3AZMC

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmC00
3AZLD 1N1JA 3AZNC 5GT0A 3AZIA 3RELA 4H9RB 3AZJB 5B24D 2F8ND 5B2JC 4KHAB 3X1VB 1P3KC 1P3IC 4WU8C 4WU9B 3WAAA 3AZEB 1P34B 1TZYA 3VH5A 1EQZB 3A6NB 3X1SA 4XUJD 3AFAA 3NQUB 3X1TC 1F66B 2HIOA 3REHC 3LZ0B 4QLCD 5GXQA 2PYOB 3O62A 1ZLAB 4WZSB 4CSRA 3UTAD 1HQ3C 1M19A 5E5AC 1ID3C 3UT9A 5B32A 3AYWA 4KGCD 3AZGA 3REID 3KXBB 5B0ZC 5B32G 1P3BD 3C1CB 3AZMB 3KUYB 5AVCB 5CPJA 3R45A 1P3LC 5B2IC 2F8NK 3WAAD 3AZND 1TZYD 5DNNC 4AWLC 5BO0A 1AOIB 3B6FA 5JRGA 5B1LC 3AFAD 3VH6W 5G49B 5GT3A 5C3IB 1P3KD 1P3ID 5BNXB 3REJA 5DNMB 4J8WA 3O62D 2YFVB 4X23C 3B0DC 3X1VC 3W97C 1S32B 1HTAA 3AZFC 3X1TD 2NQBA 3AZGD 4Z66A 5BNVB 3A6NC 5BT1D 3AN2C 5CPIB 4H9RA 2BYMB 3AZJA 4KHAA 4YM6A 3B6GC 3LZ0C 5E5AD 5AV5C 5CPJD 3WTPE 4WU9A 5F99B 3AZEA 1P34A 1EQZA 3AV1A 5B0ZD 1F66A 3NQUA 4J8XB 2PYOA 5GT3D 1P3LD 5B2ID 1ZLAA 3REJD 3WTPB 2NZDB 4R8PC 3KUYC 1P3GB 5KDMB 5B1MC 3LZ1C 3NQJB 5B1LD 3KXBA 2NQBD 5AY8A 5CP6B 3B0CW 5B40A 3C1CA 4G92C 3AZMA 5AVCA 1N1JB 5BS7A 5C3IC 3X1VD 3W97D 5GT0B 4LD9B 5JA4B 3REKC 4WU9D 3AZIB 4WNNB 1ULYA 5DNMC 4HGAC 3VH5W 3AZED 1P34D 3VH6T 3AZHA 1EQZD 3A6ND 1AOIA 4Z5TB 1S32C 1F66D 3KWQA 3LZ0D 4EO5C 5BNXA 2PYOD 3W96C 2HIOB 3AZLC 1P3PB 5GXQB 5F99C 1JFIB 5B24C 3KXBD 5CPIA 4H9SC 3UT9B 5B32B 3AYWB 3C1CD 1KX5B 3AZMD 4J8XC 3KUYD 5B33B 5AVCD 5B1MD 4J8UB 3WA9A 4Z2MH 4XUJC 3X1UA 1AOID 3R45B 3UTAC 3MGQA 1U35B 3WTPA 3B6FB 5DNMD 2NZDA 4KUDC 5KDMA 4WV4B 1B6WA 1S32D 2L5AA 3RELC 4XZQA 4J8WB 3UTBB 5CP6A 4Z2MG 2CWEA 2HUEB 5AVBA 3W96D 5CPID 3MGRB 3WAAC 4H9QA 4Z66B 1TZYC 4LD9A 5JA4A 5F99D 4WNNA 3X1SC 3AFAC 1P3AB 2HIOC 4Z5TA 4YM6B 5GXQC 1R4VA 4NE6A 4J8XD 3O62C 3AV1B 1M19C 3UT9C 5B32C 3AYWC 3WTPD 3AZGC 1P3PA 1M1AB 2NZDD 3AZKA 1P3GD 5BT1C 3MVDB 1JFIA 5AV6B 5AV9B 5B31A 1P3MB 5CPJC 5CP6D 1KX3A 1KX5A 1P3FB 5B33A 5B31G 4KUDD 4J8UA 5AY8B 5GT0D 5B40B 4NFTA 3AZID 3RELD 3LJAB 1P3OB 3B6FC 5JRGC 3WKJB 5AV8A 3MNNB 5GT3C 3C1BB 3REJC 4H9OB 4J8WC 3AZHB 1U35A 3X1SD 3W99B 1KU5A 2NQBC 3KWQB 4UUZB 2HIOD 4Z66C 5CPKB 5GXQD 3AZJC 4J8VA 3MGSB 3UTBA 4YM6C 3MGRA 1BH9A 1M19D 4WU9C 3UT9D 5B32D 3AYWD 2FJ7B 3AZEC 1P34C 1KX5D 1EQZC 4M6BA 1F66C 1P3AA 3V9RA 2PYOC 3WA9B 3X1UB 1ZLAC 3AV2B 2AROB 1U35D 2CV5B 1M1AA 3B6FD 5JRGD 3KXBC 5DNNA 3MVDA 5AY8C 3MGQB 5AV6A 5B40C 1F1EA 4NE3A 5AV9A 3C1CC 4J8WD 3AZMC 2YFWB 1P3MA 5AVCC 3UTBD 3MGRD 4NE5A 3MGPA 1P3FA 4XZQB 4Z66D 3AZHC 5AVBB 1AOIC 1P3OA 1KX4B 3LJAA 3AZJD 3WKJA 1P3AD 4H9QB 4YM6D 3MNNA 3C1BA 4H9OA 3TU4A 3B6GA 5B0YA 3AV1D 2IO5B 3W99A 4UUZA 1M1AD 5CPKA 4QLCB 5CPIC 3MVDD 4JJNB 5AV6D 3MGSA 1ZLAD 1P3MD 3AZKB 5FUGB 2FJ7A 3LELB 3WA9C 4KGCB 3REIB 4R8PA 5B31B 5AY8D 1KX3B 5B40D 1P3OD 3LJAD 1M18B 2JSSA 3WKJD 1H3OB 3MNND 4DRAA 4ZUXB 3MGQC 3C1BD 3WTPC 3AV2A 2NZDC 5AV8B 2AROA 2LY8A 3AZHD 1P3GC 2CV5A 3W99D 3KWQD 4XZQC 5B2JB 5CPKD 5CP6C 3W98A 4WU8B 5GSUA 2YFWA 4YS3A 4H9NB 1TAFB 3B0CT 5GT0C 4LD9C 3AZIC 4DRBA 3X1TB 3AZLA 4J8VB 3REHB 4Z5TC 1KX4A 1BH9B 5CHLB 3VH5T 4H9PA 1HQ3B 1ID3B 3WA9D 2F8NG 3X1UD 3AV2D 1P3PC 3V9RB 2CV5D 4QLCA 5B31C 4JJNA 3MGQD 1KX3C 5B2IB 1BH8B 1KX5C 5FUGA 5B33C 5DNNB 3LELA 4J8UC 4KGCA 3REIA 4XZQD 5AV8C 5AVBD 1KX4D 1P3BA 1M18A 3MGPB 1H3OA 4ZUXA 2BYKB 3B0DB 4E44A 4X23B 1U35C 4G91B 3W97B 4LD9D 3AZFB 1WWIA 3AZNA 4Z5TD 4CAYA 3AN2B 3TU4B 5B2JA 4J8VC 3UTBC 5B0YB 1P3IA 2HUEC 5AV5B 4WU8A 1P3KA 3B6GB 3MGRC 4JJND 4H9NA 1P3PD 1TAFA 3AZKD 3LELD 3X1TA 4ZBJB 3REHA 1P3AC 5B31D 1KX3D 1M18D 4R8PB 1HQ3A 5B33D 5E5AA 3AV1C 1ID3A 4J8UD 5B1MB 3LZ1B 4ZUXD 4E45A 1M1AC 5B0ZA 5AV8D 3MVDC 5AV6C 4G92B 5AV9C 1P3MC 5B2JD 1P3LA 5B2IA 3REKB 1BH8A 4WU8D 4HGAB 3MGPC 1P3FC 3W98B 5B1LA 4G91C 1P3OC 5GSUB 3LJAC 4YS3B 3WKJC 4J8VD 3REHD 4EO5B 5BS7C 3MNNC 3C1BC 3W96B 3TU4C 3AZLB 2BYKA 4X23A 3W97A 1HQ3D 3B0BA 5B0YC 3X1VA 3AZFA 1ID3D 3W99C 2F8NB 5B24B 3KWQC 3A6NA 4H9PB 3AN2A 5CPKC 4ZBJC 3MGSC 3LZ0A 5AV5A 4XUJB 2FJ7C 1BFMA 5DNND 3KSYA 5AV9D 2RVQC 3UTAB 3X1UC 3MGPD 1P3FD 3KUYA 3AV2C 4KUDB 5B1MA 3LZ1A 2AROC 4X23D 2CV5C 3AZFD 1P3BB 3RELB 3AN2D 3W98C 5GSUC 3TU4D 3WAAB 5G49A 4YS3C 3B6GD 3AZNB 1TZYB 5B0YD 5AV5D 3REKA 4CAYB 3X1SB 5DNMA 2F8NH 3AFAB 3VH6A 2YFVA 1P3KB 1P3IB 5AVBC 1S32A 1KX4C 3MGSD 3O62B 5BNVA 4CSRB 3W96A 1M19B 2BYMA 2FJ7D 3AZGB 4R8PD 1A7WA 1WWSA 2IO5C 5F99A 3LZ1D 1B67A 5B24A 2F8NA 2RVQD 5E5AB 5CPJB 4H9SA 4QLCC 4JJNC 4J8XA 3AZKC 5B0ZB 2AROD 4XUJA 3LELC 3REKD 5BO0B 4KGCC 3REIC 5JRGB 1P3GA 5GT3B 1P3LB 3NQJA 3W98D 5GSUD 3REJB 1P3BC 1M18C 4YS3D 3UTAA 4AWLB 4ZUXC 1Q9CA 5B1LB 2NQBB 4KUDA
chains in the Genus database with same CATH superfamily
3AZLD 2ZY3A 1N1JA 3AZNC 5GT0A 3AZIA 3RELA 4H9RB 3AZJB 5B24D 2F8ND 5B2JC 4KHAB 3X1VB 1P3KC 1P3IC 4WU8C 4WU9B 3WAAA 3AZEB 1P34B 1TZYA 3VH5A 1EQZB 3A6NB 3X1SA 4XUJD 3AFAA 3NQUB 3X1TC 1F66B 2HIOA 3REHC 3LZ0B 4QLCD 5GXQA 2PYOB 3O62A 1ZLAB 4WZSB 4CSRA 3UTAD 1HQ3C 1M19A 5E5AC 1ID3C 3UT9A 5B32A 3AYWA 4KGCD 3AZGA 3REID 3KXBB 5B0ZC 5B32G 3IP4C 1P3BD 3C1CB 3AZMB 3KUYB 5AVCB 5CPJA 3R45A 1P3LC 5B2IC 2F8NK 3WAAD 3AZND 1TZYD 5DNNC 4AWLC 5BO0A 1AOIB 3B6FA 5JRGA 5B1LC 3AFAD 3VH6W 5G49B 5GT3A 5C3IB 1P3KD 1P3ID 1W2EA 5BNXB 3REJA 5DNMB 4J8WA 3O62D 2RIQA 2YFVB 4X23C 3B0DC 3X1VC 3W97C 1S32B 1HTAA 3AZFC 3X1TD 2NQBA 3AZGD 4Z66A 5BNVB 3A6NC 5BT1D 3AN2C 5CPIB 4H9RA 2BYMB 3AZJA 4KHAA 4YM6A 3B6GC 3LZ0C 5E5AD 5AV5C 5CPJD 3WTPE 4WU9A 5F99B 3AZEA 1P34A 1EQZA 3AV1A 5B0ZD 1F66A 3NQUA 4J8XB 2PYOA 5GT3D 1P3LD 1T3UA 5B2ID 2Y2OA 1ZLAA 3REJD 3WTPB 2NZDB 4R8PC 3KUYC 1P3GB 5KDMB 5B1MC 3LZ1C 3NQJB 5B1LD 3KXBA 2NQBD 5AY8A 5CP6B 3B0CW 5B40A 2Y2LA 3C1CA 4G92C 3AZMA 5AVCA 1N1JB 5BS7A 5C3IC 3X1VD 3W97D 5GT0B 4LD9B 5JA4B 3REKC 4WU9D 3AZIB 4WNNB 1ULYA 5DNMC 4HGAC 3VH5W 3AZED 1P34D 3VH6T 3AZHA 1EQZD 3A6ND 1AOIA 4Z5TB 1S32C 1F66D 3KWQA 3LZ0D 4EO5C 5BNXA 2PYOD 3W96C 2HIOB 3AZLC 1P3PB 5GXQB 5F99C 1JFIB 5B24C 3KXBD 2Y2HA 2ZM5A 5CPIA 4H9SC 3UT9B 5B32B 3AYWB 3C1CD 1KX5B 3AZMD 4J8XC 3KUYD 5B33B 5AVCD 5B1MD 4J8UB 3WA9A 4Z2MH 4XUJC 3X1UA 2BG1A 1AOID 3R45B 3UTAC 3KFUG 3MGQA 1U35B 2Y2JA 3WTPA 3B6FB 5DNMD 2NZDA 4KUDC 5KDMA 4WV4B 1B6WA 1S32D 2L5AA 3RELC 4XZQA 4J8WB 3UTBB 5CP6A 4Z2MG 2CWEA 2HUEB 5AVBA 3W96D 5CPID 3MGRB 2JE5A 3WAAC 4H9QA 4Z66B 1TZYC 4LD9A 5JA4A 3AL0C 5F99D 4WNNA 2Y2NA 3X1SC 3AFAC 1P3AB 2HIOC 4Z5TA 4YM6B 5GXQC 1R4VA 4NE6A 4J8XD 3O62C 3AV1B 1M19C 3EPLA 3UT9C 5B32C 3AYWC 3WTPD 3AZGC 1P3PA 1M1AB 2NZDD 2Y2MA 3AZKA 1P3GD 5BT1C 2G5IC 3MVDB 1JFIA 5AV6B 5AV9B 5B31A 1P3MB 5CPJC 5CP6D 1KX3A 1KX5A 1P3FB 5B33A 5B31G 4KUDD 4J8UA 5AY8B 5GT0D 5B40B 4NFTA 3AZID 3RELD 3LJAB 1P3OB 3B6FC 5JRGC 3WKJB 5AV8A 4UPKA 5GT3C 3MNNB 3C1BB 3REJC 4H9OB 4J8WC 3AZHB 1U35A 3X1SD 3W99B 1KU5A 2NQBC 3KWQB 4UUZB 2HIOD 4Z66C 2FFFB 5CPKB 2ZY2A 5GXQD 3AZJC 4J8VA 3MGSB 3UTBA 4YM6C 3MGRA 1BH9A 1M19D 2Y2IA 4WU9C 3UT9D 5B32D 3AYWD 2FJ7B 3AZEC 1P34C 1KX5D 1EQZC 4M6BA 1F66C 1P3AA 3V9RA 2PYOC 3WA9B 3X1UB 1ZLAC 3AV2B 2JCHA 2AROB 1U35D 2CV5B 2UWXA 1M1AA 3B6FD 5JRGD 3KXBC 5DNNA 3MVDA 5AY8C 3MGQB 5AV6A 5B40C 1F1EA 4NE3A 5AV9A 4WJ3C 3C1CC 4J8WD 3AZMC 2YFWB 1P3MA 5AVCC 3UTBD 3MGRD 4NE5A 3MGPA 1P3FA 4XZQB 4Z66D 3H0RC 3AZHC 5AVBB 1AOIC 1P3OA 1KX4B 3LJAA 3AZJD 3WKJA 1P3AD 4H9QB 4YM6D 3MNNA 3C1BA 4H9OA 3TU4A 3B6GA 5B0YA 3AV1D 2IO5B 3W99A 4UUZA 1M1AD 2Y2PA 5CPKA 4QLCB 5CPIC 3MVDD 4JJNB 3EPHA 5AV6D 3MGSA 1ZLAD 1P3MD 3AZKB 5FUGB 2FJ7A 3LELB 3WA9C 4KGCB 3REIB 4R8PA 5B31B 5AY8D 2ZY4A 1KX3B 5B40D 1P3OD 3LJAD 1M18B 2JSSA 3WKJD 1H3OB 3MNND 4DRAA 4ZUXB 3MGQC 3C1BD 3WTPC 3AV2A 2NZDC 5AV8B 2AROA 2LY8A 3AZHD 1P3GC 2CV5A 3W99D 3KWQD 4XZQC 5B2JB 5CPKD 5CP6C 3W98A 4WU8B 5GSUA 3H0MC 2YFWA 4YS3A 4H9NB 1TAFB 3A1KA 3B0CT 5GT0C 4LD9C 3AZIC 4DRBA 3X1TB 3AZLA 4J8VB 3REHB 4Z5TC 1KX4A 1BH9B 5CHLB 3VH5T 4H9PA 1HQ3B 1ID3B 3WA9D 2F8NG 2XD5A 3X1UD 1Z2CB 3AV2D 1P3PC 3V9RB 2VQRA 2CV5D 4QLCA 5B31C 4JJNA 3MGQD 1KX3C 5B2IB 1BH8B 1KX5C 5FUGA 5B33C 5DNNB 3LELA 3A1IA 4J8UC 4KGCA 3REIA 4XZQD 5AV8C 5AVBD 2J8PA 1KX4D 1P3BA 1M18A 3MGPB 1H3OA 4ZUXA 2BYKB 3B0DB 4E44A 4X23B 1U35C 4G91B 3W97B 4LD9D 3AZFB 1WWIA 3AZNA 4Z5TD 4CAYA 3AN2B 3TU4B 5B2JA 4J8VC 3UTBC 5B0YB 1P3IA 2HUEC 5AV5B 4WU8A 1P3KA 3B6GB 3MGRC 4JJND 4H9NA 1P3PD 1TAFA 3AZKD 3LELD 3X1TA 4ZBJB 3F6TA 3REHA 1P3AC 5B31D 1KX3D 1M18D 4R8PB 1HQ3A 5B33D 5E5AA 3AV1C 1ID3A 4J8UD 5B1MB 3LZ1B 4ZUXD 2G5HC 4E45A 1M1AC 5B0ZA 5AV8D 3MVDC 5AV6C 4G92B 4DQYB 5AV9C 2ZY5A 1P3MC 3H0LC 5B2JD 1P3LA 5B2IA 3REKB 1BH8A 4WU8D 4HGAB 3MGPC 1P3FC 3W98B 5B1LA 4G91C 1P3OC 5GSUB 3LJAC 2Y2KA 4YS3B 3WKJC 4J8VD 3REHD 2Y2GA 4EO5B 5BS7C 3MNNC 3C1BC 3W96B 3TU4C 3AZLB 2BYKA 4X23A 3W97A 1HQ3D 3B0BA 5B0YC 3X1VA 3AZFA 1ID3D 2F2AC 3W99C 2F8NB 5B24B 3KWQC 3A6NA 4H9PB 3AN2A 5CPKC 4ZBJC 3MGSC 3LZ0A 5AV5A 3EPKA 4XUJB 2FJ7C 1BFMA 5DNND 3KSYA 2XD1A 5AV9D 2RVQC 2DQNC 3UTAB 2W8SA 3X1UC 3MGPD 1P3FD 3KUYA 3AV2C 4KUDB 5B1MA 3LZ1A 2AROC 4X23D 2CV5C 3AZFD 1P3BB 3RELB 3AN2D 3W98C 5GSUC 3TU4D 3WAAB 5G49A 1PZRA 4YS3C 3B6GD 3AZNB 1TZYB 5B0YD 3EPJA 5AV5D 3REKA 4CAYB 3X1SB 5DNMA 2F8NH 2DF4C 3AFAB 3VH6A 2YFVA 1P3KB 1P3IB 5AVBC 1S32A 1KX4C 3MGSD 3O62B 5BNVA 3P5JB 3W96A 4CSRB 1M19B 2BYMA 2FJ7D 3AZGB 4R8PD 1A7WA 1WWSA 2IO5C 5F99A 3LZ1D 1B67A 5B24A 2F8NA 2RVQD 2Y2QA 5E5AB 5CPJB 4H9SA 4QLCC 4JJNC 4J8XA 3AZKC 5B0ZB 2AROD 4XUJA 3LELC 3REKD 5BO0B 4KGCC 3REIC 3FDDA 5JRGB 1P3GA 3EG5B 5GT3B 1P3LB 3NQJA 3W98D 5GSUD 3REJB 1P3BC 1M18C 4YS3D 3UTAA 4AWLB 4ZUXC 1Q9CA 5B1LB 2NQBB 4KUDA
chains in the Genus database with same CATH topology
3AZLD 2ZY3A 1N1JA 3AZNC 5GT0A 3AZIA 3RELA 4H9RB 3AZJB 5B24D 2F8ND 5B2JC 4KHAB 3X1VB 1P3KC 1P3IC 4WU8C 4WU9B 3WAAA 3AZEB 1P34B 1TZYA 3VH5A 1EQZB 3A6NB 3X1SA 4XUJD 3AFAA 3NQUB 3X1TC 1F66B 2HIOA 3REHC 3LZ0B 4QLCD 5GXQA 2PYOB 3O62A 1ZLAB 4WZSB 4CSRA 3UTAD 1HQ3C 1M19A 5E5AC 1ID3C 3UT9A 5B32A 3AYWA 4KGCD 3AZGA 3REID 3KXBB 5B0ZC 5B32G 3IP4C 1P3BD 3C1CB 3AZMB 3KUYB 5AVCB 5CPJA 3R45A 1P3LC 5B2IC 2F8NK 3WAAD 3AZND 1TZYD 5DNNC 4AWLC 5BO0A 1AOIB 3B6FA 5JRGA 5B1LC 3AFAD 3VH6W 5G49B 5GT3A 5C3IB 1P3KD 1P3ID 1W2EA 5BNXB 3REJA 5DNMB 4J8WA 3O62D 2RIQA 2YFVB 4X23C 3B0DC 3X1VC 3W97C 1S32B 1HTAA 3AZFC 3X1TD 2NQBA 3AZGD 4Z66A 5BNVB 3A6NC 5BT1D 3AN2C 5CPIB 4H9RA 2BYMB 3AZJA 4KHAA 4YM6A 3B6GC 3LZ0C 5E5AD 5AV5C 5CPJD 3WTPE 4WU9A 5F99B 3AZEA 1P34A 1EQZA 3AV1A 5B0ZD 1F66A 3NQUA 4J8XB 2PYOA 5GT3D 1P3LD 1T3UA 5B2ID 2Y2OA 1ZLAA 3REJD 3WTPB 2NZDB 4R8PC 3KUYC 1P3GB 5KDMB 5B1MC 3LZ1C 3NQJB 5B1LD 3KXBA 2NQBD 5AY8A 5CP6B 3B0CW 5B40A 2Y2LA 3C1CA 4G92C 3AZMA 5AVCA 1N1JB 5BS7A 5C3IC 3X1VD 3W97D 5GT0B 4LD9B 5JA4B 3REKC 4WU9D 3AZIB 4WNNB 1ULYA 5DNMC 4HGAC 3VH5W 3AZED 1P34D 3VH6T 3AZHA 1EQZD 3A6ND 1AOIA 4Z5TB 1S32C 1F66D 3KWQA 3LZ0D 4EO5C 5BNXA 2PYOD 3W96C 2HIOB 3AZLC 1P3PB 5GXQB 5F99C 1JFIB 5B24C 3KXBD 2Y2HA 2ZM5A 5CPIA 4H9SC 3UT9B 5B32B 3AYWB 3C1CD 1KX5B 3AZMD 4J8XC 3KUYD 5B33B 5AVCD 5B1MD 4J8UB 3WA9A 4Z2MH 4XUJC 3X1UA 2BG1A 1AOID 3R45B 3UTAC 3KFUG 3MGQA 1U35B 2Y2JA 3WTPA 3B6FB 5DNMD 2NZDA 4KUDC 5KDMA 4WV4B 1B6WA 1S32D 2L5AA 3RELC 4XZQA 4J8WB 3UTBB 5CP6A 4Z2MG 2CWEA 2HUEB 5AVBA 3W96D 5CPID 3MGRB 2JE5A 3WAAC 4H9QA 4Z66B 1TZYC 4LD9A 5JA4A 3AL0C 5F99D 4WNNA 2Y2NA 3X1SC 3AFAC 1P3AB 2HIOC 4Z5TA 4YM6B 5GXQC 1R4VA 4NE6A 4J8XD 3O62C 3AV1B 1M19C 3EPLA 3UT9C 5B32C 3AYWC 3WTPD 3AZGC 1P3PA 1M1AB 2NZDD 2Y2MA 3AZKA 1P3GD 5BT1C 2G5IC 3MVDB 1JFIA 5AV6B 5AV9B 5B31A 1P3MB 5CPJC 5CP6D 1KX3A 1KX5A 1P3FB 5B33A 5B31G 4KUDD 4J8UA 5AY8B 5GT0D 5B40B 4NFTA 3AZID 3RELD 3LJAB 1P3OB 3B6FC 5JRGC 3WKJB 5AV8A 4UPKA 5GT3C 3MNNB 3C1BB 3REJC 4H9OB 4J8WC 3AZHB 1U35A 3X1SD 3W99B 1KU5A 2NQBC 3KWQB 4UUZB 2HIOD 4Z66C 2FFFB 5CPKB 2ZY2A 5GXQD 3AZJC 4J8VA 3MGSB 3UTBA 4YM6C 3MGRA 1BH9A 1M19D 2Y2IA 4WU9C 3UT9D 5B32D 3AYWD 2FJ7B 3AZEC 1P34C 1KX5D 1EQZC 4M6BA 1F66C 1P3AA 3V9RA 2PYOC 3WA9B 3X1UB 1ZLAC 3AV2B 2JCHA 2AROB 1U35D 2CV5B 2UWXA 1M1AA 3B6FD 5JRGD 3KXBC 5DNNA 3MVDA 5AY8C 3MGQB 5AV6A 5B40C 1F1EA 4NE3A 5AV9A 4WJ3C 3C1CC 4J8WD 3AZMC 2YFWB 1P3MA 5AVCC 3UTBD 3MGRD 4NE5A 3MGPA 1P3FA 4XZQB 4Z66D 3H0RC 3AZHC 5AVBB 1AOIC 1P3OA 1KX4B 3LJAA 3AZJD 3WKJA 1P3AD 4H9QB 4YM6D 3MNNA 3C1BA 4H9OA 3TU4A 3B6GA 5B0YA 3AV1D 2IO5B 3W99A 4UUZA 1M1AD 2Y2PA 5CPKA 4QLCB 5CPIC 3MVDD 4JJNB 3EPHA 5AV6D 3MGSA 1ZLAD 1P3MD 3AZKB 5FUGB 2FJ7A 3LELB 3WA9C 4KGCB 3REIB 4R8PA 5B31B 5AY8D 2ZY4A 1KX3B 5B40D 1P3OD 3LJAD 1M18B 2JSSA 3WKJD 1H3OB 3MNND 4DRAA 4ZUXB 3MGQC 3C1BD 3WTPC 3AV2A 2NZDC 5AV8B 2AROA 2LY8A 3AZHD 1P3GC 2CV5A 3W99D 3KWQD 4XZQC 5B2JB 5CPKD 5CP6C 3W98A 4WU8B 5GSUA 3H0MC 2YFWA 4YS3A 4H9NB 1TAFB 3A1KA 3B0CT 5GT0C 4LD9C 3AZIC 4DRBA 3X1TB 3AZLA 4J8VB 3REHB 4Z5TC 1KX4A 1BH9B 5CHLB 3VH5T 4H9PA 1HQ3B 1ID3B 3WA9D 2F8NG 2XD5A 3X1UD 1Z2CB 3AV2D 1P3PC 3V9RB 2VQRA 2CV5D 4QLCA 5B31C 4JJNA 3MGQD 1KX3C 5B2IB 1BH8B 1KX5C 5FUGA 5B33C 5DNNB 3LELA 3A1IA 4J8UC 4KGCA 3REIA 4XZQD 5AV8C 5AVBD 2J8PA 1KX4D 1P3BA 1M18A 3MGPB 1H3OA 4ZUXA 2BYKB 3B0DB 4E44A 4X23B 1U35C 4G91B 3W97B 4LD9D 3AZFB 1WWIA 3AZNA 4Z5TD 4CAYA 3AN2B 3TU4B 5B2JA 4J8VC 3UTBC 5B0YB 1P3IA 2HUEC 5AV5B 4WU8A 1P3KA 3B6GB 3MGRC 4JJND 4H9NA 1P3PD 1TAFA 3AZKD 3LELD 3X1TA 4ZBJB 3F6TA 3REHA 1P3AC 5B31D 1KX3D 1M18D 4R8PB 1HQ3A 5B33D 5E5AA 3AV1C 1ID3A 4J8UD 5B1MB 3LZ1B 4ZUXD 2G5HC 4E45A 1M1AC 5B0ZA 5AV8D 3MVDC 5AV6C 4G92B 4DQYB 5AV9C 2ZY5A 1P3MC 3H0LC 5B2JD 1P3LA 5B2IA 3REKB 1BH8A 4WU8D 4HGAB 3MGPC 1P3FC 3W98B 5B1LA 4G91C 1P3OC 5GSUB 3LJAC 2Y2KA 4YS3B 3WKJC 4J8VD 3REHD 2Y2GA 4EO5B 5BS7C 3MNNC 3C1BC 3W96B 3TU4C 3AZLB 2BYKA 4X23A 3W97A 1HQ3D 3B0BA 5B0YC 3X1VA 3AZFA 1ID3D 2F2AC 3W99C 2F8NB 5B24B 3KWQC 3A6NA 4H9PB 3AN2A 5CPKC 4ZBJC 3MGSC 3LZ0A 5AV5A 3EPKA 4XUJB 2FJ7C 1BFMA 5DNND 3KSYA 2XD1A 5AV9D 2RVQC 2DQNC 3UTAB 2W8SA 3X1UC 3MGPD 1P3FD 3KUYA 3AV2C 4KUDB 5B1MA 3LZ1A 2AROC 4X23D 2CV5C 3AZFD 1P3BB 3RELB 3AN2D 3W98C 5GSUC 3TU4D 3WAAB 5G49A 1PZRA 4YS3C 3B6GD 3AZNB 1TZYB 5B0YD 3EPJA 5AV5D 3REKA 4CAYB 3X1SB 5DNMA 2F8NH 2DF4C 3AFAB 3VH6A 2YFVA 1P3KB 1P3IB 5AVBC 1S32A 1KX4C 3MGSD 3O62B 5BNVA 3P5JB 3W96A 4CSRB 1M19B 2BYMA 2FJ7D 3AZGB 4R8PD 1A7WA 1WWSA 2IO5C 5F99A 3LZ1D 1B67A 5B24A 2F8NA 2RVQD 2Y2QA 5E5AB 5CPJB 4H9SA 4QLCC 4JJNC 4J8XA 3AZKC 5B0ZB 2AROD 4XUJA 3LELC 3REKD 5BO0B 4KGCC 3REIC 3FDDA 5JRGB 1P3GA 3EG5B 5GT3B 1P3LB 3NQJA 3W98D 5GSUD 3REJB 1P3BC 1M18C 4YS3D 3UTAA 4AWLB 4ZUXC 1Q9CA 5B1LB 2NQBB 4KUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL D;  1N1J A;  3AZN C;  5GT0 A;  3AZI A;  3REL A;  4H9R B;  3AZJ B;  5B24 D;  2F8N D;  5B2J C;  4KHA B;  3X1V B;  1P3K C;  1P3I C;  4WU8 C;  4WU9 B;  3WAA A;  3AZE B;  1P34 B;  1TZY A;  3VH5 A;  1EQZ B;  3A6N B;  3X1S A;  4XUJ D;  3AFA A;  3NQU B;  3X1T C;  1F66 B;  2HIO A;  3REH C;  3LZ0 B;  4QLC D;  5GXQ A;  2PYO B;  3O62 A;  1ZLA B;  4WZS B;  4CSR A;  3UTA D;  1HQ3 C;  1M19 A;  5E5A C;  1ID3 C;  3UT9 A;  5B32 A;  3AYW A;  4KGC D;  3AZG A;  3REI D;  3KXB B;  5B0Z C;  5B32 G;  1P3B D;  3C1C B;  3AZM B;  3KUY B;  5AVC B;  5CPJ A;  3R45 A;  1P3L C;  5B2I C;  2F8N K;  3WAA D;  3AZN D;  1TZY D;  5DNN C;  4AWL C;  5BO0 A;  1AOI B;  3B6F A;  5JRG A;  5B1L C;  3AFA D;  3VH6 W;  5G49 B;  5GT3 A;  5C3I B;  1P3K D;  1P3I D;  5BNX B;  3REJ A;  5DNM B;  4J8W A;  3O62 D;  2YFV B;  4X23 C;  3B0D C;  3X1V C;  3W97 C;  1S32 B;  1HTA A;  3AZF C;  3X1T D;  2NQB A;  3AZG D;  4Z66 A;  5BNV B;  3A6N C;  5BT1 D;  3AN2 C;  5CPI B;  4H9R A;  2BYM B;  3AZJ A;  4KHA A;  4YM6 A;  3B6G C;  3LZ0 C;  5E5A D;  5AV5 C;  5CPJ D;  3WTP E;  4WU9 A;  5F99 B;  3AZE A;  1P34 A;  1EQZ A;  3AV1 A;  5B0Z D;  1F66 A;  3NQU A;  4J8X B;  2PYO A;  5GT3 D;  1P3L D;  5B2I D;  1ZLA A;  3REJ D;  3WTP B;  2NZD B;  4R8P C;  3KUY C;  1P3G B;  5KDM B;  5B1M C;  3LZ1 C;  3NQJ B;  5B1L D;  3KXB A;  2NQB D;  5AY8 A;  5CP6 B;  3B0C W;  5B40 A;  3C1C A;  4G92 C;  3AZM A;  5AVC A;  1N1J B;  5BS7 A;  5C3I C;  3X1V D;  3W97 D;  5GT0 B;  4LD9 B;  5JA4 B;  3REK C;  4WU9 D;  3AZI B;  4WNN B;  1ULY A;  5DNM C;  4HGA C;  3VH5 W;  3AZE D;  1P34 D;  3VH6 T;  3AZH A;  1EQZ D;  3A6N D;  1AOI A;  4Z5T B;  1S32 C;  1F66 D;  3KWQ A;  3LZ0 D;  4EO5 C;  5BNX A;  2PYO D;  3W96 C;  2HIO B;  3AZL C;  1P3P B;  5GXQ B;  5F99 C;  1JFI B;  5B24 C;  3KXB D;  5CPI A;  4H9S C;  3UT9 B;  5B32 B;  3AYW B;  3C1C D;  1KX5 B;  3AZM D;  4J8X C;  3KUY D;  5B33 B;  5AVC D;  5B1M D;  4J8U B;  3WA9 A;  4Z2M H;  4XUJ C;  3X1U A;  1AOI D;  3R45 B;  3UTA C;  3MGQ A;  1U35 B;  3WTP A;  3B6F B;  5DNM D;  2NZD A;  4KUD C;  5KDM A;  4WV4 B;  1B6W A;  1S32 D;  2L5A A;  3REL C;  4XZQ A;  4J8W B;  3UTB B;  5CP6 A;  4Z2M G;  2CWE A;  2HUE B;  5AVB A;  3W96 D;  5CPI D;  3MGR B;  3WAA C;  4H9Q A;  4Z66 B;  1TZY C;  4LD9 A;  5JA4 A;  5F99 D;  4WNN A;  3X1S C;  3AFA C;  1P3A B;  2HIO C;  4Z5T A;  4YM6 B;  5GXQ C;  1R4V A;  4NE6 A;  4J8X D;  3O62 C;  3AV1 B;  1M19 C;  3UT9 C;  5B32 C;  3AYW C;  3WTP D;  3AZG C;  1P3P A;  1M1A B;  2NZD D;  3AZK A;  1P3G D;  5BT1 C;  3MVD B;  1JFI A;  5AV6 B;  5AV9 B;  5B31 A;  1P3M B;  5CPJ C;  5CP6 D;  1KX3 A;  1KX5 A;  1P3F B;  5B33 A;  5B31 G;  4KUD D;  4J8U A;  5AY8 B;  5GT0 D;  5B40 B;  4NFT A;  3AZI D;  3REL D;  3LJA B;  1P3O B;  3B6F C;  5JRG C;  3WKJ B;  5AV8 A;  3MNN B;  5GT3 C;  3C1B B;  3REJ C;  4H9O B;  4J8W C;  3AZH B;  1U35 A;  3X1S D;  3W99 B;  1KU5 A;  2NQB C;  3KWQ B;  4UUZ B;  2HIO D;  4Z66 C;  5CPK B;  5GXQ D;  3AZJ C;  4J8V A;  3MGS B;  3UTB A;  4YM6 C;  3MGR A;  1BH9 A;  1M19 D;  4WU9 C;  3UT9 D;  5B32 D;  3AYW D;  2FJ7 B;  3AZE C;  1P34 C;  1KX5 D;  1EQZ C;  4M6B A;  1F66 C;  1P3A A;  3V9R A;  2PYO C;  3WA9 B;  3X1U B;  1ZLA C;  3AV2 B;  2ARO B;  1U35 D;  2CV5 B;  1M1A A;  3B6F D;  5JRG D;  3KXB C;  5DNN A;  3MVD A;  5AY8 C;  3MGQ B;  5AV6 A;  5B40 C;  1F1E A;  4NE3 A;  5AV9 A;  3C1C C;  4J8W D;  3AZM C;  2YFW B;  1P3M A;  5AVC C;  3UTB D;  3MGR D;  4NE5 A;  3MGP A;  1P3F A;  4XZQ B;  4Z66 D;  3AZH C;  5AVB B;  1AOI C;  1P3O A;  1KX4 B;  3LJA A;  3AZJ D;  3WKJ A;  1P3A D;  4H9Q B;  4YM6 D;  3MNN A;  3C1B A;  4H9O A;  3TU4 A;  3B6G A;  5B0Y A;  3AV1 D;  2IO5 B;  3W99 A;  4UUZ A;  1M1A D;  5CPK A;  4QLC B;  5CPI C;  3MVD D;  4JJN B;  5AV6 D;  3MGS A;  1ZLA D;  1P3M D;  3AZK B;  5FUG B;  2FJ7 A;  3LEL B;  3WA9 C;  4KGC B;  3REI B;  4R8P A;  5B31 B;  5AY8 D;  1KX3 B;  5B40 D;  1P3O D;  3LJA D;  1M18 B;  2JSS A;  3WKJ D;  1H3O B;  3MNN D;  4DRA A;  4ZUX B;  3MGQ C;  3C1B D;  3WTP C;  3AV2 A;  2NZD C;  5AV8 B;  2ARO A;  2LY8 A;  3AZH D;  1P3G C;  2CV5 A;  3W99 D;  3KWQ D;  4XZQ C;  5B2J B;  5CPK D;  5CP6 C;  3W98 A;  4WU8 B;  5GSU A;  2YFW A;  4YS3 A;  4H9N B;  1TAF B;  3B0C T;  5GT0 C;  4LD9 C;  3AZI C;  4DRB A;  3X1T B;  3AZL A;  4J8V B;  3REH B;  4Z5T C;  1KX4 A;  1BH9 B;  5CHL B;  3VH5 T;  4H9P A;  1HQ3 B;  1ID3 B;  3WA9 D;  2F8N G;  3X1U D;  3AV2 D;  1P3P C;  3V9R B;  2CV5 D;  4QLC A;  5B31 C;  4JJN A;  3MGQ D;  1KX3 C;  5B2I B;  1BH8 B;  1KX5 C;  5FUG A;  5B33 C;  5DNN B;  3LEL A;  4J8U C;  4KGC A;  3REI A;  4XZQ D;  5AV8 C;  5AVB D;  1KX4 D;  1P3B A;  1M18 A;  3MGP B;  1H3O A;  4ZUX A;  2BYK B;  3B0D B;  4E44 A;  4X23 B;  1U35 C;  4G91 B;  3W97 B;  4LD9 D;  3AZF B;  1WWI A;  3AZN A;  4Z5T D;  4CAY A;  3AN2 B;  3TU4 B;  5B2J A;  4J8V C;  3UTB C;  5B0Y B;  1P3I A;  2HUE C;  5AV5 B;  4WU8 A;  1P3K A;  3B6G B;  3MGR C;  4JJN D;  4H9N A;  1P3P D;  1TAF A;  3AZK D;  3LEL D;  3X1T A;  4ZBJ B;  3REH A;  1P3A C;  5B31 D;  1KX3 D;  1M18 D;  4R8P B;  1HQ3 A;  5B33 D;  5E5A A;  3AV1 C;  1ID3 A;  4J8U D;  5B1M B;  3LZ1 B;  4ZUX D;  4E45 A;  1M1A C;  5B0Z A;  5AV8 D;  3MVD C;  5AV6 C;  4G92 B;  5AV9 C;  1P3M C;  5B2J D;  1P3L A;  5B2I A;  3REK B;  1BH8 A;  4WU8 D;  4HGA B;  3MGP C;  1P3F C;  3W98 B;  5B1L A;  4G91 C;  1P3O C;  5GSU B;  3LJA C;  4YS3 B;  3WKJ C;  4J8V D;  3REH D;  4EO5 B;  5BS7 C;  3MNN C;  3C1B C;  3W96 B;  3TU4 C;  3AZL B;  2BYK A;  4X23 A;  3W97 A;  1HQ3 D;  3B0B A;  5B0Y C;  3X1V A;  3AZF A;  1ID3 D;  3W99 C;  2F8N B;  5B24 B;  3KWQ C;  3A6N A;  4H9P B;  3AN2 A;  5CPK C;  4ZBJ C;  3MGS C;  3LZ0 A;  5AV5 A;  4XUJ B;  2FJ7 C;  1BFM A;  5DNN D;  3KSY A;  5AV9 D;  2RVQ C;  3UTA B;  3X1U C;  3MGP D;  1P3F D;  3KUY A;  3AV2 C;  4KUD B;  5B1M A;  3LZ1 A;  2ARO C;  4X23 D;  2CV5 C;  3AZF D;  1P3B B;  3REL B;  3AN2 D;  3W98 C;  5GSU C;  3TU4 D;  3WAA B;  5G49 A;  4YS3 C;  3B6G D;  3AZN B;  1TZY B;  5B0Y D;  5AV5 D;  3REK A;  4CAY B;  3X1S B;  5DNM A;  2F8N H;  3AFA B;  3VH6 A;  2YFV A;  1P3K B;  1P3I B;  5AVB C;  1S32 A;  1KX4 C;  3MGS D;  3O62 B;  5BNV A;  4CSR B;  3W96 A;  1M19 B;  2BYM A;  2FJ7 D;  3AZG B;  4R8P D;  1A7W A;  1WWS A;  2IO5 C;  5F99 A;  3LZ1 D;  1B67 A;  5B24 A;  2F8N A;  2RVQ D;  5E5A B;  5CPJ B;  4H9S A;  4QLC C;  4JJN C;  4J8X A;  3AZK C;  5B0Z B;  2ARO D;  4XUJ A;  3LEL C;  3REK D;  5BO0 B;  4KGC C;  3REI C;  5JRG B;  1P3G A;  5GT3 B;  1P3L B;  3NQJ A;  3W98 D;  5GSU D;  3REJ B;  1P3B C;  1M18 C;  4YS3 D;  3UTA A;  4AWL B;  4ZUX C;  1Q9C A;  5B1L B;  2NQB B;  4KUD A; 
#chains in the Genus database with same CATH topology
 3AZL D;  2ZY3 A;  1N1J A;  3AZN C;  5GT0 A;  3AZI A;  3REL A;  4H9R B;  3AZJ B;  5B24 D;  2F8N D;  5B2J C;  4KHA B;  3X1V B;  1P3K C;  1P3I C;  4WU8 C;  4WU9 B;  3WAA A;  3AZE B;  1P34 B;  1TZY A;  3VH5 A;  1EQZ B;  3A6N B;  3X1S A;  4XUJ D;  3AFA A;  3NQU B;  3X1T C;  1F66 B;  2HIO A;  3REH C;  3LZ0 B;  4QLC D;  5GXQ A;  2PYO B;  3O62 A;  1ZLA B;  4WZS B;  4CSR A;  3UTA D;  1HQ3 C;  1M19 A;  5E5A C;  1ID3 C;  3UT9 A;  5B32 A;  3AYW A;  4KGC D;  3AZG A;  3REI D;  3KXB B;  5B0Z C;  5B32 G;  3IP4 C;  1P3B D;  3C1C B;  3AZM B;  3KUY B;  5AVC B;  5CPJ A;  3R45 A;  1P3L C;  5B2I C;  2F8N K;  3WAA D;  3AZN D;  1TZY D;  5DNN C;  4AWL C;  5BO0 A;  1AOI B;  3B6F A;  5JRG A;  5B1L C;  3AFA D;  3VH6 W;  5G49 B;  5GT3 A;  5C3I B;  1P3K D;  1P3I D;  1W2E A;  5BNX B;  3REJ A;  5DNM B;  4J8W A;  3O62 D;  2RIQ A;  2YFV B;  4X23 C;  3B0D C;  3X1V C;  3W97 C;  1S32 B;  1HTA A;  3AZF C;  3X1T D;  2NQB A;  3AZG D;  4Z66 A;  5BNV B;  3A6N C;  5BT1 D;  3AN2 C;  5CPI B;  4H9R A;  2BYM B;  3AZJ A;  4KHA A;  4YM6 A;  3B6G C;  3LZ0 C;  5E5A D;  5AV5 C;  5CPJ D;  3WTP E;  4WU9 A;  5F99 B;  3AZE A;  1P34 A;  1EQZ A;  3AV1 A;  5B0Z D;  1F66 A;  3NQU A;  4J8X B;  2PYO A;  5GT3 D;  1P3L D;  1T3U A;  5B2I D;  2Y2O A;  1ZLA A;  3REJ D;  3WTP B;  2NZD B;  4R8P C;  3KUY C;  1P3G B;  5KDM B;  5B1M C;  3LZ1 C;  3NQJ B;  5B1L D;  3KXB A;  2NQB D;  5AY8 A;  5CP6 B;  3B0C W;  5B40 A;  2Y2L A;  3C1C A;  4G92 C;  3AZM A;  5AVC A;  1N1J B;  5BS7 A;  5C3I C;  3X1V D;  3W97 D;  5GT0 B;  4LD9 B;  5JA4 B;  3REK C;  4WU9 D;  3AZI B;  4WNN B;  1ULY A;  5DNM C;  4HGA C;  3VH5 W;  3AZE D;  1P34 D;  3VH6 T;  3AZH A;  1EQZ D;  3A6N D;  1AOI A;  4Z5T B;  1S32 C;  1F66 D;  3KWQ A;  3LZ0 D;  4EO5 C;  5BNX A;  2PYO D;  3W96 C;  2HIO B;  3AZL C;  1P3P B;  5GXQ B;  5F99 C;  1JFI B;  5B24 C;  3KXB D;  2Y2H A;  2ZM5 A;  5CPI A;  4H9S C;  3UT9 B;  5B32 B;  3AYW B;  3C1C D;  1KX5 B;  3AZM D;  4J8X C;  3KUY D;  5B33 B;  5AVC D;  5B1M D;  4J8U B;  3WA9 A;  4Z2M H;  4XUJ C;  3X1U A;  2BG1 A;  1AOI D;  3R45 B;  3UTA C;  3KFU G;  3MGQ A;  1U35 B;  2Y2J A;  3WTP A;  3B6F B;  5DNM D;  2NZD A;  4KUD C;  5KDM A;  4WV4 B;  1B6W A;  1S32 D;  2L5A A;  3REL C;  4XZQ A;  4J8W B;  3UTB B;  5CP6 A;  4Z2M G;  2CWE A;  2HUE B;  5AVB A;  3W96 D;  5CPI D;  3MGR B;  2JE5 A;  3WAA C;  4H9Q A;  4Z66 B;  1TZY C;  4LD9 A;  5JA4 A;  3AL0 C;  5F99 D;  4WNN A;  2Y2N A;  3X1S C;  3AFA C;  1P3A B;  2HIO C;  4Z5T A;  4YM6 B;  5GXQ C;  1R4V A;  4NE6 A;  4J8X D;  3O62 C;  3AV1 B;  1M19 C;  3EPL A;  3UT9 C;  5B32 C;  3AYW C;  3WTP D;  3AZG C;  1P3P A;  1M1A B;  2NZD D;  2Y2M A;  3AZK A;  1P3G D;  5BT1 C;  2G5I C;  3MVD B;  1JFI A;  5AV6 B;  5AV9 B;  5B31 A;  1P3M B;  5CPJ C;  5CP6 D;  1KX3 A;  1KX5 A;  1P3F B;  5B33 A;  5B31 G;  4KUD D;  4J8U A;  5AY8 B;  5GT0 D;  5B40 B;  4NFT A;  3AZI D;  3REL D;  3LJA B;  1P3O B;  3B6F C;  5JRG C;  3WKJ B;  5AV8 A;  4UPK A;  5GT3 C;  3MNN B;  3C1B B;  3REJ C;  4H9O B;  4J8W C;  3AZH B;  1U35 A;  3X1S D;  3W99 B;  1KU5 A;  2NQB C;  3KWQ B;  4UUZ B;  2HIO D;  4Z66 C;  2FFF B;  5CPK B;  2ZY2 A;  5GXQ D;  3AZJ C;  4J8V A;  3MGS B;  3UTB A;  4YM6 C;  3MGR A;  1BH9 A;  1M19 D;  2Y2I A;  4WU9 C;  3UT9 D;  5B32 D;  3AYW D;  2FJ7 B;  3AZE C;  1P34 C;  1KX5 D;  1EQZ C;  4M6B A;  1F66 C;  1P3A A;  3V9R A;  2PYO C;  3WA9 B;  3X1U B;  1ZLA C;  3AV2 B;  2JCH A;  2ARO B;  1U35 D;  2CV5 B;  2UWX A;  1M1A A;  3B6F D;  5JRG D;  3KXB C;  5DNN A;  3MVD A;  5AY8 C;  3MGQ B;  5AV6 A;  5B40 C;  1F1E A;  4NE3 A;  5AV9 A;  4WJ3 C;  3C1C C;  4J8W D;  3AZM C;  2YFW B;  1P3M A;  5AVC C;  3UTB D;  3MGR D;  4NE5 A;  3MGP A;  1P3F A;  4XZQ B;  4Z66 D;  3H0R C;  3AZH C;  5AVB B;  1AOI C;  1P3O A;  1KX4 B;  3LJA A;  3AZJ D;  3WKJ A;  1P3A D;  4H9Q B;  4YM6 D;  3MNN A;  3C1B A;  4H9O A;  3TU4 A;  3B6G A;  5B0Y A;  3AV1 D;  2IO5 B;  3W99 A;  4UUZ A;  1M1A D;  2Y2P A;  5CPK A;  4QLC B;  5CPI C;  3MVD D;  4JJN B;  3EPH A;  5AV6 D;  3MGS A;  1ZLA D;  1P3M D;  3AZK B;  5FUG B;  2FJ7 A;  3LEL B;  3WA9 C;  4KGC B;  3REI B;  4R8P A;  5B31 B;  5AY8 D;  2ZY4 A;  1KX3 B;  5B40 D;  1P3O D;  3LJA D;  1M18 B;  2JSS A;  3WKJ D;  1H3O B;  3MNN D;  4DRA A;  4ZUX B;  3MGQ C;  3C1B D;  3WTP C;  3AV2 A;  2NZD C;  5AV8 B;  2ARO A;  2LY8 A;  3AZH D;  1P3G C;  2CV5 A;  3W99 D;  3KWQ D;  4XZQ C;  5B2J B;  5CPK D;  5CP6 C;  3W98 A;  4WU8 B;  5GSU A;  3H0M C;  2YFW A;  4YS3 A;  4H9N B;  1TAF B;  3A1K A;  3B0C T;  5GT0 C;  4LD9 C;  3AZI C;  4DRB A;  3X1T B;  3AZL A;  4J8V B;  3REH B;  4Z5T C;  1KX4 A;  1BH9 B;  5CHL B;  3VH5 T;  4H9P A;  1HQ3 B;  1ID3 B;  3WA9 D;  2F8N G;  2XD5 A;  3X1U D;  1Z2C B;  3AV2 D;  1P3P C;  3V9R B;  2VQR A;  2CV5 D;  4QLC A;  5B31 C;  4JJN A;  3MGQ D;  1KX3 C;  5B2I B;  1BH8 B;  1KX5 C;  5FUG A;  5B33 C;  5DNN B;  3LEL A;  3A1I A;  4J8U C;  4KGC A;  3REI A;  4XZQ D;  5AV8 C;  5AVB D;  2J8P A;  1KX4 D;  1P3B A;  1M18 A;  3MGP B;  1H3O A;  4ZUX A;  2BYK B;  3B0D B;  4E44 A;  4X23 B;  1U35 C;  4G91 B;  3W97 B;  4LD9 D;  3AZF B;  1WWI A;  3AZN A;  4Z5T D;  4CAY A;  3AN2 B;  3TU4 B;  5B2J A;  4J8V C;  3UTB C;  5B0Y B;  1P3I A;  2HUE C;  5AV5 B;  4WU8 A;  1P3K A;  3B6G B;  3MGR C;  4JJN D;  4H9N A;  1P3P D;  1TAF A;  3AZK D;  3LEL D;  3X1T A;  4ZBJ B;  3F6T A;  3REH A;  1P3A C;  5B31 D;  1KX3 D;  1M18 D;  4R8P B;  1HQ3 A;  5B33 D;  5E5A A;  3AV1 C;  1ID3 A;  4J8U D;  5B1M B;  3LZ1 B;  4ZUX D;  2G5H C;  4E45 A;  1M1A C;  5B0Z A;  5AV8 D;  3MVD C;  5AV6 C;  4G92 B;  4DQY B;  5AV9 C;  2ZY5 A;  1P3M C;  3H0L C;  5B2J D;  1P3L A;  5B2I A;  3REK B;  1BH8 A;  4WU8 D;  4HGA B;  3MGP C;  1P3F C;  3W98 B;  5B1L A;  4G91 C;  1P3O C;  5GSU B;  3LJA C;  2Y2K A;  4YS3 B;  3WKJ C;  4J8V D;  3REH D;  2Y2G A;  4EO5 B;  5BS7 C;  3MNN C;  3C1B C;  3W96 B;  3TU4 C;  3AZL B;  2BYK A;  4X23 A;  3W97 A;  1HQ3 D;  3B0B A;  5B0Y C;  3X1V A;  3AZF A;  1ID3 D;  2F2A C;  3W99 C;  2F8N B;  5B24 B;  3KWQ C;  3A6N A;  4H9P B;  3AN2 A;  5CPK C;  4ZBJ C;  3MGS C;  3LZ0 A;  5AV5 A;  3EPK A;  4XUJ B;  2FJ7 C;  1BFM A;  5DNN D;  3KSY A;  2XD1 A;  5AV9 D;  2RVQ C;  2DQN C;  3UTA B;  2W8S A;  3X1U C;  3MGP D;  1P3F D;  3KUY A;  3AV2 C;  4KUD B;  5B1M A;  3LZ1 A;  2ARO C;  4X23 D;  2CV5 C;  3AZF D;  1P3B B;  3REL B;  3AN2 D;  3W98 C;  5GSU C;  3TU4 D;  3WAA B;  5G49 A;  1PZR A;  4YS3 C;  3B6G D;  3AZN B;  1TZY B;  5B0Y D;  3EPJ A;  5AV5 D;  3REK A;  4CAY B;  3X1S B;  5DNM A;  2F8N H;  2DF4 C;  3AFA B;  3VH6 A;  2YFV A;  1P3K B;  1P3I B;  5AVB C;  1S32 A;  1KX4 C;  3MGS D;  3O62 B;  5BNV A;  3P5J B;  3W96 A;  4CSR B;  1M19 B;  2BYM A;  2FJ7 D;  3AZG B;  4R8P D;  1A7W A;  1WWS A;  2IO5 C;  5F99 A;  3LZ1 D;  1B67 A;  5B24 A;  2F8N A;  2RVQ D;  2Y2Q A;  5E5A B;  5CPJ B;  4H9S A;  4QLC C;  4JJN C;  4J8X A;  3AZK C;  5B0Z B;  2ARO D;  4XUJ A;  3LEL C;  3REK D;  5BO0 B;  4KGC C;  3REI C;  3FDD A;  5JRG B;  1P3G A;  3EG5 B;  5GT3 B;  1P3L B;  3NQJ A;  3W98 D;  5GSU D;  3REJ B;  1P3B C;  1M18 C;  4YS3 D;  3UTA A;  4AWL B;  4ZUX C;  1Q9C A;  5B1L B;  2NQB B;  4KUD A; 
#chains in the Genus database with same CATH homology
 3AZL D;  2ZY3 A;  1N1J A;  3AZN C;  5GT0 A;  3AZI A;  3REL A;  4H9R B;  3AZJ B;  5B24 D;  2F8N D;  5B2J C;  4KHA B;  3X1V B;  1P3K C;  1P3I C;  4WU8 C;  4WU9 B;  3WAA A;  3AZE B;  1P34 B;  1TZY A;  3VH5 A;  1EQZ B;  3A6N B;  3X1S A;  4XUJ D;  3AFA A;  3NQU B;  3X1T C;  1F66 B;  2HIO A;  3REH C;  3LZ0 B;  4QLC D;  5GXQ A;  2PYO B;  3O62 A;  1ZLA B;  4WZS B;  4CSR A;  3UTA D;  1HQ3 C;  1M19 A;  5E5A C;  1ID3 C;  3UT9 A;  5B32 A;  3AYW A;  4KGC D;  3AZG A;  3REI D;  3KXB B;  5B0Z C;  5B32 G;  3IP4 C;  1P3B D;  3C1C B;  3AZM B;  3KUY B;  5AVC B;  5CPJ A;  3R45 A;  1P3L C;  5B2I C;  2F8N K;  3WAA D;  3AZN D;  1TZY D;  5DNN C;  4AWL C;  5BO0 A;  1AOI B;  3B6F A;  5JRG A;  5B1L C;  3AFA D;  3VH6 W;  5G49 B;  5GT3 A;  5C3I B;  1P3K D;  1P3I D;  1W2E A;  5BNX B;  3REJ A;  5DNM B;  4J8W A;  3O62 D;  2RIQ A;  2YFV B;  4X23 C;  3B0D C;  3X1V C;  3W97 C;  1S32 B;  1HTA A;  3AZF C;  3X1T D;  2NQB A;  3AZG D;  4Z66 A;  5BNV B;  3A6N C;  5BT1 D;  3AN2 C;  5CPI B;  4H9R A;  2BYM B;  3AZJ A;  4KHA A;  4YM6 A;  3B6G C;  3LZ0 C;  5E5A D;  5AV5 C;  5CPJ D;  3WTP E;  4WU9 A;  5F99 B;  3AZE A;  1P34 A;  1EQZ A;  3AV1 A;  5B0Z D;  1F66 A;  3NQU A;  4J8X B;  2PYO A;  5GT3 D;  1P3L D;  1T3U A;  5B2I D;  2Y2O A;  1ZLA A;  3REJ D;  3WTP B;  2NZD B;  4R8P C;  3KUY C;  1P3G B;  5KDM B;  5B1M C;  3LZ1 C;  3NQJ B;  5B1L D;  3KXB A;  2NQB D;  5AY8 A;  5CP6 B;  3B0C W;  5B40 A;  2Y2L A;  3C1C A;  4G92 C;  3AZM A;  5AVC A;  1N1J B;  5BS7 A;  5C3I C;  3X1V D;  3W97 D;  5GT0 B;  4LD9 B;  5JA4 B;  3REK C;  4WU9 D;  3AZI B;  4WNN B;  1ULY A;  5DNM C;  4HGA C;  3VH5 W;  3AZE D;  1P34 D;  3VH6 T;  3AZH A;  1EQZ D;  3A6N D;  1AOI A;  4Z5T B;  1S32 C;  1F66 D;  3KWQ A;  3LZ0 D;  4EO5 C;  5BNX A;  2PYO D;  3W96 C;  2HIO B;  3AZL C;  1P3P B;  5GXQ B;  5F99 C;  1JFI B;  5B24 C;  3KXB D;  2Y2H A;  2ZM5 A;  5CPI A;  4H9S C;  3UT9 B;  5B32 B;  3AYW B;  3C1C D;  1KX5 B;  3AZM D;  4J8X C;  3KUY D;  5B33 B;  5AVC D;  5B1M D;  4J8U B;  3WA9 A;  4Z2M H;  4XUJ C;  3X1U A;  2BG1 A;  1AOI D;  3R45 B;  3UTA C;  3KFU G;  3MGQ A;  1U35 B;  2Y2J A;  3WTP A;  3B6F B;  5DNM D;  2NZD A;  4KUD C;  5KDM A;  4WV4 B;  1B6W A;  1S32 D;  2L5A A;  3REL C;  4XZQ A;  4J8W B;  3UTB B;  5CP6 A;  4Z2M G;  2CWE A;  2HUE B;  5AVB A;  3W96 D;  5CPI D;  3MGR B;  2JE5 A;  3WAA C;  4H9Q A;  4Z66 B;  1TZY C;  4LD9 A;  5JA4 A;  3AL0 C;  5F99 D;  4WNN A;  2Y2N A;  3X1S C;  3AFA C;  1P3A B;  2HIO C;  4Z5T A;  4YM6 B;  5GXQ C;  1R4V A;  4NE6 A;  4J8X D;  3O62 C;  3AV1 B;  1M19 C;  3EPL A;  3UT9 C;  5B32 C;  3AYW C;  3WTP D;  3AZG C;  1P3P A;  1M1A B;  2NZD D;  2Y2M A;  3AZK A;  1P3G D;  5BT1 C;  2G5I C;  3MVD B;  1JFI A;  5AV6 B;  5AV9 B;  5B31 A;  1P3M B;  5CPJ C;  5CP6 D;  1KX3 A;  1KX5 A;  1P3F B;  5B33 A;  5B31 G;  4KUD D;  4J8U A;  5AY8 B;  5GT0 D;  5B40 B;  4NFT A;  3AZI D;  3REL D;  3LJA B;  1P3O B;  3B6F C;  5JRG C;  3WKJ B;  5AV8 A;  4UPK A;  5GT3 C;  3MNN B;  3C1B B;  3REJ C;  4H9O B;  4J8W C;  3AZH B;  1U35 A;  3X1S D;  3W99 B;  1KU5 A;  2NQB C;  3KWQ B;  4UUZ B;  2HIO D;  4Z66 C;  2FFF B;  5CPK B;  2ZY2 A;  5GXQ D;  3AZJ C;  4J8V A;  3MGS B;  3UTB A;  4YM6 C;  3MGR A;  1BH9 A;  1M19 D;  2Y2I A;  4WU9 C;  3UT9 D;  5B32 D;  3AYW D;  2FJ7 B;  3AZE C;  1P34 C;  1KX5 D;  1EQZ C;  4M6B A;  1F66 C;  1P3A A;  3V9R A;  2PYO C;  3WA9 B;  3X1U B;  1ZLA C;  3AV2 B;  2JCH A;  2ARO B;  1U35 D;  2CV5 B;  2UWX A;  1M1A A;  3B6F D;  5JRG D;  3KXB C;  5DNN A;  3MVD A;  5AY8 C;  3MGQ B;  5AV6 A;  5B40 C;  1F1E A;  4NE3 A;  5AV9 A;  4WJ3 C;  3C1C C;  4J8W D;  3AZM C;  2YFW B;  1P3M A;  5AVC C;  3UTB D;  3MGR D;  4NE5 A;  3MGP A;  1P3F A;  4XZQ B;  4Z66 D;  3H0R C;  3AZH C;  5AVB B;  1AOI C;  1P3O A;  1KX4 B;  3LJA A;  3AZJ D;  3WKJ A;  1P3A D;  4H9Q B;  4YM6 D;  3MNN A;  3C1B A;  4H9O A;  3TU4 A;  3B6G A;  5B0Y A;  3AV1 D;  2IO5 B;  3W99 A;  4UUZ A;  1M1A D;  2Y2P A;  5CPK A;  4QLC B;  5CPI C;  3MVD D;  4JJN B;  3EPH A;  5AV6 D;  3MGS A;  1ZLA D;  1P3M D;  3AZK B;  5FUG B;  2FJ7 A;  3LEL B;  3WA9 C;  4KGC B;  3REI B;  4R8P A;  5B31 B;  5AY8 D;  2ZY4 A;  1KX3 B;  5B40 D;  1P3O D;  3LJA D;  1M18 B;  2JSS A;  3WKJ D;  1H3O B;  3MNN D;  4DRA A;  4ZUX B;  3MGQ C;  3C1B D;  3WTP C;  3AV2 A;  2NZD C;  5AV8 B;  2ARO A;  2LY8 A;  3AZH D;  1P3G C;  2CV5 A;  3W99 D;  3KWQ D;  4XZQ C;  5B2J B;  5CPK D;  5CP6 C;  3W98 A;  4WU8 B;  5GSU A;  3H0M C;  2YFW A;  4YS3 A;  4H9N B;  1TAF B;  3A1K A;  3B0C T;  5GT0 C;  4LD9 C;  3AZI C;  4DRB A;  3X1T B;  3AZL A;  4J8V B;  3REH B;  4Z5T C;  1KX4 A;  1BH9 B;  5CHL B;  3VH5 T;  4H9P A;  1HQ3 B;  1ID3 B;  3WA9 D;  2F8N G;  2XD5 A;  3X1U D;  1Z2C B;  3AV2 D;  1P3P C;  3V9R B;  2VQR A;  2CV5 D;  4QLC A;  5B31 C;  4JJN A;  3MGQ D;  1KX3 C;  5B2I B;  1BH8 B;  1KX5 C;  5FUG A;  5B33 C;  5DNN B;  3LEL A;  3A1I A;  4J8U C;  4KGC A;  3REI A;  4XZQ D;  5AV8 C;  5AVB D;  2J8P A;  1KX4 D;  1P3B A;  1M18 A;  3MGP B;  1H3O A;  4ZUX A;  2BYK B;  3B0D B;  4E44 A;  4X23 B;  1U35 C;  4G91 B;  3W97 B;  4LD9 D;  3AZF B;  1WWI A;  3AZN A;  4Z5T D;  4CAY A;  3AN2 B;  3TU4 B;  5B2J A;  4J8V C;  3UTB C;  5B0Y B;  1P3I A;  2HUE C;  5AV5 B;  4WU8 A;  1P3K A;  3B6G B;  3MGR C;  4JJN D;  4H9N A;  1P3P D;  1TAF A;  3AZK D;  3LEL D;  3X1T A;  4ZBJ B;  3F6T A;  3REH A;  1P3A C;  5B31 D;  1KX3 D;  1M18 D;  4R8P B;  1HQ3 A;  5B33 D;  5E5A A;  3AV1 C;  1ID3 A;  4J8U D;  5B1M B;  3LZ1 B;  4ZUX D;  2G5H C;  4E45 A;  1M1A C;  5B0Z A;  5AV8 D;  3MVD C;  5AV6 C;  4G92 B;  4DQY B;  5AV9 C;  2ZY5 A;  1P3M C;  3H0L C;  5B2J D;  1P3L A;  5B2I A;  3REK B;  1BH8 A;  4WU8 D;  4HGA B;  3MGP C;  1P3F C;  3W98 B;  5B1L A;  4G91 C;  1P3O C;  5GSU B;  3LJA C;  2Y2K A;  4YS3 B;  3WKJ C;  4J8V D;  3REH D;  2Y2G A;  4EO5 B;  5BS7 C;  3MNN C;  3C1B C;  3W96 B;  3TU4 C;  3AZL B;  2BYK A;  4X23 A;  3W97 A;  1HQ3 D;  3B0B A;  5B0Y C;  3X1V A;  3AZF A;  1ID3 D;  2F2A C;  3W99 C;  2F8N B;  5B24 B;  3KWQ C;  3A6N A;  4H9P B;  3AN2 A;  5CPK C;  4ZBJ C;  3MGS C;  3LZ0 A;  5AV5 A;  3EPK A;  4XUJ B;  2FJ7 C;  1BFM A;  5DNN D;  3KSY A;  2XD1 A;  5AV9 D;  2RVQ C;  2DQN C;  3UTA B;  2W8S A;  3X1U C;  3MGP D;  1P3F D;  3KUY A;  3AV2 C;  4KUD B;  5B1M A;  3LZ1 A;  2ARO C;  4X23 D;  2CV5 C;  3AZF D;  1P3B B;  3REL B;  3AN2 D;  3W98 C;  5GSU C;  3TU4 D;  3WAA B;  5G49 A;  1PZR A;  4YS3 C;  3B6G D;  3AZN B;  1TZY B;  5B0Y D;  3EPJ A;  5AV5 D;  3REK A;  4CAY B;  3X1S B;  5DNM A;  2F8N H;  2DF4 C;  3AFA B;  3VH6 A;  2YFV A;  1P3K B;  1P3I B;  5AVB C;  1S32 A;  1KX4 C;  3MGS D;  3O62 B;  5BNV A;  3P5J B;  3W96 A;  4CSR B;  1M19 B;  2BYM A;  2FJ7 D;  3AZG B;  4R8P D;  1A7W A;  1WWS A;  2IO5 C;  5F99 A;  3LZ1 D;  1B67 A;  5B24 A;  2F8N A;  2RVQ D;  2Y2Q A;  5E5A B;  5CPJ B;  4H9S A;  4QLC C;  4JJN C;  4J8X A;  3AZK C;  5B0Z B;  2ARO D;  4XUJ A;  3LEL C;  3REK D;  5BO0 B;  4KGC C;  3REI C;  3FDD A;  5JRG B;  1P3G A;  3EG5 B;  5GT3 B;  1P3L B;  3NQJ A;  3W98 D;  5GSU D;  3REJ B;  1P3B C;  1M18 C;  4YS3 D;  3UTA A;  4AWL B;  4ZUX C;  1Q9C A;  5B1L B;  2NQB B;  4KUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...