY A;  1B6W A;  1N1J B;  5B1L D;  4XZQ C;  1EQZ C;  4KUD B;  2ARO D;  5AV5 A;  5DNN C;  2PYO B;  3NQU A;  4Z66 B;  5GT3 B;  2HIO B;  1P3A C;  1AOI A;  1P3G C;  2RIQ A;  2F2A C;  1M1A A;  4KUD C;  3X1S A;  3X1U D;  5AVC D;  3B6G A;  4ZUX B;  5CP6 A;  2CV5 A;  3WTP D;  2Y2P A;  4H9Q B;  2RVQ D;  5C3I C;  4ZUX C;  5B32 A;  5AV6 B;  3AZL D;  4UPK A;  2F8N H;  2ZY4 A;  4XUJ D;  3AZE C;  1WWI A;  1TZY B;  3W98 B;  1BH8 A;  4WNN A;  3REL B;  5JRG B;  5AV9 A;  3EPK A;  2BYM A;  3B0D B;  2W8S A;  1P3I C;  1JFI A;  4X23 A;  2NZD D;  2IO5 B;  1P3L D;  3AZN B;  4J8V C;  4DQY B;  5AY8 C;  3A1I A;  1M18 A;  5B2J A;  4H9R A;  3KUY A;  4XZQ D;  1EQZ D;  5DNN D;  1S32 C;  3AZI C;  3KXB B;  3A6N A;  1P3G D;  5CPJ B;  4J8U C;  2XD5 A;  1KX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...