1P3AD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 91
sequence length 91
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aD00
3REHA 3REJC 1KX3B 2AROD 2RVQD 5B31G 2PYOA 3AN2A 4KUDB 3MGSB 4WU9A 3LELB 3LZ0A 5B2ID 5F99D 3LZ1A 2NZDB 2BYMA 1Q9CA 5B0YB 3AZKB 4CSRB 4QLCB 5AV8D 4R8PD 1P3LB 1P34A 3C1CC 4JJND 1M19B 5B2JA 2F8NK 3AZLB 5B24B 1ZLAD 1KX5B 3W99A 3VH5A 3AFAA 3AZJD 1F66C 4E44A 5DNNA 3AYWB 3AZHD 5DNMA 3REKA 3AV2C 4YS3D 5CHLB 1ID3B 4ZUXC 3KXBD 1B6WA 1TZYD 1WWIA 3AV1B 5B1LD 3X1SB 4YM6A 3AZFB 3KWQB 5KDMB 3X1UB 1P3BD 1P3OC 3AZNB 3B6GA 3VH5T 5B0ZD 1P3FB 4G91C 3WA9A 5AVBC 5AV6B 3REJA 1B67A 4G92C 4J8VC 4E45A 3MVDB 5JA4A 1P3IB 1P3GD 5B1MC 4J8XB 5CPKB 1TAFB 5BS7C 5E5AC 3VH5W 4WU8C 4HGAC 3MGQB 1F1EA 5AVCB 1P3KB 4ZBJB 5GSUD 4H9QB 3B6FD 1BH9B 2AROC 5BNVA 1F66A 3X1TD 5FUGA 3MGPB 2NQBA 3AZED 5AY8B 4ZUXA 5B2IC 2IO5C 5F99C 3AZID 5GXQD 5GT3D 4R8PC 3W97B 5C3IC 2F8NB 1BH8B 5AVBA 5B33B 1ZLAC 3TU4B 2BYKB 3AZJC 3A6NB 3AZHC 5B1MA 2FJ7B 1HQ3D 4H9PB 3C1CD 1S32D 5B31B 5BS7A 5B40D 5AV6C 4X23D 5E5AA 5CPJD 4WU8A 5B32B 1P3MD 1TZYC 4DRAA 3REKB 4H9OA 5B1LC 1P3PA 3WAAB 4LD9B 3MNND 5CPID 1P3BC 3KUYB 5B0ZC 5AV9D 3C1BD 5G49A 2CV5B 3RELD 2AROA 4NE6A 3WKJD 3X1VB 1P3GC 4H9RB 1KX4D 5JRGB 5B2IA 1P3OD 5F99A 4WNNB 4AWLB 3B0CT 5AV8A 1M18D 1N1JB 4R8PA 1M1AB 3B0DC 4J8VD 4JJNA 2HIOC 3B0BA 5GSUC 3B6FC 4Z66B 1ZLAA 1KX3D 1AOIB 2F8NG 3AZJA 3X1TC 3AZHA 3AZEC 4YS3A 4KUDD 3MGSD 3KXBA 2NZDD 1TZYA 3AZIC 5B0YD 3AZKD 5B1LA 5GXQC 4QLCD 5GT3C 1EQZB 4KGCC 5GT0B 3NQJB 3A6NC 4XUJB 3LJAB 1M19D 1P3BA 5B31C 5B0ZA 5B32G 3AZLD 5B24D 4UUZB 1KX5D 4J8UB 1P3GA 3AYWD 1H3OB 3AZMB 1HQ3C 1S32C 3VH6A 4X23C 5B40C 4XZQB 1ID3D 5CPJC 3AV1D 1P3MC 2F8NH 1R4VA 5AV5B 3X1SD 3AZFD 3KWQD 5CPIC 2YFVA 3MNNC 2HUEB 5GSUA 3X1UD 3B6FA 3O62B 3AZND 5AV9C 3C1BC 1P3FD 5AV6D 3RELC 1M1AC 3AZGB 5CP6B 1P3AB 3X1TA 3MVDD 3VH6T 4KHAB 1P3ID 3AZEA 3WKJC 1KX4C 4Z66C 4J8XD 3REIB 5CPKD 3AZIA 4EO5C 3W96B 4Z5TB 5GXQA 5GT3A 1M18C 3MGQD 3MGRB 5AVCD 3UTBB 1P3KD 5BT1D 1JFIA 3W98B 3VH6W 3V9RA 3WTPB 1EQZC 1KX3C 4CAYB 3MGPD 1HQ3A 3C1CA 1S32A 4KUDC 2HIOD 5AY8D 5B40A 4X23A 3MGSC 3UTAB 3LELC 5CPJA 4H9NA 1BFMA 2NZDC 1P3MA 5B0YC 4J8WB 3AZKC 4QLCC 3UT9B 3W97D 1P3LC 3MNNA 5CPIA 2F8ND 1U35B 5BNXB 1ULYA 1M19C 3AV2A 5AV9A 3C1BA 3REHB 4XZQC 3RELA 3AZLC 2YFWA 5B24C 5B33D 1KX5C 2PYOB 3AN2B 2CWEA 3TU4D 3WKJA 4WU9B 4KGCD 1KX4A 3A6ND 3AYWC 3O62C 3LZ0B 2FJ7D 3LZ1B 2BYMB 1P3OA 5BO0A 5B31D 1ID3C 1M18A 5B32D 5CP6C 3NQUA 1P34B 3R45A 3AV1C 3WAAD 4J8VA 5B2JB 3X1SC 4LD9D 3AZFC 3KWQC 4M6BA 4DRBA 3X1UC 3KUYD 3AZNC 3W96C 3W99B 3WTPE 1P3FC 2CV5D 1KX3A 3AFAB 5DNNB 3KSYA 5DNMB 4WZSB 3MVDC 1P3IC 3X1VD 4KUDA 3MGSA 5JRGD 4J8XC 5CPKC 2NZDA 5B0YA 3WTPC 3AZKA 4CSRA 4YM6B 4QLCA 1M1AD 3MGQC 3B6GB 5AVCC 1M19A 3WA9B 1P3KC 5BT1C 4ZBJC 3REJB 3AZLA 5B24A 4Z66D 1KX5A 5JA4B 1AOID 3UT9C 3AYWA 3MGPC 5AY8C 1ID3A 3AV1A 3X1SA 1EQZD 1HTAA 2JSSA 3AZFA 5GT0D 3W97C 3KWQA 4XUJD 3LZ0C 5KDMA 3LJAD 3X1UA 3AZNA 1P3FA 5AV6A 1A7WA 5BNVB 1F66B 3LELD 5B33C 5FUGB 3AV2B 2NQBB 3MVDA 4J8UD 3TU4C 1P3IA 1P3LD 2FJ7C 4ZUXB 3AZMD 5CPKA 1TAFA 4XZQD 4Z2MH 5B32C 3MGQA 4NFTA 5DNNC 3WAAC 3REKC 5AV5D 5AVCA 4LD9C 1P3KA 4G91B 5AVBB 4H9QA 4G92B 3O62D 3KUYC 1BH9A 4NE5A 2CV5C 3AZGD 5CP6D 1P3AD 5B1MB 3MGPA 3X1VC 2HIOA 5AY8A 5E5AB 4WU8B 1WWSA 5JRGC 4HGAB 3REID 4H9OB 1P3PB 3W96D 4Z5TD 4AWLC 3W97A 3MGRD 2F8NA 3UTBD 3W98D 1BH8A 5G49B 2AROB 5B33A 3WTPD 1AOIC 3TU4A 2BYKA 4KGCA 3A6NA 2FJ7A 5B2IB 4H9PA 2IO5B 5F99B 3WA9C 5B31A 5AV8B 3UTAD 4R8PB 5B32A 4NE3A 3WAAA 5C3IB 4J8WD 2NQBC 4JJNB 4LD9A 3UT9D 5GT0C 4XUJC 3LJAC 1U35D 3KUYA 1ZLAB 3REHD 2CV5A 3AZJB 3AZHB 2PYOD 3AN2D 4J8UC 4YS3B 3X1VA 4WU9D 4H9RA 3LZ0D 5JRGA 3KXBB 3AZMC 3LZ1D 1TZYB 4WNNA 5B1LB 1N1JA 1P34D 1M1AA 1P3BB 5AV5C 5B2JD 5B0ZB 2HUEC 4Z66A 3W99D 1P3PC 3AFAD 1AOIA 3AZGC 2L5AA 1P3GB 1P3AC 5DNND 5DNMD 3REKD 2RVQC 3B0DB 3REIC 4Z5TC 4YM6D 2HIOB 1EQZA 5GT0A 2YFVB 3NQJA 3MGRC 5GSUB 4XUJA 3LJAA 3B6FB 3UTBC 3B6GD 3WA9D 3W98C 5AV8C 3REJD 3LELA 4UUZA 3X1TB 4JJNC 4J8UA 3AZEB 1P3LA 1H3OA 3AZMA 3AZIB 4H9SC 5GXQB 5GT3B 4XZQA 3UTAC 4WV4B 4KGCB 4J8WC 4Z2MG 5AV5A 4YS3C 1JFIB 3KXBC 1U35C 3O62A 3REHC 3V9RB 3AZGA 1F66D 5CP6A 1P3AA 3AV2D 1HQ3B 3C1CB 1S32B 3AN2C 2NQBD 4KHAA 2PYOC 5B40B 4X23B 4WU9C 5CPJB 4H9NB 4ZUXD 3LZ1C 1P3MB 3REIA 3W96A 4Z5TA 3MNNB 3MGRA 5CPIB 1P34C 2LY8A 3UTBA 5B2JC 5AV9B 3C1BB 3W98A 5AVBD 3RELB 2YFWB 3W99C 4J8XA 3WTPA 3AFAC 3WKJB 4CAYA 1KX4B 5B1MD 5DNMC 1P3OB 5BO0B 4EO5B 4H9SA 5E5AD 1KU5A 4WU8D 3UTAA 1M18B 3NQUB 3R45B 3B0CW 1P3PD 4J8WA 4J8VB 4YM6C 3UT9A 3B6GC 1U35A 5BNXA
chains in the Genus database with same CATH superfamily
3REHA 3REJC 1KX3B 2AROD 2RVQD 5B31G 2ZY2A 2PYOA 3AN2A 4KUDB 3MGSB 4WU9A 3LELB 3LZ0A 5B2ID 5F99D 3LZ1A 2NZDB 2BYMA 1Q9CA 5B0YB 3AZKB 4CSRB 4QLCB 5AV8D 4R8PD 1P3LB 1P34A 3C1CC 4JJND 1M19B 5B2JA 3H0MC 2F8NK 3AZLB 2W8SA 5B24B 1ZLAD 1KX5B 3W99A 3VH5A 3AFAA 3AZJD 1F66C 4E44A 5DNNA 3AYWB 3AZHD 5DNMA 3REKA 3AV2C 4YS3D 5CHLB 2JE5A 1ID3B 4ZUXC 3KXBD 1B6WA 1TZYD 1WWIA 3AV1B 5B1LD 3X1SB 4YM6A 3AZFB 3KWQB 5KDMB 3X1UB 1P3BD 1P3OC 3AZNB 3B6GA 3VH5T 5B0ZD 1P3FB 4G91C 3WA9A 5AVBC 5AV6B 3REJA 1B67A 4G92C 4J8VC 4E45A 3MVDB 5JA4A 1P3IB 1P3GD 5B1MC 4J8XB 5CPKB 1TAFB 5BS7C 5E5AC 3VH5W 4WU8C 4HGAC 3MGQB 1F1EA 5AVCB 1P3KB 2UWXA 4ZBJB 5GSUD 4H9QB 3B6FD 1BH9B 2AROC 5BNVA 1F66A 3X1TD 1Z2CB 5FUGA 3MGPB 2NQBA 3AZED 5AY8B 4ZUXA 5B2IC 2IO5C 5F99C 3AZID 5GXQD 5GT3D 4R8PC 3W97B 5C3IC 2F8NB 1BH8B 5AVBA 5B33B 1ZLAC 3TU4B 2BYKB 3AZJC 3A6NB 3AZHC 5B1MA 2FJ7B 1HQ3D 4H9PB 3C1CD 1S32D 5B31B 5BS7A 5B40D 5AV6C 4X23D 5E5AA 5CPJD 4WU8A 5B32B 1P3MD 1TZYC 4DRAA 3REKB 4H9OA 5B1LC 1P3PA 3WAAB 4LD9B 3MNND 5CPID 1P3BC 3KUYB 5B0ZC 5AV9D 3C1BD 5G49A 2CV5B 3RELD 2AROA 2FFFB 2Y2NA 4NE6A 3WKJD 3X1VB 1P3GC 4H9RB 1KX4D 5JRGB 5B2IA 1P3OD 5F99A 4WNNB 4AWLB 3B0CT 5AV8A 1M18D 1N1JB 4R8PA 1M1AB 3B0DC 4J8VD 4JJNA 2HIOC 3B0BA 5GSUC 3B6FC 4Z66B 1ZLAA 1KX3D 1AOIB 2F8NG 3AZJA 3X1TC 3AZHA 3AZEC 4YS3A 4KUDD 3MGSD 3KXBA 2Y2HA 3EG5B 1TZYA 2G5HC 3H0RC 5B0YD 5B1LA 2Y2JA 5GXQC 3AZKD 4QLCD 3AZIC 5GT3C 1EQZB 3AL0C 4KGCC 5GT0B 3NQJB 3A6NC 4XUJB 3EPLA 3LJAB 1M19D 1P3BA 5B31C 5B0ZA 5B32G 2G5IC 3AZLD 5B24D 4UUZB 1KX5D 4J8UB 1P3GA 3AYWD 1H3OB 3AZMB 1HQ3C 1S32C 3VH6A 4X23C 5B40C 4XZQB 1ID3D 5CPJC 3AV1D 1P3MC 2F8NH 1R4VA 5AV5B 3X1SD 3AZFD 3KWQD 5CPIC 2YFVA 3MNNC 2HUEB 5GSUA 3X1UD 3B6FA 3O62B 3AZND 5AV9C 3C1BC 1P3FD 5AV6D 3RELC 1M1AC 3AZGB 5CP6B 1P3AB 3X1TA 3MVDD 3VH6T 4KHAB 1P3ID 3AZEA 3WKJC 1KX4C 2Y2IA 4Z66C 4J8XD 3REIB 5CPKD 3AZIA 4EO5C 3W96B 4Z5TB 5GXQA 5GT3A 1M18C 3MGQD 3MGRB 5AVCD 3UTBB 1P3KD 5BT1D 1JFIA 3W98B 3VH6W 2XD5A 3V9RA 3WTPB 1EQZC 1KX3C 4CAYB 2Y2PA 3MGPD 1HQ3A 3C1CA 1S32A 4KUDC 2HIOD 5AY8D 5B40A 4X23A 3MGSC 3UTAB 3LELC 5CPJA 4H9NA 1BFMA 2NZDC 1P3MA 5B0YC 4J8WB 3AZKC 4QLCC 3UT9B 3W97D 1P3LC 3MNNA 5CPIA 2F8ND 1U35B 5BNXB 1ULYA 1M19C 3AV2A 5AV9A 3C1BA 3REHB 1T3UA 4XZQC 3RELA 3AZLC 2YFWA 5B24C 5B33D 3EPHA 1KX5C 2PYOB 3AN2B 2CWEA 3TU4D 3WKJA 4WU9B 4KGCD 1KX4A 3A6ND 3AYWC 3O62C 3LZ0B 2FJ7D 3LZ1B 2BYMB 1P3OA 5BO0A 5B31D 1ID3C 1M18A 5B32D 5CP6C 3NQUA 1P34B 3R45A 3AV1C 3WAAD 4J8VA 5B2JB 3X1SC 4LD9D 1PZRA 3AZFC 3KWQC 2ZY5A 2DF4C 4M6BA 4DRBA 3X1UC 3KUYD 3W96C 3AZNC 3WTPE 1P3FC 3W99B 2CV5D 1KX3A 3AFAB 5DNNB 3KSYA 5DNMB 4WZSB 3MVDC 1P3IC 3X1VD 4KUDA 3MGSA 3P5JB 5JRGD 4J8XC 5CPKC 2NZDA 5B0YA 3WTPC 3AZKA 4CSRA 4YM6B 4QLCA 2XD1A 1M1AD 3MGQC 3B6GB 5AVCC 1M19A 3WA9B 1P3KC 5BT1C 4ZBJC 3REJB 3AZLA 5B24A 4Z66D 1KX5A 5JA4B 1AOID 3UT9C 2VQRA 3AYWA 3MGPC 5AY8C 2BG1A 1ID3A 3AV1A 3X1SA 1EQZD 1HTAA 2JSSA 3AZFA 5GT0D 3W97C 3KWQA 4XUJD 3LZ0C 5KDMA 3LJAD 3X1UA 3AZNA 1P3FA 3A1KA 5AV6A 1A7WA 5BNVB 1F66B 3LELD 5B33C 5FUGB 3AV2B 2NQBB 3MVDA 4J8UD 2ZY4A 3TU4C 1P3IA 2Y2KA 1P3LD 2FJ7C 4ZUXB 3AZMD 5CPKA 1TAFA 3KFUG 4XZQD 4Z2MH 5B32C 3MGQA 4NFTA 5DNNC 3WAAC 3REKC 5AV5D 5AVCA 4LD9C 1P3KA 4G91B 5AVBB 3FDDA 4H9QA 4G92B 3O62D 3KUYC 1BH9A 4NE5A 2CV5C 3AZGD 5CP6D 1P3AD 5B1MB 3MGPA 2JCHA 3X1VC 2HIOA 5AY8A 5E5AB 4WU8B 1WWSA 5JRGC 4HGAB 3EPJA 3REID 4H9OB 1P3PB 3W96D 2ZM5A 4Z5TD 4AWLC 3W97A 3MGRD 2F8NA 3H0LC 3UTBD 3W98D 1BH8A 5G49B 2AROB 5B33A 2Y2QA 3WTPD 1AOIC 3TU4A 2BYKA 4KGCA 3A6NA 2FJ7A 2Y2GA 5B2IB 4H9PA 2IO5B 5F99B 3WA9C 5B31A 2F2AC 5AV8B 3UTAD 4R8PB 5B32A 4NE3A 3WAAA 5C3IB 4J8WD 2NQBC 4JJNB 4LD9A 3UT9D 5GT0C 4XUJC 3LJAC 1U35D 3KUYA 1ZLAB 3REHD 2NZDD 2CV5A 3AZJB 3F6TA 3AZHB 2PYOD 3AN2D 4J8UC 4YS3B 3X1VA 4WU9D 4H9RA 3LZ0D 5JRGA 3KXBB 3AZMC 3LZ1D 1TZYB 4WNNA 5B1LB 2Y2OA 1N1JA 1P34D 1M1AA 2Y2MA 1P3BB 5AV5C 5B2JD 5B0ZB 2HUEC 4Z66A 3W99D 1P3PC 3AFAD 1AOIA 3AZGC 2L5AA 1P3GB 1P3AC 5DNND 5DNMD 3REKD 3EPKA 2RVQC 3B0DB 3REIC 4Z5TC 4YM6D 2HIOB 1EQZA 2DQNC 2YFVB 3NQJA 5GT0A 5GSUB 4XUJA 3MGRC 3LJAA 3B6FB 3UTBC 3B6GD 3WA9D 3W98C 2RIQA 5AV8C 3REJD 3IP4C 4DQYB 3LELA 4UUZA 3X1TB 4JJNC 2ZY3A 4J8UA 3AZEB 1P3LA 1H3OA 3AZMA 3AZIB 4UPKA 4H9SC 5GXQB 5GT3B 4XZQA 3UTAC 4WV4B 4KGCB 4WJ3C 4J8WC 4Z2MG 5AV5A 4YS3C 1JFIB 3KXBC 1U35C 3O62A 3REHC 3V9RB 3AZGA 1W2EA 1F66D 5CP6A 1P3AA 3AV2D 1HQ3B 3C1CB 1S32B 3AN2C 2NQBD 4KHAA 2PYOC 5B40B 4X23B 4WU9C 5CPJB 4H9NB 4ZUXD 3LZ1C 1P3MB 3REIA 3W96A 4Z5TA 3MNNB 3MGRA 5CPIB 1P34C 2LY8A 3UTBA 5B2JC 5AV9B 3C1BB 3W98A 5AVBD 3RELB 2YFWB 3W99C 4J8XA 3WTPA 3AFAC 3WKJB 4CAYA 1KX4B 5B1MD 5DNMC 1P3OB 5BO0B 4EO5B 4H9SA 5E5AD 1KU5A 4WU8D 3UTAA 1M18B 3NQUB 3R45B 3B0CW 1P3PD 4J8WA 4J8VB 2J8PA 4YM6C 2Y2LA 3A1IA 3UT9A 3B6GC 1U35A 5BNXA
chains in the Genus database with same CATH topology
3REHA 3REJC 1KX3B 2AROD 2RVQD 5B31G 2ZY2A 2PYOA 3AN2A 4KUDB 3MGSB 4WU9A 3LELB 3LZ0A 5B2ID 5F99D 3LZ1A 2NZDB 2BYMA 1Q9CA 5B0YB 3AZKB 4CSRB 4QLCB 5AV8D 4R8PD 1P3LB 1P34A 3C1CC 4JJND 1M19B 5B2JA 3H0MC 2F8NK 3AZLB 2W8SA 5B24B 1ZLAD 1KX5B 3W99A 3VH5A 3AFAA 3AZJD 1F66C 4E44A 5DNNA 3AYWB 3AZHD 5DNMA 3REKA 3AV2C 4YS3D 5CHLB 2JE5A 1ID3B 4ZUXC 3KXBD 1B6WA 1TZYD 1WWIA 3AV1B 5B1LD 3X1SB 4YM6A 3AZFB 3KWQB 5KDMB 3X1UB 1P3BD 1P3OC 3AZNB 3B6GA 3VH5T 5B0ZD 1P3FB 4G91C 3WA9A 5AVBC 5AV6B 3REJA 1B67A 4G92C 4J8VC 4E45A 3MVDB 5JA4A 1P3IB 1P3GD 5B1MC 4J8XB 5CPKB 1TAFB 5BS7C 5E5AC 3VH5W 4WU8C 4HGAC 3MGQB 1F1EA 5AVCB 1P3KB 2UWXA 4ZBJB 5GSUD 4H9QB 3B6FD 1BH9B 2AROC 5BNVA 1F66A 3X1TD 1Z2CB 5FUGA 3MGPB 2NQBA 3AZED 5AY8B 4ZUXA 5B2IC 2IO5C 5F99C 3AZID 5GXQD 5GT3D 4R8PC 3W97B 5C3IC 2F8NB 1BH8B 5AVBA 5B33B 1ZLAC 3TU4B 2BYKB 3AZJC 3A6NB 3AZHC 5B1MA 2FJ7B 1HQ3D 4H9PB 3C1CD 1S32D 5B31B 5BS7A 5B40D 5AV6C 4X23D 5E5AA 5CPJD 4WU8A 5B32B 1P3MD 1TZYC 4DRAA 3REKB 4H9OA 5B1LC 1P3PA 3WAAB 4LD9B 3MNND 5CPID 1P3BC 3KUYB 5B0ZC 5AV9D 3C1BD 5G49A 2CV5B 3RELD 2AROA 2FFFB 2Y2NA 4NE6A 3WKJD 3X1VB 1P3GC 4H9RB 1KX4D 5JRGB 5B2IA 1P3OD 5F99A 4WNNB 4AWLB 3B0CT 5AV8A 1M18D 1N1JB 4R8PA 1M1AB 3B0DC 4J8VD 4JJNA 2HIOC 3B0BA 5GSUC 3B6FC 4Z66B 1ZLAA 1KX3D 1AOIB 2F8NG 3AZJA 3X1TC 3AZHA 3AZEC 4YS3A 4KUDD 3MGSD 3KXBA 2Y2HA 3EG5B 1TZYA 2G5HC 3H0RC 5B0YD 5B1LA 2Y2JA 5GXQC 3AZKD 4QLCD 3AZIC 5GT3C 1EQZB 3AL0C 4KGCC 5GT0B 3NQJB 3A6NC 4XUJB 3EPLA 3LJAB 1M19D 1P3BA 5B31C 5B0ZA 5B32G 2G5IC 3AZLD 5B24D 4UUZB 1KX5D 4J8UB 1P3GA 3AYWD 1H3OB 3AZMB 1HQ3C 1S32C 3VH6A 4X23C 5B40C 4XZQB 1ID3D 5CPJC 3AV1D 1P3MC 2F8NH 1R4VA 5AV5B 3X1SD 3AZFD 3KWQD 5CPIC 2YFVA 3MNNC 2HUEB 5GSUA 3X1UD 3B6FA 3O62B 3AZND 5AV9C 3C1BC 1P3FD 5AV6D 3RELC 1M1AC 3AZGB 5CP6B 1P3AB 3X1TA 3MVDD 3VH6T 4KHAB 1P3ID 3AZEA 3WKJC 1KX4C 2Y2IA 4Z66C 4J8XD 3REIB 5CPKD 3AZIA 4EO5C 3W96B 4Z5TB 5GXQA 5GT3A 1M18C 3MGQD 3MGRB 5AVCD 3UTBB 1P3KD 5BT1D 1JFIA 3W98B 3VH6W 2XD5A 3V9RA 3WTPB 1EQZC 1KX3C 4CAYB 2Y2PA 3MGPD 1HQ3A 3C1CA 1S32A 4KUDC 2HIOD 5AY8D 5B40A 4X23A 3MGSC 3UTAB 3LELC 5CPJA 4H9NA 1BFMA 2NZDC 1P3MA 5B0YC 4J8WB 3AZKC 4QLCC 3UT9B 3W97D 1P3LC 3MNNA 5CPIA 2F8ND 1U35B 5BNXB 1ULYA 1M19C 3AV2A 5AV9A 3C1BA 3REHB 1T3UA 4XZQC 3RELA 3AZLC 2YFWA 5B24C 5B33D 3EPHA 1KX5C 2PYOB 3AN2B 2CWEA 3TU4D 3WKJA 4WU9B 4KGCD 1KX4A 3A6ND 3AYWC 3O62C 3LZ0B 2FJ7D 3LZ1B 2BYMB 1P3OA 5BO0A 5B31D 1ID3C 1M18A 5B32D 5CP6C 3NQUA 1P34B 3R45A 3AV1C 3WAAD 4J8VA 5B2JB 3X1SC 4LD9D 1PZRA 3AZFC 3KWQC 2ZY5A 2DF4C 4M6BA 4DRBA 3X1UC 3KUYD 3W96C 3AZNC 3WTPE 1P3FC 3W99B 2CV5D 1KX3A 3AFAB 5DNNB 3KSYA 5DNMB 4WZSB 3MVDC 1P3IC 3X1VD 4KUDA 3MGSA 3P5JB 5JRGD 4J8XC 5CPKC 2NZDA 5B0YA 3WTPC 3AZKA 4CSRA 4YM6B 4QLCA 2XD1A 1M1AD 3MGQC 3B6GB 5AVCC 1M19A 3WA9B 1P3KC 5BT1C 4ZBJC 3REJB 3AZLA 5B24A 4Z66D 1KX5A 5JA4B 1AOID 3UT9C 2VQRA 3AYWA 3MGPC 5AY8C 2BG1A 1ID3A 3AV1A 3X1SA 1EQZD 1HTAA 2JSSA 3AZFA 5GT0D 3W97C 3KWQA 4XUJD 3LZ0C 5KDMA 3LJAD 3X1UA 3AZNA 1P3FA 3A1KA 5AV6A 1A7WA 5BNVB 1F66B 3LELD 5B33C 5FUGB 3AV2B 2NQBB 3MVDA 4J8UD 2ZY4A 3TU4C 1P3IA 2Y2KA 1P3LD 2FJ7C 4ZUXB 3AZMD 5CPKA 1TAFA 3KFUG 4XZQD 4Z2MH 5B32C 3MGQA 4NFTA 5DNNC 3WAAC 3REKC 5AV5D 5AVCA 4LD9C 1P3KA 4G91B 5AVBB 3FDDA 4H9QA 4G92B 3O62D 3KUYC 1BH9A 4NE5A 2CV5C 3AZGD 5CP6D 1P3AD 5B1MB 3MGPA 2JCHA 3X1VC 2HIOA 5AY8A 5E5AB 4WU8B 1WWSA 5JRGC 4HGAB 3EPJA 3REID 4H9OB 1P3PB 3W96D 2ZM5A 4Z5TD 4AWLC 3W97A 3MGRD 2F8NA 3H0LC 3UTBD 3W98D 1BH8A 5G49B 2AROB 5B33A 2Y2QA 3WTPD 1AOIC 3TU4A 2BYKA 4KGCA 3A6NA 2FJ7A 2Y2GA 5B2IB 4H9PA 2IO5B 5F99B 3WA9C 5B31A 2F2AC 5AV8B 3UTAD 4R8PB 5B32A 4NE3A 3WAAA 5C3IB 4J8WD 2NQBC 4JJNB 4LD9A 3UT9D 5GT0C 4XUJC 3LJAC 1U35D 3KUYA 1ZLAB 3REHD 2NZDD 2CV5A 3AZJB 3F6TA 3AZHB 2PYOD 3AN2D 4J8UC 4YS3B 3X1VA 4WU9D 4H9RA 3LZ0D 5JRGA 3KXBB 3AZMC 3LZ1D 1TZYB 4WNNA 5B1LB 2Y2OA 1N1JA 1P34D 1M1AA 2Y2MA 1P3BB 5AV5C 5B2JD 5B0ZB 2HUEC 4Z66A 3W99D 1P3PC 3AFAD 1AOIA 3AZGC 2L5AA 1P3GB 1P3AC 5DNND 5DNMD 3REKD 3EPKA 2RVQC 3B0DB 3REIC 4Z5TC 4YM6D 2HIOB 1EQZA 2DQNC 2YFVB 3NQJA 5GT0A 5GSUB 4XUJA 3MGRC 3LJAA 3B6FB 3UTBC 3B6GD 3WA9D 3W98C 2RIQA 5AV8C 3REJD 3IP4C 4DQYB 3LELA 4UUZA 3X1TB 4JJNC 2ZY3A 4J8UA 3AZEB 1P3LA 1H3OA 3AZMA 3AZIB 4UPKA 4H9SC 5GXQB 5GT3B 4XZQA 3UTAC 4WV4B 4KGCB 4WJ3C 4J8WC 4Z2MG 5AV5A 4YS3C 1JFIB 3KXBC 1U35C 3O62A 3REHC 3V9RB 3AZGA 1W2EA 1F66D 5CP6A 1P3AA 3AV2D 1HQ3B 3C1CB 1S32B 3AN2C 2NQBD 4KHAA 2PYOC 5B40B 4X23B 4WU9C 5CPJB 4H9NB 4ZUXD 3LZ1C 1P3MB 3REIA 3W96A 4Z5TA 3MNNB 3MGRA 5CPIB 1P34C 2LY8A 3UTBA 5B2JC 5AV9B 3C1BB 3W98A 5AVBD 3RELB 2YFWB 3W99C 4J8XA 3WTPA 3AFAC 3WKJB 4CAYA 1KX4B 5B1MD 5DNMC 1P3OB 5BO0B 4EO5B 4H9SA 5E5AD 1KU5A 4WU8D 3UTAA 1M18B 3NQUB 3R45B 3B0CW 1P3PD 4J8WA 4J8VB 2J8PA 4YM6C 2Y2LA 3A1IA 3UT9A 3B6GC 1U35A 5BNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH A;  3REJ C;  1KX3 B;  2ARO D;  2RVQ D;  5B31 G;  2PYO A;  3AN2 A;  4KUD B;  3MGS B;  4WU9 A;  3LEL B;  3LZ0 A;  5B2I D;  5F99 D;  3LZ1 A;  2NZD B;  2BYM A;  1Q9C A;  5B0Y B;  3AZK B;  4CSR B;  4QLC B;  5AV8 D;  4R8P D;  1P3L B;  1P34 A;  3C1C C;  4JJN D;  1M19 B;  5B2J A;  2F8N K;  3AZL B;  5B24 B;  1ZLA D;  1KX5 B;  3W99 A;  3VH5 A;  3AFA A;  3AZJ D;  1F66 C;  4E44 A;  5DNN A;  3AYW B;  3AZH D;  5DNM A;  3REK A;  3AV2 C;  4YS3 D;  5CHL B;  1ID3 B;  4ZUX C;  3KXB D;  1B6W A;  1TZY D;  1WWI A;  3AV1 B;  5B1L D;  3X1S B;  4YM6 A;  3AZF B;  3KWQ B;  5KDM B;  3X1U B;  1P3B D;  1P3O C;  3AZN B;  3B6G A;  3VH5 T;  5B0Z D;  1P3F B;  4G91 C;  3WA9 A;  5AVB C;  5AV6 B;  3REJ A;  1B67 A;  4G92 C;  4J8V C;  4E45 A;  3MVD B;  5JA4 A;  1P3I B;  1P3G D;  5B1M C;  4J8X B;  5CPK B;  1TAF B;  5BS7 C;  5E5A C;  3VH5 W;  4WU8 C;  4HGA C;  3MGQ B;  1F1E A;  5AVC B;  1P3K B;  4ZBJ B;  5GSU D;  4H9Q B;  3B6F D;  1BH9 B;  2ARO C;  5BNV A;  1F66 A;  3X1T D;  5FUG A;  3MGP B;  2NQB A;  3AZE D;  5AY8 B;  4ZUX A;  5B2I C;  2IO5 C;  5F99 C;  3AZI D;  5GXQ D;  5GT3 D;  4R8P C;  3W97 B;  5C3I C;  2F8N B;  1BH8 B;  5AVB A;  5B33 B;  1ZLA C;  3TU4 B;  2BYK B;  3AZJ C;  3A6N B;  3AZH C;  5B1M A;  2FJ7 B;  1HQ3 D;  4H9P B;  3C1C D;  1S32 D;  5B31 B;  5BS7 A;  5B40 D;  5AV6 C;  4X23 D;  5E5A A;  5CPJ D;  4WU8 A;  5B32 B;  1P3M D;  1TZY C;  4DRA A;  3REK B;  4H9O A;  5B1L C;  1P3P A;  3WAA B;  4LD9 B;  3MNN D;  5CPI D;  1P3B C;  3KUY B;  5B0Z C;  5AV9 D;  3C1B D;  5G49 A;  2CV5 B;  3REL D;  2ARO A;  4NE6 A;  3WKJ D;  3X1V B;  1P3G C;  4H9R B;  1KX4 D;  5JRG B;  5B2I A;  1P3O D;  5F99 A;  4WNN B;  4AWL B;  3B0C T;  5AV8 A;  1M18 D;  1N1J B;  4R8P A;  1M1A B;  3B0D C;  4J8V D;  4JJN A;  2HIO C;  3B0B A;  5GSU C;  3B6F C;  4Z66 B;  1ZLA A;  1KX3 D;  1AOI B;  2F8N G;  3AZJ A;  3X1T C;  3AZH A;  3AZE C;  4YS3 A;  4KUD D;  3MGS D;  3KXB A;  2NZD D;  1TZY A;  3AZI C;  5B0Y D;  3AZK D;  5B1L A;  5GXQ C;  4QLC D;  5GT3 C;  1EQZ B;  4KGC C;  5GT0 B;  3NQJ B;  3A6N C;  4XUJ B;  3LJA B;  1M19 D;  1P3B A;  5B31 C;  5B0Z A;  5B32 G;  3AZL D;  5B24 D;  4UUZ B;  1KX5 D;  4J8U B;  1P3G A;  3AYW D;  1H3O B;  3AZM B;  1HQ3 C;  1S32 C;  3VH6 A;  4X23 C;  5B40 C;  4XZQ B;  1ID3 D;  5CPJ C;  3AV1 D;  1P3M C;  2F8N H;  1R4V A;  5AV5 B;  3X1S D;  3AZF D;  3KWQ D;  5CPI C;  2YFV A;  3MNN C;  2HUE B;  5GSU A;  3X1U D;  3B6F A;  3O62 B;  3AZN D;  5AV9 C;  3C1B C;  1P3F D;  5AV6 D;  3REL C;  1M1A C;  3AZG B;  5CP6 B;  1P3A B;  3X1T A;  3MVD D;  3VH6 T;  4KHA B;  1P3I D;  3AZE A;  3WKJ C;  1KX4 C;  4Z66 C;  4J8X D;  3REI B;  5CPK D;  3AZI A;  4EO5 C;  3W96 B;  4Z5T B;  5GXQ A;  5GT3 A;  1M18 C;  3MGQ D;  3MGR B;  5AVC D;  3UTB B;  1P3K D;  5BT1 D;  1JFI A;  3W98 B;  3VH6 W;  3V9R A;  3WTP B;  1EQZ C;  1KX3 C;  4CAY B;  3MGP D;  1HQ3 A;  3C1C A;  1S32 A;  4KUD C;  2HIO D;  5AY8 D;  5B40 A;  4X23 A;  3MGS C;  3UTA B;  3LEL C;  5CPJ A;  4H9N A;  1BFM A;  2NZD C;  1P3M A;  5B0Y C;  4J8W B;  3AZK C;  4QLC C;  3UT9 B;  3W97 D;  1P3L C;  3MNN A;  5CPI A;  2F8N D;  1U35 B;  5BNX B;  1ULY A;  1M19 C;  3AV2 A;  5AV9 A;  3C1B A;  3REH B;  4XZQ C;  3REL A;  3AZL C;  2YFW A;  5B24 C;  5B33 D;  1KX5 C;  2PYO B;  3AN2 B;  2CWE A;  3TU4 D;  3WKJ A;  4WU9 B;  4KGC D;  1KX4 A;  3A6N D;  3AYW C;  3O62 C;  3LZ0 B;  2FJ7 D;  3LZ1 B;  2BYM B;  1P3O A;  5BO0 A;  5B31 D;  1ID3 C;  1M18 A;  5B32 D;  5CP6 C;  3NQU A;  1P34 B;  3R45 A;  3AV1 C;  3WAA D;  4J8V A;  5B2J B;  3X1S C;  4LD9 D;  3AZF C;  3KWQ C;  4M6B A;  4DRB A;  3X1U C;  3KUY D;  3AZN C;  3W96 C;  3W99 B;  3WTP E;  1P3F C;  2CV5 D;  1KX3 A;  3AFA B;  5DNN B;  3KSY A;  5DNM B;  4WZS B;  3MVD C;  1P3I C;  3X1V D;  4KUD A;  3MGS A;  5JRG D;  4J8X C;  5CPK C;  2NZD A;  5B0Y A;  3WTP C;  3AZK A;  4CSR A;  4YM6 B;  4QLC A;  1M1A D;  3MGQ C;  3B6G B;  5AVC C;  1M19 A;  3WA9 B;  1P3K C;  5BT1 C;  4ZBJ C;  3REJ B;  3AZL A;  5B24 A;  4Z66 D;  1KX5 A;  5JA4 B;  1AOI D;  3UT9 C;  3AYW A;  3MGP C;  5AY8 C;  1ID3 A;  3AV1 A;  3X1S A;  1EQZ D;  1HTA A;  2JSS A;  3AZF A;  5GT0 D;  3W97 C;  3KWQ A;  4XUJ D;  3LZ0 C;  5KDM A;  3LJA D;  3X1U A;  3AZN A;  1P3F A;  5AV6 A;  1A7W A;  5BNV B;  1F66 B;  3LEL D;  5B33 C;  5FUG B;  3AV2 B;  2NQB B;  3MVD A;  4J8U D;  3TU4 C;  1P3I A;  1P3L D;  2FJ7 C;  4ZUX B;  3AZM D;  5CPK A;  1TAF A;  4XZQ D;  4Z2M H;  5B32 C;  3MGQ A;  4NFT A;  5DNN C;  3WAA C;  3REK C;  5AV5 D;  5AVC A;  4LD9 C;  1P3K A;  4G91 B;  5AVB B;  4H9Q A;  4G92 B;  3O62 D;  3KUY C;  1BH9 A;  4NE5 A;  2CV5 C;  3AZG D;  5CP6 D;  1P3A D;  5B1M B;  3MGP A;  3X1V C;  2HIO A;  5AY8 A;  5E5A B;  4WU8 B;  1WWS A;  5JRG C;  4HGA B;  3REI D;  4H9O B;  1P3P B;  3W96 D;  4Z5T D;  4AWL C;  3W97 A;  3MGR D;  2F8N A;  3UTB D;  3W98 D;  1BH8 A;  5G49 B;  2ARO B;  5B33 A;  3WTP D;  1AOI C;  3TU4 A;  2BYK A;  4KGC A;  3A6N A;  2FJ7 A;  5B2I B;  4H9P A;  2IO5 B;  5F99 B;  3WA9 C;  5B31 A;  5AV8 B;  3UTA D;  4R8P B;  5B32 A;  4NE3 A;  3WAA A;  5C3I B;  4J8W D;  2NQB C;  4JJN B;  4LD9 A;  3UT9 D;  5GT0 C;  4XUJ C;  3LJA C;  1U35 D;  3KUY A;  1ZLA B;  3REH D;  2CV5 A;  3AZJ B;  3AZH B;  2PYO D;  3AN2 D;  4J8U C;  4YS3 B;  3X1V A;  4WU9 D;  4H9R A;  3LZ0 D;  5JRG A;  3KXB B;  3AZM C;  3LZ1 D;  1TZY B;  4WNN A;  5B1L B;  1N1J A;  1P34 D;  1M1A A;  1P3B B;  5AV5 C;  5B2J D;  5B0Z B;  2HUE C;  4Z66 A;  3W99 D;  1P3P C;  3AFA D;  1AOI A;  3AZG C;  2L5A A;  1P3G B;  1P3A C;  5DNN D;  5DNM D;  3REK D;  2RVQ C;  3B0D B;  3REI C;  4Z5T C;  4YM6 D;  2HIO B;  1EQZ A;  5GT0 A;  2YFV B;  3NQJ A;  3MGR C;  5GSU B;  4XUJ A;  3LJA A;  3B6F B;  3UTB C;  3B6G D;  3WA9 D;  3W98 C;  5AV8 C;  3REJ D;  3LEL A;  4UUZ A;  3X1T B;  4JJN C;  4J8U A;  3AZE B;  1P3L A;  1H3O A;  3AZM A;  3AZI B;  4H9S C;  5GXQ B;  5GT3 B;  4XZQ A;  3UTA C;  4WV4 B;  4KGC B;  4J8W C;  4Z2M G;  5AV5 A;  4YS3 C;  1JFI B;  3KXB C;  1U35 C;  3O62 A;  3REH C;  3V9R B;  3AZG A;  1F66 D;  5CP6 A;  1P3A A;  3AV2 D;  1HQ3 B;  3C1C B;  1S32 B;  3AN2 C;  2NQB D;  4KHA A;  2PYO C;  5B40 B;  4X23 B;  4WU9 C;  5CPJ B;  4H9N B;  4ZUX D;  3LZ1 C;  1P3M B;  3REI A;  3W96 A;  4Z5T A;  3MNN B;  3MGR A;  5CPI B;  1P34 C;  2LY8 A;  3UTB A;  5B2J C;  5AV9 B;  3C1B B;  3W98 A;  5AVB D;  3REL B;  2YFW B;  3W99 C;  4J8X A;  3WTP A;  3AFA C;  3WKJ B;  4CAY A;  1KX4 B;  5B1M D;  5DNM C;  1P3O B;  5BO0 B;  4EO5 B;  4H9S A;  5E5A D;  1KU5 A;  4WU8 D;  3UTA A;  1M18 B;  3NQU B;  3R45 B;  3B0C W;  1P3P D;  4J8W A;  4J8V B;  4YM6 C;  3UT9 A;  3B6G C;  1U35 A;  5BNX A; 
#chains in the Genus database with same CATH topology
 3REH A;  3REJ C;  1KX3 B;  2ARO D;  2RVQ D;  5B31 G;  2ZY2 A;  2PYO A;  3AN2 A;  4KUD B;  3MGS B;  4WU9 A;  3LEL B;  3LZ0 A;  5B2I D;  5F99 D;  3LZ1 A;  2NZD B;  2BYM A;  1Q9C A;  5B0Y B;  3AZK B;  4CSR B;  4QLC B;  5AV8 D;  4R8P D;  1P3L B;  1P34 A;  3C1C C;  4JJN D;  1M19 B;  5B2J A;  3H0M C;  2F8N K;  3AZL B;  2W8S A;  5B24 B;  1ZLA D;  1KX5 B;  3W99 A;  3VH5 A;  3AFA A;  3AZJ D;  1F66 C;  4E44 A;  5DNN A;  3AYW B;  3AZH D;  5DNM A;  3REK A;  3AV2 C;  4YS3 D;  5CHL B;  2JE5 A;  1ID3 B;  4ZUX C;  3KXB D;  1B6W A;  1TZY D;  1WWI A;  3AV1 B;  5B1L D;  3X1S B;  4YM6 A;  3AZF B;  3KWQ B;  5KDM B;  3X1U B;  1P3B D;  1P3O C;  3AZN B;  3B6G A;  3VH5 T;  5B0Z D;  1P3F B;  4G91 C;  3WA9 A;  5AVB C;  5AV6 B;  3REJ A;  1B67 A;  4G92 C;  4J8V C;  4E45 A;  3MVD B;  5JA4 A;  1P3I B;  1P3G D;  5B1M C;  4J8X B;  5CPK B;  1TAF B;  5BS7 C;  5E5A C;  3VH5 W;  4WU8 C;  4HGA C;  3MGQ B;  1F1E A;  5AVC B;  1P3K B;  2UWX A;  4ZBJ B;  5GSU D;  4H9Q B;  3B6F D;  1BH9 B;  2ARO C;  5BNV A;  1F66 A;  3X1T D;  1Z2C B;  5FUG A;  3MGP B;  2NQB A;  3AZE D;  5AY8 B;  4ZUX A;  5B2I C;  2IO5 C;  5F99 C;  3AZI D;  5GXQ D;  5GT3 D;  4R8P C;  3W97 B;  5C3I C;  2F8N B;  1BH8 B;  5AVB A;  5B33 B;  1ZLA C;  3TU4 B;  2BYK B;  3AZJ C;  3A6N B;  3AZH C;  5B1M A;  2FJ7 B;  1HQ3 D;  4H9P B;  3C1C D;  1S32 D;  5B31 B;  5BS7 A;  5B40 D;  5AV6 C;  4X23 D;  5E5A A;  5CPJ D;  4WU8 A;  5B32 B;  1P3M D;  1TZY C;  4DRA A;  3REK B;  4H9O A;  5B1L C;  1P3P A;  3WAA B;  4LD9 B;  3MNN D;  5CPI D;  1P3B C;  3KUY B;  5B0Z C;  5AV9 D;  3C1B D;  5G49 A;  2CV5 B;  3REL D;  2ARO A;  2FFF B;  2Y2N A;  4NE6 A;  3WKJ D;  3X1V B;  1P3G C;  4H9R B;  1KX4 D;  5JRG B;  5B2I A;  1P3O D;  5F99 A;  4WNN B;  4AWL B;  3B0C T;  5AV8 A;  1M18 D;  1N1J B;  4R8P A;  1M1A B;  3B0D C;  4J8V D;  4JJN A;  2HIO C;  3B0B A;  5GSU C;  3B6F C;  4Z66 B;  1ZLA A;  1KX3 D;  1AOI B;  2F8N G;  3AZJ A;  3X1T C;  3AZH A;  3AZE C;  4YS3 A;  4KUD D;  3MGS D;  3KXB A;  2Y2H A;  3EG5 B;  1TZY A;  2G5H C;  3H0R C;  5B0Y D;  5B1L A;  2Y2J A;  5GXQ C;  3AZK D;  4QLC D;  3AZI C;  5GT3 C;  1EQZ B;  3AL0 C;  4KGC C;  5GT0 B;  3NQJ B;  3A6N C;  4XUJ B;  3EPL A;  3LJA B;  1M19 D;  1P3B A;  5B31 C;  5B0Z A;  5B32 G;  2G5I C;  3AZL D;  5B24 D;  4UUZ B;  1KX5 D;  4J8U B;  1P3G A;  3AYW D;  1H3O B;  3AZM B;  1HQ3 C;  1S32 C;  3VH6 A;  4X23 C;  5B40 C;  4XZQ B;  1ID3 D;  5CPJ C;  3AV1 D;  1P3M C;  2F8N H;  1R4V A;  5AV5 B;  3X1S D;  3AZF D;  3KWQ D;  5CPI C;  2YFV A;  3MNN C;  2HUE B;  5GSU A;  3X1U D;  3B6F A;  3O62 B;  3AZN D;  5AV9 C;  3C1B C;  1P3F D;  5AV6 D;  3REL C;  1M1A C;  3AZG B;  5CP6 B;  1P3A B;  3X1T A;  3MVD D;  3VH6 T;  4KHA B;  1P3I D;  3AZE A;  3WKJ C;  1KX4 C;  2Y2I A;  4Z66 C;  4J8X D;  3REI B;  5CPK D;  3AZI A;  4EO5 C;  3W96 B;  4Z5T B;  5GXQ A;  5GT3 A;  1M18 C;  3MGQ D;  3MGR B;  5AVC D;  3UTB B;  1P3K D;  5BT1 D;  1JFI A;  3W98 B;  3VH6 W;  2XD5 A;  3V9R A;  3WTP B;  1EQZ C;  1KX3 C;  4CAY B;  2Y2P A;  3MGP D;  1HQ3 A;  3C1C A;  1S32 A;  4KUD C;  2HIO D;  5AY8 D;  5B40 A;  4X23 A;  3MGS C;  3UTA B;  3LEL C;  5CPJ A;  4H9N A;  1BFM A;  2NZD C;  1P3M A;  5B0Y C;  4J8W B;  3AZK C;  4QLC C;  3UT9 B;  3W97 D;  1P3L C;  3MNN A;  5CPI A;  2F8N D;  1U35 B;  5BNX B;  1ULY A;  1M19 C;  3AV2 A;  5AV9 A;  3C1B A;  3REH B;  1T3U A;  4XZQ C;  3REL A;  3AZL C;  2YFW A;  5B24 C;  5B33 D;  3EPH A;  1KX5 C;  2PYO B;  3AN2 B;  2CWE A;  3TU4 D;  3WKJ A;  4WU9 B;  4KGC D;  1KX4 A;  3A6N D;  3AYW C;  3O62 C;  3LZ0 B;  2FJ7 D;  3LZ1 B;  2BYM B;  1P3O A;  5BO0 A;  5B31 D;  1ID3 C;  1M18 A;  5B32 D;  5CP6 C;  3NQU A;  1P34 B;  3R45 A;  3AV1 C;  3WAA D;  4J8V A;  5B2J B;  3X1S C;  4LD9 D;  1PZR A;  3AZF C;  3KWQ C;  2ZY5 A;  2DF4 C;  4M6B A;  4DRB A;  3X1U C;  3KUY D;  3W96 C;  3AZN C;  3WTP E;  1P3F C;  3W99 B;  2CV5 D;  1KX3 A;  3AFA B;  5DNN B;  3KSY A;  5DNM B;  4WZS B;  3MVD C;  1P3I C;  3X1V D;  4KUD A;  3MGS A;  3P5J B;  5JRG D;  4J8X C;  5CPK C;  2NZD A;  5B0Y A;  3WTP C;  3AZK A;  4CSR A;  4YM6 B;  4QLC A;  2XD1 A;  1M1A D;  3MGQ C;  3B6G B;  5AVC C;  1M19 A;  3WA9 B;  1P3K C;  5BT1 C;  4ZBJ C;  3REJ B;  3AZL A;  5B24 A;  4Z66 D;  1KX5 A;  5JA4 B;  1AOI D;  3UT9 C;  2VQR A;  3AYW A;  3MGP C;  5AY8 C;  2BG1 A;  1ID3 A;  3AV1 A;  3X1S A;  1EQZ D;  1HTA A;  2JSS A;  3AZF A;  5GT0 D;  3W97 C;  3KWQ A;  4XUJ D;  3LZ0 C;  5KDM A;  3LJA D;  3X1U A;  3AZN A;  1P3F A;  3A1K A;  5AV6 A;  1A7W A;  5BNV B;  1F66 B;  3LEL D;  5B33 C;  5FUG B;  3AV2 B;  2NQB B;  3MVD A;  4J8U D;  2ZY4 A;  3TU4 C;  1P3I A;  2Y2K A;  1P3L D;  2FJ7 C;  4ZUX B;  3AZM D;  5CPK A;  1TAF A;  3KFU G;  4XZQ D;  4Z2M H;  5B32 C;  3MGQ A;  4NFT A;  5DNN C;  3WAA C;  3REK C;  5AV5 D;  5AVC A;  4LD9 C;  1P3K A;  4G91 B;  5AVB B;  3FDD A;  4H9Q A;  4G92 B;  3O62 D;  3KUY C;  1BH9 A;  4NE5 A;  2CV5 C;  3AZG D;  5CP6 D;  1P3A D;  5B1M B;  3MGP A;  2JCH A;  3X1V C;  2HIO A;  5AY8 A;  5E5A B;  4WU8 B;  1WWS A;  5JRG C;  4HGA B;  3EPJ A;  3REI D;  4H9O B;  1P3P B;  3W96 D;  2ZM5 A;  4Z5T D;  4AWL C;  3W97 A;  3MGR D;  2F8N A;  3H0L C;  3UTB D;  3W98 D;  1BH8 A;  5G49 B;  2ARO B;  5B33 A;  2Y2Q A;  3WTP D;  1AOI C;  3TU4 A;  2BYK A;  4KGC A;  3A6N A;  2FJ7 A;  2Y2G A;  5B2I B;  4H9P A;  2IO5 B;  5F99 B;  3WA9 C;  5B31 A;  2F2A C;  5AV8 B;  3UTA D;  4R8P B;  5B32 A;  4NE3 A;  3WAA A;  5C3I B;  4J8W D;  2NQB C;  4JJN B;  4LD9 A;  3UT9 D;  5GT0 C;  4XUJ C;  3LJA C;  1U35 D;  3KUY A;  1ZLA B;  3REH D;  2NZD D;  2CV5 A;  3AZJ B;  3F6T A;  3AZH B;  2PYO D;  3AN2 D;  4J8U C;  4YS3 B;  3X1V A;  4WU9 D;  4H9R A;  3LZ0 D;  5JRG A;  3KXB B;  3AZM C;  3LZ1 D;  1TZY B;  4WNN A;  5B1L B;  2Y2O A;  1N1J A;  1P34 D;  1M1A A;  2Y2M A;  1P3B B;  5AV5 C;  5B2J D;  5B0Z B;  2HUE C;  4Z66 A;  3W99 D;  1P3P C;  3AFA D;  1AOI A;  3AZG C;  2L5A A;  1P3G B;  1P3A C;  5DNN D;  5DNM D;  3REK D;  3EPK A;  2RVQ C;  3B0D B;  3REI C;  4Z5T C;  4YM6 D;  2HIO B;  1EQZ A;  2DQN C;  2YFV B;  3NQJ A;  5GT0 A;  5GSU B;  4XUJ A;  3MGR C;  3LJA A;  3B6F B;  3UTB C;  3B6G D;  3WA9 D;  3W98 C;  2RIQ A;  5AV8 C;  3REJ D;  3IP4 C;  4DQY B;  3LEL A;  4UUZ A;  3X1T B;  4JJN C;  2ZY3 A;  4J8U A;  3AZE B;  1P3L A;  1H3O A;  3AZM A;  3AZI B;  4UPK A;  4H9S C;  5GXQ B;  5GT3 B;  4XZQ A;  3UTA C;  4WV4 B;  4KGC B;  4WJ3 C;  4J8W C;  4Z2M G;  5AV5 A;  4YS3 C;  1JFI B;  3KXB C;  1U35 C;  3O62 A;  3REH C;  3V9R B;  3AZG A;  1W2E A;  1F66 D;  5CP6 A;  1P3A A;  3AV2 D;  1HQ3 B;  3C1C B;  1S32 B;  3AN2 C;  2NQB D;  4KHA A;  2PYO C;  5B40 B;  4X23 B;  4WU9 C;  5CPJ B;  4H9N B;  4ZUX D;  3LZ1 C;  1P3M B;  3REI A;  3W96 A;  4Z5T A;  3MNN B;  3MGR A;  5CPI B;  1P34 C;  2LY8 A;  3UTB A;  5B2J C;  5AV9 B;  3C1B B;  3W98 A;  5AVB D;  3REL B;  2YFW B;  3W99 C;  4J8X A;  3WTP A;  3AFA C;  3WKJ B;  4CAY A;  1KX4 B;  5B1M D;  5DNM C;  1P3O B;  5BO0 B;  4EO5 B;  4H9S A;  5E5A D;  1KU5 A;  4WU8 D;  3UTA A;  1M18 B;  3NQU B;  3R45 B;  3B0C W;  1P3P D;  4J8W A;  4J8V B;  2J8P A;  4YM6 C;  2Y2L A;  3A1I A;  3UT9 A;  3B6G C;  1U35 A;  5BNX A; 
#chains in the Genus database with same CATH homology
 3REH A;  3REJ C;  1KX3 B;  2ARO D;  2RVQ D;  5B31 G;  2ZY2 A;  2PYO A;  3AN2 A;  4KUD B;  3MGS B;  4WU9 A;  3LEL B;  3LZ0 A;  5B2I D;  5F99 D;  3LZ1 A;  2NZD B;  2BYM A;  1Q9C A;  5B0Y B;  3AZK B;  4CSR B;  4QLC B;  5AV8 D;  4R8P D;  1P3L B;  1P34 A;  3C1C C;  4JJN D;  1M19 B;  5B2J A;  3H0M C;  2F8N K;  3AZL B;  2W8S A;  5B24 B;  1ZLA D;  1KX5 B;  3W99 A;  3VH5 A;  3AFA A;  3AZJ D;  1F66 C;  4E44 A;  5DNN A;  3AYW B;  3AZH D;  5DNM A;  3REK A;  3AV2 C;  4YS3 D;  5CHL B;  2JE5 A;  1ID3 B;  4ZUX C;  3KXB D;  1B6W A;  1TZY D;  1WWI A;  3AV1 B;  5B1L D;  3X1S B;  4YM6 A;  3AZF B;  3KWQ B;  5KDM B;  3X1U B;  1P3B D;  1P3O C;  3AZN B;  3B6G A;  3VH5 T;  5B0Z D;  1P3F B;  4G91 C;  3WA9 A;  5AVB C;  5AV6 B;  3REJ A;  1B67 A;  4G92 C;  4J8V C;  4E45 A;  3MVD B;  5JA4 A;  1P3I B;  1P3G D;  5B1M C;  4J8X B;  5CPK B;  1TAF B;  5BS7 C;  5E5A C;  3VH5 W;  4WU8 C;  4HGA C;  3MGQ B;  1F1E A;  5AVC B;  1P3K B;  2UWX A;  4ZBJ B;  5GSU D;  4H9Q B;  3B6F D;  1BH9 B;  2ARO C;  5BNV A;  1F66 A;  3X1T D;  1Z2C B;  5FUG A;  3MGP B;  2NQB A;  3AZE D;  5AY8 B;  4ZUX A;  5B2I C;  2IO5 C;  5F99 C;  3AZI D;  5GXQ D;  5GT3 D;  4R8P C;  3W97 B;  5C3I C;  2F8N B;  1BH8 B;  5AVB A;  5B33 B;  1ZLA C;  3TU4 B;  2BYK B;  3AZJ C;  3A6N B;  3AZH C;  5B1M A;  2FJ7 B;  1HQ3 D;  4H9P B;  3C1C D;  1S32 D;  5B31 B;  5BS7 A;  5B40 D;  5AV6 C;  4X23 D;  5E5A A;  5CPJ D;  4WU8 A;  5B32 B;  1P3M D;  1TZY C;  4DRA A;  3REK B;  4H9O A;  5B1L C;  1P3P A;  3WAA B;  4LD9 B;  3MNN D;  5CPI D;  1P3B C;  3KUY B;  5B0Z C;  5AV9 D;  3C1B D;  5G49 A;  2CV5 B;  3REL D;  2ARO A;  2FFF B;  2Y2N A;  4NE6 A;  3WKJ D;  3X1V B;  1P3G C;  4H9R B;  1KX4 D;  5JRG B;  5B2I A;  1P3O D;  5F99 A;  4WNN B;  4AWL B;  3B0C T;  5AV8 A;  1M18 D;  1N1J B;  4R8P A;  1M1A B;  3B0D C;  4J8V D;  4JJN A;  2HIO C;  3B0B A;  5GSU C;  3B6F C;  4Z66 B;  1ZLA A;  1KX3 D;  1AOI B;  2F8N G;  3AZJ A;  3X1T C;  3AZH A;  3AZE C;  4YS3 A;  4KUD D;  3MGS D;  3KXB A;  2Y2H A;  3EG5 B;  1TZY A;  2G5H C;  3H0R C;  5B0Y D;  5B1L A;  2Y2J A;  5GXQ C;  3AZK D;  4QLC D;  3AZI C;  5GT3 C;  1EQZ B;  3AL0 C;  4KGC C;  5GT0 B;  3NQJ B;  3A6N C;  4XUJ B;  3EPL A;  3LJA B;  1M19 D;  1P3B A;  5B31 C;  5B0Z A;  5B32 G;  2G5I C;  3AZL D;  5B24 D;  4UUZ B;  1KX5 D;  4J8U B;  1P3G A;  3AYW D;  1H3O B;  3AZM B;  1HQ3 C;  1S32 C;  3VH6 A;  4X23 C;  5B40 C;  4XZQ B;  1ID3 D;  5CPJ C;  3AV1 D;  1P3M C;  2F8N H;  1R4V A;  5AV5 B;  3X1S D;  3AZF D;  3KWQ D;  5CPI C;  2YFV A;  3MNN C;  2HUE B;  5GSU A;  3X1U D;  3B6F A;  3O62 B;  3AZN D;  5AV9 C;  3C1B C;  1P3F D;  5AV6 D;  3REL C;  1M1A C;  3AZG B;  5CP6 B;  1P3A B;  3X1T A;  3MVD D;  3VH6 T;  4KHA B;  1P3I D;  3AZE A;  3WKJ C;  1KX4 C;  2Y2I A;  4Z66 C;  4J8X D;  3REI B;  5CPK D;  3AZI A;  4EO5 C;  3W96 B;  4Z5T B;  5GXQ A;  5GT3 A;  1M18 C;  3MGQ D;  3MGR B;  5AVC D;  3UTB B;  1P3K D;  5BT1 D;  1JFI A;  3W98 B;  3VH6 W;  2XD5 A;  3V9R A;  3WTP B;  1EQZ C;  1KX3 C;  4CAY B;  2Y2P A;  3MGP D;  1HQ3 A;  3C1C A;  1S32 A;  4KUD C;  2HIO D;  5AY8 D;  5B40 A;  4X23 A;  3MGS C;  3UTA B;  3LEL C;  5CPJ A;  4H9N A;  1BFM A;  2NZD C;  1P3M A;  5B0Y C;  4J8W B;  3AZK C;  4QLC C;  3UT9 B;  3W97 D;  1P3L C;  3MNN A;  5CPI A;  2F8N D;  1U35 B;  5BNX B;  1ULY A;  1M19 C;  3AV2 A;  5AV9 A;  3C1B A;  3REH B;  1T3U A;  4XZQ C;  3REL A;  3AZL C;  2YFW A;  5B24 C;  5B33 D;  3EPH A;  1KX5 C;  2PYO B;  3AN2 B;  2CWE A;  3TU4 D;  3WKJ A;  4WU9 B;  4KGC D;  1KX4 A;  3A6N D;  3AYW C;  3O62 C;  3LZ0 B;  2FJ7 D;  3LZ1 B;  2BYM B;  1P3O A;  5BO0 A;  5B31 D;  1ID3 C;  1M18 A;  5B32 D;  5CP6 C;  3NQU A;  1P34 B;  3R45 A;  3AV1 C;  3WAA D;  4J8V A;  5B2J B;  3X1S C;  4LD9 D;  1PZR A;  3AZF C;  3KWQ C;  2ZY5 A;  2DF4 C;  4M6B A;  4DRB A;  3X1U C;  3KUY D;  3W96 C;  3AZN C;  3WTP E;  1P3F C;  3W99 B;  2CV5 D;  1KX3 A;  3AFA B;  5DNN B;  3KSY A;  5DNM B;  4WZS B;  3MVD C;  1P3I C;  3X1V D;  4KUD A;  3MGS A;  3P5J B;  5JRG D;  4J8X C;  5CPK C;  2NZD A;  5B0Y A;  3WTP C;  3AZK A;  4CSR A;  4YM6 B;  4QLC A;  2XD1 A;  1M1A D;  3MGQ C;  3B6G B;  5AVC C;  1M19 A;  3WA9 B;  1P3K C;  5BT1 C;  4ZBJ C;  3REJ B;  3AZL A;  5B24 A;  4Z66 D;  1KX5 A;  5JA4 B;  1AOI D;  3UT9 C;  2VQR A;  3AYW A;  3MGP C;  5AY8 C;  2BG1 A;  1ID3 A;  3AV1 A;  3X1S A;  1EQZ D;  1HTA A;  2JSS A;  3AZF A;  5GT0 D;  3W97 C;  3KWQ A;  4XUJ D;  3LZ0 C;  5KDM A;  3LJA D;  3X1U A;  3AZN A;  1P3F A;  3A1K A;  5AV6 A;  1A7W A;  5BNV B;  1F66 B;  3LEL D;  5B33 C;  5FUG B;  3AV2 B;  2NQB B;  3MVD A;  4J8U D;  2ZY4 A;  3TU4 C;  1P3I A;  2Y2K A;  1P3L D;  2FJ7 C;  4ZUX B;  3AZM D;  5CPK A;  1TAF A;  3KFU G;  4XZQ D;  4Z2M H;  5B32 C;  3MGQ A;  4NFT A;  5DNN C;  3WAA C;  3REK C;  5AV5 D;  5AVC A;  4LD9 C;  1P3K A;  4G91 B;  5AVB B;  3FDD A;  4H9Q A;  4G92 B;  3O62 D;  3KUY C;  1BH9 A;  4NE5 A;  2CV5 C;  3AZG D;  5CP6 D;  1P3A D;  5B1M B;  3MGP A;  2JCH A;  3X1V C;  2HIO A;  5AY8 A;  5E5A B;  4WU8 B;  1WWS A;  5JRG C;  4HGA B;  3EPJ A;  3REI D;  4H9O B;  1P3P B;  3W96 D;  2ZM5 A;  4Z5T D;  4AWL C;  3W97 A;  3MGR D;  2F8N A;  3H0L C;  3UTB D;  3W98 D;  1BH8 A;  5G49 B;  2ARO B;  5B33 A;  2Y2Q A;  3WTP D;  1AOI C;  3TU4 A;  2BYK A;  4KGC A;  3A6N A;  2FJ7 A;  2Y2G A;  5B2I B;  4H9P A;  2IO5 B;  5F99 B;  3WA9 C;  5B31 A;  2F2A C;  5AV8 B;  3UTA D;  4R8P B;  5B32 A;  4NE3 A;  3WAA A;  5C3I B;  4J8W D;  2NQB C;  4JJN B;  4LD9 A;  3UT9 D;  5GT0 C;  4XUJ C;  3LJA C;  1U35 D;  3KUY A;  1ZLA B;  3REH D;  2NZD D;  2CV5 A;  3AZJ B;  3F6T A;  3AZH B;  2PYO D;  3AN2 D;  4J8U C;  4YS3 B;  3X1V A;  4WU9 D;  4H9R A;  3LZ0 D;  5JRG A;  3KXB B;  3AZM C;  3LZ1 D;  1TZY B;  4WNN A;  5B1L B;  2Y2O A;  1N1J A;  1P34 D;  1M1A A;  2Y2M A;  1P3B B;  5AV5 C;  5B2J D;  5B0Z B;  2HUE C;  4Z66 A;  3W99 D;  1P3P C;  3AFA D;  1AOI A;  3AZG C;  2L5A A;  1P3G B;  1P3A C;  5DNN D;  5DNM D;  3REK D;  3EPK A;  2RVQ C;  3B0D B;  3REI C;  4Z5T C;  4YM6 D;  2HIO B;  1EQZ A;  2DQN C;  2YFV B;  3NQJ A;  5GT0 A;  5GSU B;  4XUJ A;  3MGR C;  3LJA A;  3B6F B;  3UTB C;  3B6G D;  3WA9 D;  3W98 C;  2RIQ A;  5AV8 C;  3REJ D;  3IP4 C;  4DQY B;  3LEL A;  4UUZ A;  3X1T B;  4JJN C;  2ZY3 A;  4J8U A;  3AZE B;  1P3L A;  1H3O A;  3AZM A;  3AZI B;  4UPK A;  4H9S C;  5GXQ B;  5GT3 B;  4XZQ A;  3UTA C;  4WV4 B;  4KGC B;  4WJ3 C;  4J8W C;  4Z2M G;  5AV5 A;  4YS3 C;  1JFI B;  3KXB C;  1U35 C;  3O62 A;  3REH C;  3V9R B;  3AZG A;  1W2E A;  1F66 D;  5CP6 A;  1P3A A;  3AV2 D;  1HQ3 B;  3C1C B;  1S32 B;  3AN2 C;  2NQB D;  4KHA A;  2PYO C;  5B40 B;  4X23 B;  4WU9 C;  5CPJ B;  4H9N B;  4ZUX D;  3LZ1 C;  1P3M B;  3REI A;  3W96 A;  4Z5T A;  3MNN B;  3MGR A;  5CPI B;  1P34 C;  2LY8 A;  3UTB A;  5B2J C;  5AV9 B;  3C1B B;  3W98 A;  5AVB D;  3REL B;  2YFW B;  3W99 C;  4J8X A;  3WTP A;  3AFA C;  3WKJ B;  4CAY A;  1KX4 B;  5B1M D;  5DNM C;  1P3O B;  5BO0 B;  4EO5 B;  4H9S A;  5E5A D;  1KU5 A;  4WU8 D;  3UTA A;  1M18 B;  3NQU B;  3R45 B;  3B0C W;  1P3P D;  4J8W A;  4J8V B;  2J8P A;  4YM6 C;  2Y2L A;  3A1I A;  3UT9 A;  3B6G C;  1U35 A;  5BNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...