3AZNA

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznA00
1P3KC 1KX3B 5GT3C 3TU4A 5DNMC 3RELB 1KU5A 1Q9CA 2BYKB 3X1SD 5B31C 2F8NH 3B6GA 4H9OA 2YFVB 4Z66B 5AV8B 1S32C 3AZGA 5GT0A 3C1CC 5JRGC 5B33A 1HQ3B 5B1LA 3MGPD 4J8XC 1B67A 3AFAA 3W97A 3W96B 5B0YB 4WU9D 1B6WA 5CP6C 3LZ0C 4KUDA 5AY8B 4J8UA 4NFTA 2F8NG 4NE6A 1P34C 4YM6B 3AZHD 1P3KA 5CPKC 1P3MB 1M1AA 5DNMA 5B24C 3B0DC 5B0ZC 5GT0D 3AYWA 3REHC 1F66B 5B31A 5AVBA 4J8VB 1M19B 3LELC 4H9SA 1M18C 3MVDC 5F99C 3REKD 3AZEB 3WAAC 3C1CA 5JRGA 4Z2MH 4QLCC 4LD9B 4H9RB 2HIOC 3AZNB 4XUJD 1M1AD 4KGCC 3UTBC 3AV1B 5BS7A 4G91B 5KDMB 1AOIC 5B1MA 3WKJC 3KWQD 3MGSD 1KX4D 4WU8C 1P3BD 5B24A 3X1TA 5B0ZA 1KX3D 3VH6A 2NZDA 3REHA 3RELD 4Z2MG 1M18A 1U35B 2CV5C 3WAAA 4ZUXC 4QLCA 4XZQB 1N1JB 2HIOA 1HQ3D 2NQBB 1BFMA 5B2JB 3KSYA 3UTBA 3W96D 1AOIA 5B0YD 1TZYC 3WKJA 4J8WB 5AY8D 2IO5B 4X23C 1H3OB 4WU8A 1P3MD 1P3AC 3KUYD 1F66D 4J8VD 1M19D 3UTAD 4YS3C 5GSUB 3LJAC 3X1SB 2PYOC 4EO5B 2HUEB 4G92C 1R4VA 1ID3C 3AZID 3REJD 3AV1D 1TZYA 3UT9B 4UUZA 4X23A 3MGPB 4H9PB 3NQUB 3X1UD 3TU4B 5DNNA 1P3AA 5AV9C 3KXBC 4CAYA 3B6GB 4H9OB 5AV5C 4NE5A 2RVQC 1TAFB 3AZGB 1P3LA 1JFIA 3WA9C 5GT0B 3MGQC 2PYOA 3REIC 5B33B 1ZLAC 5B1LB 4XZQD 3B6FA 3AFAB 3AN2C 1ID3A 3W97B 5E5AD 3MNNC 4HGAB 5DNND 5AVCA 4KUDB 4J8UB 3AZMA 4J8WD 1P3KB 1M1AB 5DNMB 5AV9A 3KXBA 4H9NA 3AYWB 5B31B 5AVBB 3B6FD 4WZSB 1EQZA 3VH6T 3C1CB 3MGQA 5GSUD 5JRGB 1ZLAA 3NQJA 4E44A 3O62C 3AN2A 2LY8A 3V9RA 1KX5C 3MNNA 5B1MB 1P3FC 5B2IC 3MGRC 3UT9D 5AV6C 3X1VC 1P3PC 5GXQD 3W98A 5B24B 3B0DB 5B0ZB 3X1TB 2NZDB 3TU4D 3REHB 3AZJA 3B6GD 5CPIC 1M18B 4WNNA 1BH9A 5GT3A 3AZGD 4QLCB 3KUYB 1P3OC 3O62A 5B33D 4Z5TC 3AZLC 5B1LD 3UTAB 1KX4C 1KX5A 3AFAD 3W97D 1KX3C 5B32G 1S32A 1AOIB 3RELC 3AZJD 1P3IC 4DRAA 3WKJB 1P3FA 5B2IA 3MGRA 4KUDD 4J8UD 5AV6A 3X1VA 1P3PA 4J8XA 3AZIB 4Z66C 5AV8C 3REJB 1P3KD 5DNMD 5CP6A 3LZ0A 3AYWD 1HQ3C 1HTAA 4KHAA 5B31D 5AVBD 5CPIA 1P34A 3X1UB 3W96C 5CPKA 1S32D 3C1CD 5JRGD 4Z5TA 3AZLA 4J8XD 4YM6C 3LELA 3WTPC 1P3MC 3MVDA 5F99A 1TZYB 1P3IA 1F66C 5B1MD 4UUZB 4X23B 2AROC 4DRBA 1F1EA 5E5AB 4KGCA 5DNNB 5B24D 3AZEC 3X1TD 5B32C 5BT1D 4R8PC 5B0ZD 3AZFC 1P3AB 3REHD 2NZDD 4LD9C 2FJ7C 1A7WA 4CAYB 3AZNC 3LELD 1M18D 3MVDD 5F99D 3AZKC 1P3LB 1JFIB 4G91C 3WAAD 2PYOB 4QLCD 1P3GC 4JJNC 3B6FB 2HIOD 5BO0A 4YM6A 3A6NC 1ID3B 2F8NA 3WTPA 3W99C 3UTBD 5AVCB 2CV5A 1AOID 4ZUXA 3AZMB 3WKJD 2AROA 3VH5A 5CPJC 4WU8D 3AV2C 1U35C 5AV9B 3KXBB 4H9NB 5B32A 4R8PA 3AZFA 2FJ7A 2NQBC 5B2JC 5B40C 1EQZB 5GXQB 3AZKA 3MGQB 1ZLAB 4ZUXD 1WWSA 4J8WC 1P3GA 3C1BC 3NQJB 4JJNA 3AN2B 3A6NA 3R45A 3V9RB 3MNNB 3W99A 5FUGA 3LZ1C 5G49A 4YS3A 3VH5W 3LJAA 3B0CW 1TZYD 4X23D 5BNVA 5CPJA 2BYMA 1U35A 3AV2A 3W98B 2F8NK 3AZJB 5C3IC 3X1SC 1P3AD 4EO5C 5B40A 5B2JA 4WNNB 1BH9B 5GT3B 1P3LD 2CWEA 1P3BB 5B31G 3C1BA 2PYOD 3MGPC 2YFWA 1KX5B 5AV5A 1ID3D 3LZ1A 1S32B 4WU9C 4CSRA 5AVCD 3WA9A 1P3FB 3MGRB 3REIA 5AV6B 3AZMD 3X1VB 1P3PB 4J8XB 3AZHC 3B0BA 5GT0C 5BNXA 5CP6B 5AV9D 3KXBD 3LZ0B 3WTPE 4KHAB 5B1LC 4M6BA 5CPIB 5AV5D 1P34B 2RVQD 1EQZD 5CPKB 3REKC 4KUDC 4ZBJC 3MGQD 4J8UC 3REID 1ZLAD 4Z5TB 3MGPA 3AZLB 4XUJC 3AN2D 5JA4A 5CHLB 3LELB 1M1AC 3MNND 3MVDB 5F99B 4WU9A 1P3IB 3AYWC 3WAAB 5AVBC 3KWQC 4H9QA 3MGSC 2HIOB 3AZHA 4AWLC 4H9SC 4KGCB 1TAFA 1P3BC 3UTBB 3W98D 3VH5T 3B0CT 4WU8B 3REKA 5BS7C 5GT3D 5B1MC 3O62D 4XUJA 5BO0B 2F8NB 1KX5D 3WTPB 3X1TC 5BT1C 2CV5B 5B0YC 2NZDC 4ZUXB 2AROB 5AY8C 5B2ID 3KWQA 3MGRD 3MGSA 1P3FD 5AV6D 3X1VD 1P3OA 1BH8A 1P3PD 1KX4A 1H3OA 1ULYA 1P3BA 3AZFB 1KX3A 5B32B 4R8PB 3RELA 3KUYC 2BYKA 5CP6D 3LZ0D 2FJ7B 4J8VC 1M19C 3UTAC 5CPID 1P34D 3AZKB 2YFVA 4Z66A 5AV8A 5CPKD 1P3GB 1P3OD 4JJNB 1HQ3A 4Z5TD 3AZLD 3A6NB 3R45B 3W99B 4WV4B 5FUGB 3W96A 3REJC 5G49B 3AZIC 5B0YA 4YS3B 3LJAB 3AV1C 1P3ID 5AY8A 5BNVB 5CPJB 2BYMB 4G92B 3X1UC 3AV2B 4Z66D 5AV8D 1P3MA 4KGCD 3KUYA 1F66A 4J8VA 1M19A 3UTAA 5B40B 2JSSA 3AZEA 3C1BB 4XZQC 4LD9A 3VH6W 2YFWB 4H9RA 5AV5B 3AZNA 4YM6D 5E5AC 3LZ1B 3REJA 3AZIA 3WTPD 2F8ND 5DNNC 3AV1A 4CSRB 3WA9B 2CV5D 5KDMA 3REIB 2AROD 2IO5C 2L5AA 3X1UA 1P3LC 5C3IB 3AZED 5BNXB 5B32D 3AZFD 4R8PD 4LD9D 2FJ7D 3B6FC 3AZND 3AZKD 5AVCC 5GSUC 3AZMC 4XZQA 1N1JA 1P3GD 4JJND 2NQBA 2HUEC 3A6ND 5JA4B 5E5AA 3W99D 4WU9B 4YS3D 3LJAD 4J8WA 4H9QB 3O62B 3UT9C 3AZHB 1EQZC 5CPJD 5GXQC 3AV2D 1U35D 3TU4C 5B2IB 2NQBD 3B6GC 5B40D 5B2JD 3REKB 3AZGC 4ZBJB 5GSUA 3X1SA 3C1BD 5B33C 4XUJB 3AFAC 4E45A 3W98C 3W97C 1WWIA 4NE3A 3LZ1D 4HGAC 3AZJC 3WA9D 3KWQB 1P3OB 3UT9A 3MGSB 4AWLB 1BH8B 1KX4B 4H9PA 3NQUA 5GXQA
chains in the Genus database with same CATH superfamily
1P3KC 1KX3B 5GT3C 3TU4A 5DNMC 3RELB 1KU5A 1Q9CA 2BYKB 3X1SD 2Y2IA 5B31C 2Y2NA 2F8NH 3B6GA 4H9OA 2YFVB 4Z66B 5AV8B 2Y2HA 1S32C 3AZGA 3FDDA 5GT0A 3C1CC 5JRGC 5B33A 1HQ3B 5B1LA 3MGPD 4J8XC 1B67A 3AFAA 3W97A 3W96B 5B0YB 4WU9D 1B6WA 5CP6C 3LZ0C 4KUDA 5AY8B 4J8UA 4NFTA 2XD5A 2F8NG 4NE6A 1P34C 4YM6B 3AZHD 1P3KA 5CPKC 1P3MB 1M1AA 5DNMA 5B24C 3B0DC 5B0ZC 5GT0D 3AYWA 3REHC 1F66B 5B31A 5AVBA 4J8VB 1M19B 2DQNC 3LELC 4H9SA 1M18C 3MVDC 5F99C 3REKD 3AZEB 3WAAC 3C1CA 5JRGA 4Z2MH 4QLCC 4LD9B 3EPLA 4H9RB 2HIOC 3AZNB 4XUJD 1M1AD 4KGCC 3UTBC 3AV1B 5BS7A 4G91B 5KDMB 1AOIC 5B1MA 3WKJC 3KWQD 3MGSD 1KX4D 4WU8C 1P3BD 5B24A 3X1TA 5B0ZA 1KX3D 3VH6A 2NZDA 3REHA 3RELD 4Z2MG 1M18A 1U35B 2CV5C 3WAAA 4ZUXC 4QLCA 4XZQB 1N1JB 2HIOA 1HQ3D 2NQBB 1BFMA 5B2JB 3KSYA 3UTBA 3W96D 1AOIA 5B0YD 1TZYC 3WKJA 4J8WB 5AY8D 2IO5B 4X23C 1H3OB 2F2AC 4WU8A 1P3MD 1P3AC 3KUYD 2BG1A 1F66D 4J8VD 1M19D 3UTAD 4YS3C 5GSUB 3LJAC 3X1SB 2PYOC 4EO5B 2HUEB 4G92C 1R4VA 1ID3C 3AZID 3REJD 3AV1D 1TZYA 3UT9B 4UUZA 4X23A 3MGPB 4H9PB 3NQUB 3X1UD 3TU4B 5DNNA 1P3AA 5AV9C 3KXBC 4CAYA 3B6GB 4H9OB 5AV5C 4NE5A 2RVQC 1TAFB 3AZGB 1P3LA 1P3AB 1JFIA 3WA9C 5GT0B 3MGQC 2PYOA 3REIC 5B33B 1ZLAC 5B1LB 4XZQD 3B6FA 3AFAB 3AN2C 1ID3A 3W97B 5E5AD 3MNNC 4HGAB 5DNND 5AVCA 3AL0C 4KUDB 4J8UB 3AZMA 4J8WD 2Y2OA 1P3KB 1M1AB 5DNMB 5AV9A 3KXBA 4H9NA 3AYWB 5B31B 5AVBB 3F6TA 3B6FD 4WZSB 1EQZA 3EPKA 3VH6T 3C1CB 3MGQA 5GSUD 5JRGB 1ZLAA 3NQJA 4E44A 3O62C 4DQYB 3AN2A 2LY8A 3V9RA 1KX5C 3MNNA 2JE5A 5B1MB 1P3FC 5B2IC 3MGRC 3UT9D 5AV6C 3X1VC 1P3PC 5GXQD 3W98A 5B24B 3B0DB 5B0ZB 3X1TB 2NZDB 3TU4D 3REHB 3AZJA 3B6GD 5CPIC 1M18B 4WNNA 1BH9A 5GT3A 3AZGD 4QLCB 3KUYB 2UWXA 1P3OC 3O62A 5B33D 4Z5TC 3AZLC 5B1LD 3UTAB 1KX4C 1KX5A 3AFAD 3W97D 1KX3C 5B32G 1S32A 1AOIB 3RELC 3AZJD 1P3IC 4DRAA 3H0MC 1P3FA 5B2IA 3MGRA 3WKJB 4J8UD 4KUDD 3KFUG 5AV6A 3X1VA 1P3PA 4J8XA 1W2EA 2VQRA 2Y2GA 5AV8C 4Z66C 3REJB 3AZIB 1P3KD 5DNMD 5CP6A 3LZ0A 3AYWD 1HQ3C 1HTAA 4KHAA 5B31D 5AVBD 5CPIA 1P34A 3X1UB 3W96C 5CPKA 1S32D 3C1CD 1Z2CB 2Y2LA 5JRGD 4Z5TA 3AZLA 3EPJA 4J8XD 4YM6C 3LELA 3WTPC 1P3MC 3MVDA 5F99A 1TZYB 1P3IA 2G5HC 1F66C 5B1MD 4UUZB 4X23B 2AROC 4DRBA 1F1EA 5E5AB 4KGCA 5DNNB 5B24D 2ZY4A 3X1TD 5B32C 5BT1D 4R8PC 5B0ZD 3AZEC 2ZY3A 3REHD 3AZFC 2NZDD 4LD9C 2FJ7C 1A7WA 4CAYB 3AZNC 2JCHA 3LELD 1M18D 3MVDD 5F99D 3AZKC 1P3LB 1JFIB 4G91C 3WAAD 2PYOB 4QLCD 1P3GC 4JJNC 3B6FB 2HIOD 5BO0A 4YM6A 3A6NC 1ID3B 2F8NA 3WTPA 3W99C 3UTBD 5AVCB 2CV5A 1AOID 2Y2JA 4ZUXA 3AZMB 3WKJD 2AROA 3VH5A 5CPJC 4WU8D 3AV2C 1U35C 5AV9B 3KXBB 4H9NB 5B32A 4R8PA 3AZFA 2FJ7A 3P5JB 2NQBC 5B2JC 5B40C 1EQZB 5GXQB 3AZKA 3MGQB 2FFFB 1ZLAB 4ZUXD 1WWSA 4J8WC 1P3GA 3C1BC 3NQJB 4JJNA 3AN2B 3A6NA 3R45A 3V9RB 3MNNB 3W99A 5FUGA 3LZ1C 5G49A 4YS3A 3VH5W 3LJAA 3B0CW 1TZYD 3EPHA 4X23D 5BNVA 5CPJA 2BYMA 1U35A 3AV2A 3W98B 2F8NK 2G5IC 3AZJB 5C3IC 3X1SC 1P3AD 4EO5C 5B40A 5B2JA 4WNNB 1BH9B 5GT3B 1P3LD 2CWEA 1P3BB 5B31G 2Y2PA 3C1BA 2PYOD 3MGPC 2YFWA 1KX5B 5AV5A 1ID3D 3LZ1A 1S32B 4WU9C 4CSRA 5AVCD 3WA9A 1P3FB 3MGRB 3REIA 5AV6B 3AZMD 3X1VB 1P3PB 4J8XB 4UPKA 3AZHC 3B0BA 5GT0C 5BNXA 5CP6B 5AV9D 3KXBD 3LZ0B 3WTPE 4KHAB 5B1LC 4M6BA 5CPIB 5AV5D 1P34B 2RVQD 1EQZD 5CPKB 3REKC 4KUDC 4ZBJC 3MGQD 4J8UC 3REID 1ZLAD 4Z5TB 3MGPA 3AZLB 4XUJC 3AN2D 5JA4A 5CHLB 3LELB 3A1IA 1M1AC 3MNND 3MVDB 5F99B 4WU9A 1P3IB 3AYWC 3WAAB 5AVBC 3KWQC 4H9QA 2Y2MA 2HIOB 3MGSC 3AZHA 4AWLC 4H9SC 4KGCB 1TAFA 1P3BC 3UTBB 3W98D 2Y2KA 3VH5T 3B0CT 4WU8B 3REKA 5BS7C 5GT3D 5B1MC 3O62D 4XUJA 5BO0B 2F8NB 1KX5D 3WTPB 3X1TC 5BT1C 2CV5B 5B0YC 2NZDC 4ZUXB 2AROB 5AY8C 5B2ID 3KWQA 3MGRD 3MGSA 1P3FD 5AV6D 3X1VD 1P3OA 1BH8A 1P3PD 1KX4A 1H3OA 1ULYA 1P3BA 3AZFB 1KX3A 5B32B 4R8PB 3RELA 2ZY5A 3H0LC 3KUYC 2BYKA 2XD1A 2J8PA 5CP6D 3LZ0D 2FJ7B 4J8VC 1M19C 3UTAC 5CPID 1P34D 1PZRA 3AZKB 2YFVA 4Z66A 5AV8A 5CPKD 1P3GB 1P3OD 4JJNB 1HQ3A 4Z5TD 3AZLD 3A6NB 3R45B 3W99B 4WJ3C 4WV4B 5FUGB 3W96A 3REJC 5G49B 3AZIC 5B0YA 4YS3B 3LJAB 3AV1C 1P3ID 1T3UA 5AY8A 3IP4C 2ZY2A 5BNVB 5CPJB 2BYMB 4G92B 3X1UC 3AV2B 2ZM5A 4Z66D 5AV8D 1P3MA 4KGCD 3KUYA 1F66A 4J8VA 1M19A 3UTAA 5B40B 2JSSA 3AZEA 3C1BB 4XZQC 4LD9A 3VH6W 2YFWB 4H9RA 5AV5B 3AZNA 4YM6D 5E5AC 3LZ1B 3REJA 3AZIA 3WTPD 2F8ND 5DNNC 3H0RC 3AV1A 4CSRB 3WA9B 2CV5D 5KDMA 3REIB 3EG5B 2AROD 2IO5C 2L5AA 3X1UA 1P3LC 5C3IB 3AZED 5BNXB 5B32D 3AZFD 4R8PD 4LD9D 2FJ7D 3B6FC 3AZND 3AZKD 5AVCC 5GSUC 3AZMC 4XZQA 1N1JA 1P3GD 4JJND 2NQBA 2HUEC 3A6ND 5JA4B 5E5AA 2RIQA 2W8SA 3W99D 4WU9B 4YS3D 3LJAD 4J8WA 4H9QB 3O62B 3UT9C 3AZHB 1EQZC 5CPJD 5GXQC 3AV2D 1U35D 3TU4C 3A1KA 5B2IB 2DF4C 2NQBD 3B6GC 5B40D 5B2JD 3REKB 3AZGC 4ZBJB 5GSUA 3X1SA 3C1BD 5B33C 4XUJB 3AFAC 4E45A 3W98C 3W97C 2Y2QA 1WWIA 4NE3A 3LZ1D 4HGAC 3AZJC 3WA9D 3KWQB 1P3OB 3UT9A 3MGSB 4AWLB 1BH8B 1KX4B 4H9PA 3NQUA 5GXQA
chains in the Genus database with same CATH topology
1P3KC 1KX3B 5GT3C 3TU4A 5DNMC 3RELB 1KU5A 1Q9CA 2BYKB 3X1SD 2Y2IA 5B31C 2Y2NA 2F8NH 3B6GA 4H9OA 2YFVB 4Z66B 5AV8B 2Y2HA 1S32C 3AZGA 3FDDA 5GT0A 3C1CC 5JRGC 5B33A 1HQ3B 5B1LA 3MGPD 4J8XC 1B67A 3AFAA 3W97A 3W96B 5B0YB 4WU9D 1B6WA 5CP6C 3LZ0C 4KUDA 5AY8B 4J8UA 4NFTA 2XD5A 2F8NG 4NE6A 1P34C 4YM6B 3AZHD 1P3KA 5CPKC 1P3MB 1M1AA 5DNMA 5B24C 3B0DC 5B0ZC 5GT0D 3AYWA 3REHC 1F66B 5B31A 5AVBA 4J8VB 1M19B 2DQNC 3LELC 4H9SA 1M18C 3MVDC 5F99C 3REKD 3AZEB 3WAAC 3C1CA 5JRGA 4Z2MH 4QLCC 4LD9B 3EPLA 4H9RB 2HIOC 3AZNB 4XUJD 1M1AD 4KGCC 3UTBC 3AV1B 5BS7A 4G91B 5KDMB 1AOIC 5B1MA 3WKJC 3KWQD 3MGSD 1KX4D 4WU8C 1P3BD 5B24A 3X1TA 5B0ZA 1KX3D 3VH6A 2NZDA 3REHA 3RELD 4Z2MG 1M18A 1U35B 2CV5C 3WAAA 4ZUXC 4QLCA 4XZQB 1N1JB 2HIOA 1HQ3D 2NQBB 1BFMA 5B2JB 3KSYA 3UTBA 3W96D 1AOIA 5B0YD 1TZYC 3WKJA 4J8WB 5AY8D 2IO5B 4X23C 1H3OB 2F2AC 4WU8A 1P3MD 1P3AC 3KUYD 2BG1A 1F66D 4J8VD 1M19D 3UTAD 4YS3C 5GSUB 3LJAC 3X1SB 2PYOC 4EO5B 2HUEB 4G92C 1R4VA 1ID3C 3AZID 3REJD 3AV1D 1TZYA 3UT9B 4UUZA 4X23A 3MGPB 4H9PB 3NQUB 3X1UD 3TU4B 5DNNA 1P3AA 5AV9C 3KXBC 4CAYA 3B6GB 4H9OB 5AV5C 4NE5A 2RVQC 1TAFB 3AZGB 1P3LA 1P3AB 1JFIA 3WA9C 5GT0B 3MGQC 2PYOA 3REIC 5B33B 1ZLAC 5B1LB 4XZQD 3B6FA 3AFAB 3AN2C 1ID3A 3W97B 5E5AD 3MNNC 4HGAB 5DNND 5AVCA 3AL0C 4KUDB 4J8UB 3AZMA 4J8WD 2Y2OA 1P3KB 1M1AB 5DNMB 5AV9A 3KXBA 4H9NA 3AYWB 5B31B 5AVBB 3F6TA 3B6FD 4WZSB 1EQZA 3EPKA 3VH6T 3C1CB 3MGQA 5GSUD 5JRGB 1ZLAA 3NQJA 4E44A 3O62C 4DQYB 3AN2A 2LY8A 3V9RA 1KX5C 3MNNA 2JE5A 5B1MB 1P3FC 5B2IC 3MGRC 3UT9D 5AV6C 3X1VC 1P3PC 5GXQD 3W98A 5B24B 3B0DB 5B0ZB 3X1TB 2NZDB 3TU4D 3REHB 3AZJA 3B6GD 5CPIC 1M18B 4WNNA 1BH9A 5GT3A 3AZGD 4QLCB 3KUYB 2UWXA 1P3OC 3O62A 5B33D 4Z5TC 3AZLC 5B1LD 3UTAB 1KX4C 1KX5A 3AFAD 3W97D 1KX3C 5B32G 1S32A 1AOIB 3RELC 3AZJD 1P3IC 4DRAA 3H0MC 1P3FA 5B2IA 3MGRA 3WKJB 4J8UD 4KUDD 3KFUG 5AV6A 3X1VA 1P3PA 4J8XA 1W2EA 2VQRA 2Y2GA 5AV8C 4Z66C 3REJB 3AZIB 1P3KD 5DNMD 5CP6A 3LZ0A 3AYWD 1HQ3C 1HTAA 4KHAA 5B31D 5AVBD 5CPIA 1P34A 3X1UB 3W96C 5CPKA 1S32D 3C1CD 1Z2CB 2Y2LA 5JRGD 4Z5TA 3AZLA 3EPJA 4J8XD 4YM6C 3LELA 3WTPC 1P3MC 3MVDA 5F99A 1TZYB 1P3IA 2G5HC 1F66C 5B1MD 4UUZB 4X23B 2AROC 4DRBA 1F1EA 5E5AB 4KGCA 5DNNB 5B24D 2ZY4A 3X1TD 5B32C 5BT1D 4R8PC 5B0ZD 3AZEC 2ZY3A 3REHD 3AZFC 2NZDD 4LD9C 2FJ7C 1A7WA 4CAYB 3AZNC 2JCHA 3LELD 1M18D 3MVDD 5F99D 3AZKC 1P3LB 1JFIB 4G91C 3WAAD 2PYOB 4QLCD 1P3GC 4JJNC 3B6FB 2HIOD 5BO0A 4YM6A 3A6NC 1ID3B 2F8NA 3WTPA 3W99C 3UTBD 5AVCB 2CV5A 1AOID 2Y2JA 4ZUXA 3AZMB 3WKJD 2AROA 3VH5A 5CPJC 4WU8D 3AV2C 1U35C 5AV9B 3KXBB 4H9NB 5B32A 4R8PA 3AZFA 2FJ7A 3P5JB 2NQBC 5B2JC 5B40C 1EQZB 5GXQB 3AZKA 3MGQB 2FFFB 1ZLAB 4ZUXD 1WWSA 4J8WC 1P3GA 3C1BC 3NQJB 4JJNA 3AN2B 3A6NA 3R45A 3V9RB 3MNNB 3W99A 5FUGA 3LZ1C 5G49A 4YS3A 3VH5W 3LJAA 3B0CW 1TZYD 3EPHA 4X23D 5BNVA 5CPJA 2BYMA 1U35A 3AV2A 3W98B 2F8NK 2G5IC 3AZJB 5C3IC 3X1SC 1P3AD 4EO5C 5B40A 5B2JA 4WNNB 1BH9B 5GT3B 1P3LD 2CWEA 1P3BB 5B31G 2Y2PA 3C1BA 2PYOD 3MGPC 2YFWA 1KX5B 5AV5A 1ID3D 3LZ1A 1S32B 4WU9C 4CSRA 5AVCD 3WA9A 1P3FB 3MGRB 3REIA 5AV6B 3AZMD 3X1VB 1P3PB 4J8XB 4UPKA 3AZHC 3B0BA 5GT0C 5BNXA 5CP6B 5AV9D 3KXBD 3LZ0B 3WTPE 4KHAB 5B1LC 4M6BA 5CPIB 5AV5D 1P34B 2RVQD 1EQZD 5CPKB 3REKC 4KUDC 4ZBJC 3MGQD 4J8UC 3REID 1ZLAD 4Z5TB 3MGPA 3AZLB 4XUJC 3AN2D 5JA4A 5CHLB 3LELB 3A1IA 1M1AC 3MNND 3MVDB 5F99B 4WU9A 1P3IB 3AYWC 3WAAB 5AVBC 3KWQC 4H9QA 2Y2MA 2HIOB 3MGSC 3AZHA 4AWLC 4H9SC 4KGCB 1TAFA 1P3BC 3UTBB 3W98D 2Y2KA 3VH5T 3B0CT 4WU8B 3REKA 5BS7C 5GT3D 5B1MC 3O62D 4XUJA 5BO0B 2F8NB 1KX5D 3WTPB 3X1TC 5BT1C 2CV5B 5B0YC 2NZDC 4ZUXB 2AROB 5AY8C 5B2ID 3KWQA 3MGRD 3MGSA 1P3FD 5AV6D 3X1VD 1P3OA 1BH8A 1P3PD 1KX4A 1H3OA 1ULYA 1P3BA 3AZFB 1KX3A 5B32B 4R8PB 3RELA 2ZY5A 3H0LC 3KUYC 2BYKA 2XD1A 2J8PA 5CP6D 3LZ0D 2FJ7B 4J8VC 1M19C 3UTAC 5CPID 1P34D 1PZRA 3AZKB 2YFVA 4Z66A 5AV8A 5CPKD 1P3GB 1P3OD 4JJNB 1HQ3A 4Z5TD 3AZLD 3A6NB 3R45B 3W99B 4WJ3C 4WV4B 5FUGB 3W96A 3REJC 5G49B 3AZIC 5B0YA 4YS3B 3LJAB 3AV1C 1P3ID 1T3UA 5AY8A 3IP4C 2ZY2A 5BNVB 5CPJB 2BYMB 4G92B 3X1UC 3AV2B 2ZM5A 4Z66D 5AV8D 1P3MA 4KGCD 3KUYA 1F66A 4J8VA 1M19A 3UTAA 5B40B 2JSSA 3AZEA 3C1BB 4XZQC 4LD9A 3VH6W 2YFWB 4H9RA 5AV5B 3AZNA 4YM6D 5E5AC 3LZ1B 3REJA 3AZIA 3WTPD 2F8ND 5DNNC 3H0RC 3AV1A 4CSRB 3WA9B 2CV5D 5KDMA 3REIB 3EG5B 2AROD 2IO5C 2L5AA 3X1UA 1P3LC 5C3IB 3AZED 5BNXB 5B32D 3AZFD 4R8PD 4LD9D 2FJ7D 3B6FC 3AZND 3AZKD 5AVCC 5GSUC 3AZMC 4XZQA 1N1JA 1P3GD 4JJND 2NQBA 2HUEC 3A6ND 5JA4B 5E5AA 2RIQA 2W8SA 3W99D 4WU9B 4YS3D 3LJAD 4J8WA 4H9QB 3O62B 3UT9C 3AZHB 1EQZC 5CPJD 5GXQC 3AV2D 1U35D 3TU4C 3A1KA 5B2IB 2DF4C 2NQBD 3B6GC 5B40D 5B2JD 3REKB 3AZGC 4ZBJB 5GSUA 3X1SA 3C1BD 5B33C 4XUJB 3AFAC 4E45A 3W98C 3W97C 2Y2QA 1WWIA 4NE3A 3LZ1D 4HGAC 3AZJC 3WA9D 3KWQB 1P3OB 3UT9A 3MGSB 4AWLB 1BH8B 1KX4B 4H9PA 3NQUA 5GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K C;  1KX3 B;  5GT3 C;  3TU4 A;  5DNM C;  3REL B;  1KU5 A;  1Q9C A;  2BYK B;  3X1S D;  5B31 C;  2F8N H;  3B6G A;  4H9O A;  2YFV B;  4Z66 B;  5AV8 B;  1S32 C;  3AZG A;  5GT0 A;  3C1C C;  5JRG C;  5B33 A;  1HQ3 B;  5B1L A;  3MGP D;  4J8X C;  1B67 A;  3AFA A;  3W97 A;  3W96 B;  5B0Y B;  4WU9 D;  1B6W A;  5CP6 C;  3LZ0 C;  4KUD A;  5AY8 B;  4J8U A;  4NFT A;  2F8N G;  4NE6 A;  1P34 C;  4YM6 B;  3AZH D;  1P3K A;  5CPK C;  1P3M B;  1M1A A;  5DNM A;  5B24 C;  3B0D C;  5B0Z C;  5GT0 D;  3AYW A;  3REH C;  1F66 B;  5B31 A;  5AVB A;  4J8V B;  1M19 B;  3LEL C;  4H9S A;  1M18 C;  3MVD C;  5F99 C;  3REK D;  3AZE B;  3WAA C;  3C1C A;  5JRG A;  4Z2M H;  4QLC C;  4LD9 B;  4H9R B;  2HIO C;  3AZN B;  4XUJ D;  1M1A D;  4KGC C;  3UTB C;  3AV1 B;  5BS7 A;  4G91 B;  5KDM B;  1AOI C;  5B1M A;  3WKJ C;  3KWQ D;  3MGS D;  1KX4 D;  4WU8 C;  1P3B D;  5B24 A;  3X1T A;  5B0Z A;  1KX3 D;  3VH6 A;  2NZD A;  3REH A;  3REL D;  4Z2M G;  1M18 A;  1U35 B;  2CV5 C;  3WAA A;  4ZUX C;  4QLC A;  4XZQ B;  1N1J B;  2HIO A;  1HQ3 D;  2NQB B;  1BFM A;  5B2J B;  3KSY A;  3UTB A;  3W96 D;  1AOI A;  5B0Y D;  1TZY C;  3WKJ A;  4J8W B;  5AY8 D;  2IO5 B;  4X23 C;  1H3O B;  4WU8 A;  1P3M D;  1P3A C;  3KUY D;  1F66 D;  4J8V D;  1M19 D;  3UTA D;  4YS3 C;  5GSU B;  3LJA C;  3X1S B;  2PYO C;  4EO5 B;  2HUE B;  4G92 C;  1R4V A;  1ID3 C;  3AZI D;  3REJ D;  3AV1 D;  1TZY A;  3UT9 B;  4UUZ A;  4X23 A;  3MGP B;  4H9P B;  3NQU B;  3X1U D;  3TU4 B;  5DNN A;  1P3A A;  5AV9 C;  3KXB C;  4CAY A;  3B6G B;  4H9O B;  5AV5 C;  4NE5 A;  2RVQ C;  1TAF B;  3AZG B;  1P3L A;  1JFI A;  3WA9 C;  5GT0 B;  3MGQ C;  2PYO A;  3REI C;  5B33 B;  1ZLA C;  5B1L B;  4XZQ D;  3B6F A;  3AFA B;  3AN2 C;  1ID3 A;  3W97 B;  5E5A D;  3MNN C;  4HGA B;  5DNN D;  5AVC A;  4KUD B;  4J8U B;  3AZM A;  4J8W D;  1P3K B;  1M1A B;  5DNM B;  5AV9 A;  3KXB A;  4H9N A;  3AYW B;  5B31 B;  5AVB B;  3B6F D;  4WZS B;  1EQZ A;  3VH6 T;  3C1C B;  3MGQ A;  5GSU D;  5JRG B;  1ZLA A;  3NQJ A;  4E44 A;  3O62 C;  3AN2 A;  2LY8 A;  3V9R A;  1KX5 C;  3MNN A;  5B1M B;  1P3F C;  5B2I C;  3MGR C;  3UT9 D;  5AV6 C;  3X1V C;  1P3P C;  5GXQ D;  3W98 A;  5B24 B;  3B0D B;  5B0Z B;  3X1T B;  2NZD B;  3TU4 D;  3REH B;  3AZJ A;  3B6G D;  5CPI C;  1M18 B;  4WNN A;  1BH9 A;  5GT3 A;  3AZG D;  4QLC B;  3KUY B;  1P3O C;  3O62 A;  5B33 D;  4Z5T C;  3AZL C;  5B1L D;  3UTA B;  1KX4 C;  1KX5 A;  3AFA D;  3W97 D;  1KX3 C;  5B32 G;  1S32 A;  1AOI B;  3REL C;  3AZJ D;  1P3I C;  4DRA A;  3WKJ B;  1P3F A;  5B2I A;  3MGR A;  4KUD D;  4J8U D;  5AV6 A;  3X1V A;  1P3P A;  4J8X A;  3AZI B;  4Z66 C;  5AV8 C;  3REJ B;  1P3K D;  5DNM D;  5CP6 A;  3LZ0 A;  3AYW D;  1HQ3 C;  1HTA A;  4KHA A;  5B31 D;  5AVB D;  5CPI A;  1P34 A;  3X1U B;  3W96 C;  5CPK A;  1S32 D;  3C1C D;  5JRG D;  4Z5T A;  3AZL A;  4J8X D;  4YM6 C;  3LEL A;  3WTP C;  1P3M C;  3MVD A;  5F99 A;  1TZY B;  1P3I A;  1F66 C;  5B1M D;  4UUZ B;  4X23 B;  2ARO C;  4DRB A;  1F1E A;  5E5A B;  4KGC A;  5DNN B;  5B24 D;  3AZE C;  3X1T D;  5B32 C;  5BT1 D;  4R8P C;  5B0Z D;  3AZF C;  1P3A B;  3REH D;  2NZD D;  4LD9 C;  2FJ7 C;  1A7W A;  4CAY B;  3AZN C;  3LEL D;  1M18 D;  3MVD D;  5F99 D;  3AZK C;  1P3L B;  1JFI B;  4G91 C;  3WAA D;  2PYO B;  4QLC D;  1P3G C;  4JJN C;  3B6F B;  2HIO D;  5BO0 A;  4YM6 A;  3A6N C;  1ID3 B;  2F8N A;  3WTP A;  3W99 C;  3UTB D;  5AVC B;  2CV5 A;  1AOI D;  4ZUX A;  3AZM B;  3WKJ D;  2ARO A;  3VH5 A;  5CPJ C;  4WU8 D;  3AV2 C;  1U35 C;  5AV9 B;  3KXB B;  4H9N B;  5B32 A;  4R8P A;  3AZF A;  2FJ7 A;  2NQB C;  5B2J C;  5B40 C;  1EQZ B;  5GXQ B;  3AZK A;  3MGQ B;  1ZLA B;  4ZUX D;  1WWS A;  4J8W C;  1P3G A;  3C1B C;  3NQJ B;  4JJN A;  3AN2 B;  3A6N A;  3R45 A;  3V9R B;  3MNN B;  3W99 A;  5FUG A;  3LZ1 C;  5G49 A;  4YS3 A;  3VH5 W;  3LJA A;  3B0C W;  1TZY D;  4X23 D;  5BNV A;  5CPJ A;  2BYM A;  1U35 A;  3AV2 A;  3W98 B;  2F8N K;  3AZJ B;  5C3I C;  3X1S C;  1P3A D;  4EO5 C;  5B40 A;  5B2J A;  4WNN B;  1BH9 B;  5GT3 B;  1P3L D;  2CWE A;  1P3B B;  5B31 G;  3C1B A;  2PYO D;  3MGP C;  2YFW A;  1KX5 B;  5AV5 A;  1ID3 D;  3LZ1 A;  1S32 B;  4WU9 C;  4CSR A;  5AVC D;  3WA9 A;  1P3F B;  3MGR B;  3REI A;  5AV6 B;  3AZM D;  3X1V B;  1P3P B;  4J8X B;  3AZH C;  3B0B A;  5GT0 C;  5BNX A;  5CP6 B;  5AV9 D;  3KXB D;  3LZ0 B;  3WTP E;  4KHA B;  5B1L C;  4M6B A;  5CPI B;  5AV5 D;  1P34 B;  2RVQ D;  1EQZ D;  5CPK B;  3REK C;  4KUD C;  4ZBJ C;  3MGQ D;  4J8U C;  3REI D;  1ZLA D;  4Z5T B;  3MGP A;  3AZL B;  4XUJ C;  3AN2 D;  5JA4 A;  5CHL B;  3LEL B;  1M1A C;  3MNN D;  3MVD B;  5F99 B;  4WU9 A;  1P3I B;  3AYW C;  3WAA B;  5AVB C;  3KWQ C;  4H9Q A;  3MGS C;  2HIO B;  3AZH A;  4AWL C;  4H9S C;  4KGC B;  1TAF A;  1P3B C;  3UTB B;  3W98 D;  3VH5 T;  3B0C T;  4WU8 B;  3REK A;  5BS7 C;  5GT3 D;  5B1M C;  3O62 D;  4XUJ A;  5BO0 B;  2F8N B;  1KX5 D;  3WTP B;  3X1T C;  5BT1 C;  2CV5 B;  5B0Y C;  2NZD C;  4ZUX B;  2ARO B;  5AY8 C;  5B2I D;  3KWQ A;  3MGR D;  3MGS A;  1P3F D;  5AV6 D;  3X1V D;  1P3O A;  1BH8 A;  1P3P D;  1KX4 A;  1H3O A;  1ULY A;  1P3B A;  3AZF B;  1KX3 A;  5B32 B;  4R8P B;  3REL A;  3KUY C;  2BYK A;  5CP6 D;  3LZ0 D;  2FJ7 B;  4J8V C;  1M19 C;  3UTA C;  5CPI D;  1P34 D;  3AZK B;  2YFV A;  4Z66 A;  5AV8 A;  5CPK D;  1P3G B;  1P3O D;  4JJN B;  1HQ3 A;  4Z5T D;  3AZL D;  3A6N B;  3R45 B;  3W99 B;  4WV4 B;  5FUG B;  3W96 A;  3REJ C;  5G49 B;  3AZI C;  5B0Y A;  4YS3 B;  3LJA B;  3AV1 C;  1P3I D;  5AY8 A;  5BNV B;  5CPJ B;  2BYM B;  4G92 B;  3X1U C;  3AV2 B;  4Z66 D;  5AV8 D;  1P3M A;  4KGC D;  3KUY A;  1F66 A;  4J8V A;  1M19 A;  3UTA A;  5B40 B;  2JSS A;  3AZE A;  3C1B B;  4XZQ C;  4LD9 A;  3VH6 W;  2YFW B;  4H9R A;  5AV5 B;  3AZN A;  4YM6 D;  5E5A C;  3LZ1 B;  3REJ A;  3AZI A;  3WTP D;  2F8N D;  5DNN C;  3AV1 A;  4CSR B;  3WA9 B;  2CV5 D;  5KDM A;  3REI B;  2ARO D;  2IO5 C;  2L5A A;  3X1U A;  1P3L C;  5C3I B;  3AZE D;  5BNX B;  5B32 D;  3AZF D;  4R8P D;  4LD9 D;  2FJ7 D;  3B6F C;  3AZN D;  3AZK D;  5AVC C;  5GSU C;  3AZM C;  4XZQ A;  1N1J A;  1P3G D;  4JJN D;  2NQB A;  2HUE C;  3A6N D;  5JA4 B;  5E5A A;  3W99 D;  4WU9 B;  4YS3 D;  3LJA D;  4J8W A;  4H9Q B;  3O62 B;  3UT9 C;  3AZH B;  1EQZ C;  5CPJ D;  5GXQ C;  3AV2 D;  1U35 D;  3TU4 C;  5B2I B;  2NQB D;  3B6G C;  5B40 D;  5B2J D;  3REK B;  3AZG C;  4ZBJ B;  5GSU A;  3X1S A;  3C1B D;  5B33 C;  4XUJ B;  3AFA C;  4E45 A;  3W98 C;  3W97 C;  1WWI A;  4NE3 A;  3LZ1 D;  4HGA C;  3AZJ C;  3WA9 D;  3KWQ B;  1P3O B;  3UT9 A;  3MGS B;  4AWL B;  1BH8 B;  1KX4 B;  4H9P A;  3NQU A;  5GXQ A; 
#chains in the Genus database with same CATH topology
 1P3K C;  1KX3 B;  5GT3 C;  3TU4 A;  5DNM C;  3REL B;  1KU5 A;  1Q9C A;  2BYK B;  3X1S D;  2Y2I A;  5B31 C;  2Y2N A;  2F8N H;  3B6G A;  4H9O A;  2YFV B;  4Z66 B;  5AV8 B;  2Y2H A;  1S32 C;  3AZG A;  3FDD A;  5GT0 A;  3C1C C;  5JRG C;  5B33 A;  1HQ3 B;  5B1L A;  3MGP D;  4J8X C;  1B67 A;  3AFA A;  3W97 A;  3W96 B;  5B0Y B;  4WU9 D;  1B6W A;  5CP6 C;  3LZ0 C;  4KUD A;  5AY8 B;  4J8U A;  4NFT A;  2XD5 A;  2F8N G;  4NE6 A;  1P34 C;  4YM6 B;  3AZH D;  1P3K A;  5CPK C;  1P3M B;  1M1A A;  5DNM A;  5B24 C;  3B0D C;  5B0Z C;  5GT0 D;  3AYW A;  3REH C;  1F66 B;  5B31 A;  5AVB A;  4J8V B;  1M19 B;  2DQN C;  3LEL C;  4H9S A;  1M18 C;  3MVD C;  5F99 C;  3REK D;  3AZE B;  3WAA C;  3C1C A;  5JRG A;  4Z2M H;  4QLC C;  4LD9 B;  3EPL A;  4H9R B;  2HIO C;  3AZN B;  4XUJ D;  1M1A D;  4KGC C;  3UTB C;  3AV1 B;  5BS7 A;  4G91 B;  5KDM B;  1AOI C;  5B1M A;  3WKJ C;  3KWQ D;  3MGS D;  1KX4 D;  4WU8 C;  1P3B D;  5B24 A;  3X1T A;  5B0Z A;  1KX3 D;  3VH6 A;  2NZD A;  3REH A;  3REL D;  4Z2M G;  1M18 A;  1U35 B;  2CV5 C;  3WAA A;  4ZUX C;  4QLC A;  4XZQ B;  1N1J B;  2HIO A;  1HQ3 D;  2NQB B;  1BFM A;  5B2J B;  3KSY A;  3UTB A;  3W96 D;  1AOI A;  5B0Y D;  1TZY C;  3WKJ A;  4J8W B;  5AY8 D;  2IO5 B;  4X23 C;  1H3O B;  2F2A C;  4WU8 A;  1P3M D;  1P3A C;  3KUY D;  2BG1 A;  1F66 D;  4J8V D;  1M19 D;  3UTA D;  4YS3 C;  5GSU B;  3LJA C;  3X1S B;  2PYO C;  4EO5 B;  2HUE B;  4G92 C;  1R4V A;  1ID3 C;  3AZI D;  3REJ D;  3AV1 D;  1TZY A;  3UT9 B;  4UUZ A;  4X23 A;  3MGP B;  4H9P B;  3NQU B;  3X1U D;  3TU4 B;  5DNN A;  1P3A A;  5AV9 C;  3KXB C;  4CAY A;  3B6G B;  4H9O B;  5AV5 C;  4NE5 A;  2RVQ C;  1TAF B;  3AZG B;  1P3L A;  1P3A B;  1JFI A;  3WA9 C;  5GT0 B;  3MGQ C;  2PYO A;  3REI C;  5B33 B;  1ZLA C;  5B1L B;  4XZQ D;  3B6F A;  3AFA B;  3AN2 C;  1ID3 A;  3W97 B;  5E5A D;  3MNN C;  4HGA B;  5DNN D;  5AVC A;  3AL0 C;  4KUD B;  4J8U B;  3AZM A;  4J8W D;  2Y2O A;  1P3K B;  1M1A B;  5DNM B;  5AV9 A;  3KXB A;  4H9N A;  3AYW B;  5B31 B;  5AVB B;  3F6T A;  3B6F D;  4WZS B;  1EQZ A;  3EPK A;  3VH6 T;  3C1C B;  3MGQ A;  5GSU D;  5JRG B;  1ZLA A;  3NQJ A;  4E44 A;  3O62 C;  4DQY B;  3AN2 A;  2LY8 A;  3V9R A;  1KX5 C;  3MNN A;  2JE5 A;  5B1M B;  1P3F C;  5B2I C;  3MGR C;  3UT9 D;  5AV6 C;  3X1V C;  1P3P C;  5GXQ D;  3W98 A;  5B24 B;  3B0D B;  5B0Z B;  3X1T B;  2NZD B;  3TU4 D;  3REH B;  3AZJ A;  3B6G D;  5CPI C;  1M18 B;  4WNN A;  1BH9 A;  5GT3 A;  3AZG D;  4QLC B;  3KUY B;  2UWX A;  1P3O C;  3O62 A;  5B33 D;  4Z5T C;  3AZL C;  5B1L D;  3UTA B;  1KX4 C;  1KX5 A;  3AFA D;  3W97 D;  1KX3 C;  5B32 G;  1S32 A;  1AOI B;  3REL C;  3AZJ D;  1P3I C;  4DRA A;  3H0M C;  1P3F A;  5B2I A;  3MGR A;  3WKJ B;  4J8U D;  4KUD D;  3KFU G;  5AV6 A;  3X1V A;  1P3P A;  4J8X A;  1W2E A;  2VQR A;  2Y2G A;  5AV8 C;  4Z66 C;  3REJ B;  3AZI B;  1P3K D;  5DNM D;  5CP6 A;  3LZ0 A;  3AYW D;  1HQ3 C;  1HTA A;  4KHA A;  5B31 D;  5AVB D;  5CPI A;  1P34 A;  3X1U B;  3W96 C;  5CPK A;  1S32 D;  3C1C D;  1Z2C B;  2Y2L A;  5JRG D;  4Z5T A;  3AZL A;  3EPJ A;  4J8X D;  4YM6 C;  3LEL A;  3WTP C;  1P3M C;  3MVD A;  5F99 A;  1TZY B;  1P3I A;  2G5H C;  1F66 C;  5B1M D;  4UUZ B;  4X23 B;  2ARO C;  4DRB A;  1F1E A;  5E5A B;  4KGC A;  5DNN B;  5B24 D;  2ZY4 A;  3X1T D;  5B32 C;  5BT1 D;  4R8P C;  5B0Z D;  3AZE C;  2ZY3 A;  3REH D;  3AZF C;  2NZD D;  4LD9 C;  2FJ7 C;  1A7W A;  4CAY B;  3AZN C;  2JCH A;  3LEL D;  1M18 D;  3MVD D;  5F99 D;  3AZK C;  1P3L B;  1JFI B;  4G91 C;  3WAA D;  2PYO B;  4QLC D;  1P3G C;  4JJN C;  3B6F B;  2HIO D;  5BO0 A;  4YM6 A;  3A6N C;  1ID3 B;  2F8N A;  3WTP A;  3W99 C;  3UTB D;  5AVC B;  2CV5 A;  1AOI D;  2Y2J A;  4ZUX A;  3AZM B;  3WKJ D;  2ARO A;  3VH5 A;  5CPJ C;  4WU8 D;  3AV2 C;  1U35 C;  5AV9 B;  3KXB B;  4H9N B;  5B32 A;  4R8P A;  3AZF A;  2FJ7 A;  3P5J B;  2NQB C;  5B2J C;  5B40 C;  1EQZ B;  5GXQ B;  3AZK A;  3MGQ B;  2FFF B;  1ZLA B;  4ZUX D;  1WWS A;  4J8W C;  1P3G A;  3C1B C;  3NQJ B;  4JJN A;  3AN2 B;  3A6N A;  3R45 A;  3V9R B;  3MNN B;  3W99 A;  5FUG A;  3LZ1 C;  5G49 A;  4YS3 A;  3VH5 W;  3LJA A;  3B0C W;  1TZY D;  3EPH A;  4X23 D;  5BNV A;  5CPJ A;  2BYM A;  1U35 A;  3AV2 A;  3W98 B;  2F8N K;  2G5I C;  3AZJ B;  5C3I C;  3X1S C;  1P3A D;  4EO5 C;  5B40 A;  5B2J A;  4WNN B;  1BH9 B;  5GT3 B;  1P3L D;  2CWE A;  1P3B B;  5B31 G;  2Y2P A;  3C1B A;  2PYO D;  3MGP C;  2YFW A;  1KX5 B;  5AV5 A;  1ID3 D;  3LZ1 A;  1S32 B;  4WU9 C;  4CSR A;  5AVC D;  3WA9 A;  1P3F B;  3MGR B;  3REI A;  5AV6 B;  3AZM D;  3X1V B;  1P3P B;  4J8X B;  4UPK A;  3AZH C;  3B0B A;  5GT0 C;  5BNX A;  5CP6 B;  5AV9 D;  3KXB D;  3LZ0 B;  3WTP E;  4KHA B;  5B1L C;  4M6B A;  5CPI B;  5AV5 D;  1P34 B;  2RVQ D;  1EQZ D;  5CPK B;  3REK C;  4KUD C;  4ZBJ C;  3MGQ D;  4J8U C;  3REI D;  1ZLA D;  4Z5T B;  3MGP A;  3AZL B;  4XUJ C;  3AN2 D;  5JA4 A;  5CHL B;  3LEL B;  3A1I A;  1M1A C;  3MNN D;  3MVD B;  5F99 B;  4WU9 A;  1P3I B;  3AYW C;  3WAA B;  5AVB C;  3KWQ C;  4H9Q A;  2Y2M A;  2HIO B;  3MGS C;  3AZH A;  4AWL C;  4H9S C;  4KGC B;  1TAF A;  1P3B C;  3UTB B;  3W98 D;  2Y2K A;  3VH5 T;  3B0C T;  4WU8 B;  3REK A;  5BS7 C;  5GT3 D;  5B1M C;  3O62 D;  4XUJ A;  5BO0 B;  2F8N B;  1KX5 D;  3WTP B;  3X1T C;  5BT1 C;  2CV5 B;  5B0Y C;  2NZD C;  4ZUX B;  2ARO B;  5AY8 C;  5B2I D;  3KWQ A;  3MGR D;  3MGS A;  1P3F D;  5AV6 D;  3X1V D;  1P3O A;  1BH8 A;  1P3P D;  1KX4 A;  1H3O A;  1ULY A;  1P3B A;  3AZF B;  1KX3 A;  5B32 B;  4R8P B;  3REL A;  2ZY5 A;  3H0L C;  3KUY C;  2BYK A;  2XD1 A;  2J8P A;  5CP6 D;  3LZ0 D;  2FJ7 B;  4J8V C;  1M19 C;  3UTA C;  5CPI D;  1P34 D;  1PZR A;  3AZK B;  2YFV A;  4Z66 A;  5AV8 A;  5CPK D;  1P3G B;  1P3O D;  4JJN B;  1HQ3 A;  4Z5T D;  3AZL D;  3A6N B;  3R45 B;  3W99 B;  4WJ3 C;  4WV4 B;  5FUG B;  3W96 A;  3REJ C;  5G49 B;  3AZI C;  5B0Y A;  4YS3 B;  3LJA B;  3AV1 C;  1P3I D;  1T3U A;  5AY8 A;  3IP4 C;  2ZY2 A;  5BNV B;  5CPJ B;  2BYM B;  4G92 B;  3X1U C;  3AV2 B;  2ZM5 A;  4Z66 D;  5AV8 D;  1P3M A;  4KGC D;  3KUY A;  1F66 A;  4J8V A;  1M19 A;  3UTA A;  5B40 B;  2JSS A;  3AZE A;  3C1B B;  4XZQ C;  4LD9 A;  3VH6 W;  2YFW B;  4H9R A;  5AV5 B;  3AZN A;  4YM6 D;  5E5A C;  3LZ1 B;  3REJ A;  3AZI A;  3WTP D;  2F8N D;  5DNN C;  3H0R C;  3AV1 A;  4CSR B;  3WA9 B;  2CV5 D;  5KDM A;  3REI B;  3EG5 B;  2ARO D;  2IO5 C;  2L5A A;  3X1U A;  1P3L C;  5C3I B;  3AZE D;  5BNX B;  5B32 D;  3AZF D;  4R8P D;  4LD9 D;  2FJ7 D;  3B6F C;  3AZN D;  3AZK D;  5AVC C;  5GSU C;  3AZM C;  4XZQ A;  1N1J A;  1P3G D;  4JJN D;  2NQB A;  2HUE C;  3A6N D;  5JA4 B;  5E5A A;  2RIQ A;  2W8S A;  3W99 D;  4WU9 B;  4YS3 D;  3LJA D;  4J8W A;  4H9Q B;  3O62 B;  3UT9 C;  3AZH B;  1EQZ C;  5CPJ D;  5GXQ C;  3AV2 D;  1U35 D;  3TU4 C;  3A1K A;  5B2I B;  2DF4 C;  2NQB D;  3B6G C;  5B40 D;  5B2J D;  3REK B;  3AZG C;  4ZBJ B;  5GSU A;  3X1S A;  3C1B D;  5B33 C;  4XUJ B;  3AFA C;  4E45 A;  3W98 C;  3W97 C;  2Y2Q A;  1WWI A;  4NE3 A;  3LZ1 D;  4HGA C;  3AZJ C;  3WA9 D;  3KWQ B;  1P3O B;  3UT9 A;  3MGS B;  4AWL B;  1BH8 B;  1KX4 B;  4H9P A;  3NQU A;  5GXQ A; 
#chains in the Genus database with same CATH homology
 1P3K C;  1KX3 B;  5GT3 C;  3TU4 A;  5DNM C;  3REL B;  1KU5 A;  1Q9C A;  2BYK B;  3X1S D;  2Y2I A;  5B31 C;  2Y2N A;  2F8N H;  3B6G A;  4H9O A;  2YFV B;  4Z66 B;  5AV8 B;  2Y2H A;  1S32 C;  3AZG A;  3FDD A;  5GT0 A;  3C1C C;  5JRG C;  5B33 A;  1HQ3 B;  5B1L A;  3MGP D;  4J8X C;  1B67 A;  3AFA A;  3W97 A;  3W96 B;  5B0Y B;  4WU9 D;  1B6W A;  5CP6 C;  3LZ0 C;  4KUD A;  5AY8 B;  4J8U A;  4NFT A;  2XD5 A;  2F8N G;  4NE6 A;  1P34 C;  4YM6 B;  3AZH D;  1P3K A;  5CPK C;  1P3M B;  1M1A A;  5DNM A;  5B24 C;  3B0D C;  5B0Z C;  5GT0 D;  3AYW A;  3REH C;  1F66 B;  5B31 A;  5AVB A;  4J8V B;  1M19 B;  2DQN C;  3LEL C;  4H9S A;  1M18 C;  3MVD C;  5F99 C;  3REK D;  3AZE B;  3WAA C;  3C1C A;  5JRG A;  4Z2M H;  4QLC C;  4LD9 B;  3EPL A;  4H9R B;  2HIO C;  3AZN B;  4XUJ D;  1M1A D;  4KGC C;  3UTB C;  3AV1 B;  5BS7 A;  4G91 B;  5KDM B;  1AOI C;  5B1M A;  3WKJ C;  3KWQ D;  3MGS D;  1KX4 D;  4WU8 C;  1P3B D;  5B24 A;  3X1T A;  5B0Z A;  1KX3 D;  3VH6 A;  2NZD A;  3REH A;  3REL D;  4Z2M G;  1M18 A;  1U35 B;  2CV5 C;  3WAA A;  4ZUX C;  4QLC A;  4XZQ B;  1N1J B;  2HIO A;  1HQ3 D;  2NQB B;  1BFM A;  5B2J B;  3KSY A;  3UTB A;  3W96 D;  1AOI A;  5B0Y D;  1TZY C;  3WKJ A;  4J8W B;  5AY8 D;  2IO5 B;  4X23 C;  1H3O B;  2F2A C;  4WU8 A;  1P3M D;  1P3A C;  3KUY D;  2BG1 A;  1F66 D;  4J8V D;  1M19 D;  3UTA D;  4YS3 C;  5GSU B;  3LJA C;  3X1S B;  2PYO C;  4EO5 B;  2HUE B;  4G92 C;  1R4V A;  1ID3 C;  3AZI D;  3REJ D;  3AV1 D;  1TZY A;  3UT9 B;  4UUZ A;  4X23 A;  3MGP B;  4H9P B;  3NQU B;  3X1U D;  3TU4 B;  5DNN A;  1P3A A;  5AV9 C;  3KXB C;  4CAY A;  3B6G B;  4H9O B;  5AV5 C;  4NE5 A;  2RVQ C;  1TAF B;  3AZG B;  1P3L A;  1P3A B;  1JFI A;  3WA9 C;  5GT0 B;  3MGQ C;  2PYO A;  3REI C;  5B33 B;  1ZLA C;  5B1L B;  4XZQ D;  3B6F A;  3AFA B;  3AN2 C;  1ID3 A;  3W97 B;  5E5A D;  3MNN C;  4HGA B;  5DNN D;  5AVC A;  3AL0 C;  4KUD B;  4J8U B;  3AZM A;  4J8W D;  2Y2O A;  1P3K B;  1M1A B;  5DNM B;  5AV9 A;  3KXB A;  4H9N A;  3AYW B;  5B31 B;  5AVB B;  3F6T A;  3B6F D;  4WZS B;  1EQZ A;  3EPK A;  3VH6 T;  3C1C B;  3MGQ A;  5GSU D;  5JRG B;  1ZLA A;  3NQJ A;  4E44 A;  3O62 C;  4DQY B;  3AN2 A;  2LY8 A;  3V9R A;  1KX5 C;  3MNN A;  2JE5 A;  5B1M B;  1P3F C;  5B2I C;  3MGR C;  3UT9 D;  5AV6 C;  3X1V C;  1P3P C;  5GXQ D;  3W98 A;  5B24 B;  3B0D B;  5B0Z B;  3X1T B;  2NZD B;  3TU4 D;  3REH B;  3AZJ A;  3B6G D;  5CPI C;  1M18 B;  4WNN A;  1BH9 A;  5GT3 A;  3AZG D;  4QLC B;  3KUY B;  2UWX A;  1P3O C;  3O62 A;  5B33 D;  4Z5T C;  3AZL C;  5B1L D;  3UTA B;  1KX4 C;  1KX5 A;  3AFA D;  3W97 D;  1KX3 C;  5B32 G;  1S32 A;  1AOI B;  3REL C;  3AZJ D;  1P3I C;  4DRA A;  3H0M C;  1P3F A;  5B2I A;  3MGR A;  3WKJ B;  4J8U D;  4KUD D;  3KFU G;  5AV6 A;  3X1V A;  1P3P A;  4J8X A;  1W2E A;  2VQR A;  2Y2G A;  5AV8 C;  4Z66 C;  3REJ B;  3AZI B;  1P3K D;  5DNM D;  5CP6 A;  3LZ0 A;  3AYW D;  1HQ3 C;  1HTA A;  4KHA A;  5B31 D;  5AVB D;  5CPI A;  1P34 A;  3X1U B;  3W96 C;  5CPK A;  1S32 D;  3C1C D;  1Z2C B;  2Y2L A;  5JRG D;  4Z5T A;  3AZL A;  3EPJ A;  4J8X D;  4YM6 C;  3LEL A;  3WTP C;  1P3M C;  3MVD A;  5F99 A;  1TZY B;  1P3I A;  2G5H C;  1F66 C;  5B1M D;  4UUZ B;  4X23 B;  2ARO C;  4DRB A;  1F1E A;  5E5A B;  4KGC A;  5DNN B;  5B24 D;  2ZY4 A;  3X1T D;  5B32 C;  5BT1 D;  4R8P C;  5B0Z D;  3AZE C;  2ZY3 A;  3REH D;  3AZF C;  2NZD D;  4LD9 C;  2FJ7 C;  1A7W A;  4CAY B;  3AZN C;  2JCH A;  3LEL D;  1M18 D;  3MVD D;  5F99 D;  3AZK C;  1P3L B;  1JFI B;  4G91 C;  3WAA D;  2PYO B;  4QLC D;  1P3G C;  4JJN C;  3B6F B;  2HIO D;  5BO0 A;  4YM6 A;  3A6N C;  1ID3 B;  2F8N A;  3WTP A;  3W99 C;  3UTB D;  5AVC B;  2CV5 A;  1AOI D;  2Y2J A;  4ZUX A;  3AZM B;  3WKJ D;  2ARO A;  3VH5 A;  5CPJ C;  4WU8 D;  3AV2 C;  1U35 C;  5AV9 B;  3KXB B;  4H9N B;  5B32 A;  4R8P A;  3AZF A;  2FJ7 A;  3P5J B;  2NQB C;  5B2J C;  5B40 C;  1EQZ B;  5GXQ B;  3AZK A;  3MGQ B;  2FFF B;  1ZLA B;  4ZUX D;  1WWS A;  4J8W C;  1P3G A;  3C1B C;  3NQJ B;  4JJN A;  3AN2 B;  3A6N A;  3R45 A;  3V9R B;  3MNN B;  3W99 A;  5FUG A;  3LZ1 C;  5G49 A;  4YS3 A;  3VH5 W;  3LJA A;  3B0C W;  1TZY D;  3EPH A;  4X23 D;  5BNV A;  5CPJ A;  2BYM A;  1U35 A;  3AV2 A;  3W98 B;  2F8N K;  2G5I C;  3AZJ B;  5C3I C;  3X1S C;  1P3A D;  4EO5 C;  5B40 A;  5B2J A;  4WNN B;  1BH9 B;  5GT3 B;  1P3L D;  2CWE A;  1P3B B;  5B31 G;  2Y2P A;  3C1B A;  2PYO D;  3MGP C;  2YFW A;  1KX5 B;  5AV5 A;  1ID3 D;  3LZ1 A;  1S32 B;  4WU9 C;  4CSR A;  5AVC D;  3WA9 A;  1P3F B;  3MGR B;  3REI A;  5AV6 B;  3AZM D;  3X1V B;  1P3P B;  4J8X B;  4UPK A;  3AZH C;  3B0B A;  5GT0 C;  5BNX A;  5CP6 B;  5AV9 D;  3KXB D;  3LZ0 B;  3WTP E;  4KHA B;  5B1L C;  4M6B A;  5CPI B;  5AV5 D;  1P34 B;  2RVQ D;  1EQZ D;  5CPK B;  3REK C;  4KUD C;  4ZBJ C;  3MGQ D;  4J8U C;  3REI D;  1ZLA D;  4Z5T B;  3MGP A;  3AZL B;  4XUJ C;  3AN2 D;  5JA4 A;  5CHL B;  3LEL B;  3A1I A;  1M1A C;  3MNN D;  3MVD B;  5F99 B;  4WU9 A;  1P3I B;  3AYW C;  3WAA B;  5AVB C;  3KWQ C;  4H9Q A;  2Y2M A;  2HIO B;  3MGS C;  3AZH A;  4AWL C;  4H9S C;  4KGC B;  1TAF A;  1P3B C;  3UTB B;  3W98 D;  2Y2K A;  3VH5 T;  3B0C T;  4WU8 B;  3REK A;  5BS7 C;  5GT3 D;  5B1M C;  3O62 D;  4XUJ A;  5BO0 B;  2F8N B;  1KX5 D;  3WTP B;  3X1T C;  5BT1 C;  2CV5 B;  5B0Y C;  2NZD C;  4ZUX B;  2ARO B;  5AY8 C;  5B2I D;  3KWQ A;  3MGR D;  3MGS A;  1P3F D;  5AV6 D;  3X1V D;  1P3O A;  1BH8 A;  1P3P D;  1KX4 A;  1H3O A;  1ULY A;  1P3B A;  3AZF B;  1KX3 A;  5B32 B;  4R8P B;  3REL A;  2ZY5 A;  3H0L C;  3KUY C;  2BYK A;  2XD1 A;  2J8P A;  5CP6 D;  3LZ0 D;  2FJ7 B;  4J8V C;  1M19 C;  3UTA C;  5CPI D;  1P34 D;  1PZR A;  3AZK B;  2YFV A;  4Z66 A;  5AV8 A;  5CPK D;  1P3G B;  1P3O D;  4JJN B;  1HQ3 A;  4Z5T D;  3AZL D;  3A6N B;  3R45 B;  3W99 B;  4WJ3 C;  4WV4 B;  5FUG B;  3W96 A;  3REJ C;  5G49 B;  3AZI C;  5B0Y A;  4YS3 B;  3LJA B;  3AV1 C;  1P3I D;  1T3U A;  5AY8 A;  3IP4 C;  2ZY2 A;  5BNV B;  5CPJ B;  2BYM B;  4G92 B;  3X1U C;  3AV2 B;  2ZM5 A;  4Z66 D;  5AV8 D;  1P3M A;  4KGC D;  3KUY A;  1F66 A;  4J8V A;  1M19 A;  3UTA A;  5B40 B;  2JSS A;  3AZE A;  3C1B B;  4XZQ C;  4LD9 A;  3VH6 W;  2YFW B;  4H9R A;  5AV5 B;  3AZN A;  4YM6 D;  5E5A C;  3LZ1 B;  3REJ A;  3AZI A;  3WTP D;  2F8N D;  5DNN C;  3H0R C;  3AV1 A;  4CSR B;  3WA9 B;  2CV5 D;  5KDM A;  3REI B;  3EG5 B;  2ARO D;  2IO5 C;  2L5A A;  3X1U A;  1P3L C;  5C3I B;  3AZE D;  5BNX B;  5B32 D;  3AZF D;  4R8P D;  4LD9 D;  2FJ7 D;  3B6F C;  3AZN D;  3AZK D;  5AVC C;  5GSU C;  3AZM C;  4XZQ A;  1N1J A;  1P3G D;  4JJN D;  2NQB A;  2HUE C;  3A6N D;  5JA4 B;  5E5A A;  2RIQ A;  2W8S A;  3W99 D;  4WU9 B;  4YS3 D;  3LJA D;  4J8W A;  4H9Q B;  3O62 B;  3UT9 C;  3AZH B;  1EQZ C;  5CPJ D;  5GXQ C;  3AV2 D;  1U35 D;  3TU4 C;  3A1K A;  5B2I B;  2DF4 C;  2NQB D;  3B6G C;  5B40 D;  5B2J D;  3REK B;  3AZG C;  4ZBJ B;  5GSU A;  3X1S A;  3C1B D;  5B33 C;  4XUJ B;  3AFA C;  4E45 A;  3W98 C;  3W97 C;  2Y2Q A;  1WWI A;  4NE3 A;  3LZ1 D;  4HGA C;  3AZJ C;  3WA9 D;  3KWQ B;  1P3O B;  3UT9 A;  3MGS B;  4AWL B;  1BH8 B;  1KX4 B;  4H9P A;  3NQU A;  5GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...