1P3AD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 91
sequence length 91
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aD00
2JSSA 2F8NH 3NQJA 5B40C 4H9OB 1KU5A 3AV2B 3UTBA 5GSUB 3LELA 2HIOA 5B33C 3REKC 3AZJD 5B32C 1P3AC 3B0CW 1BH8A 3RELB 1F66B 5G49B 5KDMA 5FUGB 3UTAA 3W99B 3AZMC 4JJNC 3MGSA 5JRGA 3AZKC 3MNNB 1AOIC 3AV2D 5GT0B 2FJ7C 5GSUD 5B2JC 5DNMC 5GT3B 5F99A 3WTPC 3KWQA 3UT9A 2CV5C 3AN2B 3RELD 1F66D 3X1VA 1JFIB 5C3IC 1WWSA 3W99D 3AV1C 5BT1D 4ZUXB 3KUYA 3MNND 5BO0B 3B6FB 5CPKB 5GT0D 1TAFB 1P3GC 4X23C 2AROC 4G91C 5GT3D 5BNXB 4KUDB 5DNNC 3C1CA 1ID3C 1ZLAA 3AN2D 4DRBA 4J8XB 5AV9C 4H9SA 5CPJC 3AYWC 3VH5W 5B31B 1BFMA 3MGRB 3AZLA 1HQ3A 2BYMB 1Q9CA 4ZUXD 1ULYA 3O62B 3MVDB 3B6FD 5CPKD 5AV5C 1N1JA 1P3IC 1EQZB 5GXQB 1KX4C 1P34B 2YFVB 5AVCC 1P3MC 1P3OB 1M19B 4KUDD 4KHAB 3WA9B 4J8XD 5B0YC 3AZJA 3KSYA 1P3KB 1M1AC 3A6NC 5B31D 3AZHB 4CSRA 5AV6B 3AZGB 5E5AC 3O62D 4H9OA 3MGPC 2HUEC 5GXQD 3AV2A 1EQZD 3MGQC 1F1EA 1P34D 5GSUA 1P3OD 1M19D 3WA9D 3AZEB 4HGAB 1P3KD 1KX3C 4Z2MH 3RELA 1F66A 5G49A 3AZHD 5FUGA 5BNVB 5AV6D 3W99A 3AZGD 2NZDC 1S32C 3MNNA 5GT0A 5B1MB 5GT3A 4YS3B 3AZED 5CP6C 3AN2A 3W97C 4UUZB 1JFIA 1P3FB 4WU9C 4H9PA 3X1UC 4J8VC 4ZUXA 5B40B 3C1BC 3AZNC 5BO0A 3KXBC 5CPKA 3B6FA 1TAFA 3B6GC 5B1MD 4YS3D 5BNXA 3REHB 4WU8B 1B6WA 4KUDA 5B33B 4Z66B 4Z5TB 3W98C 1HTAA 4G92C 3REKB 4J8XA 1P3BC 5B31A 1P3FD 2NQBC 3MGRA 3REJC 1P3PC 2BYMA 5B40D 3O62A 1AOIB 1EQZA 5GXQA 5CPIC 4QLCC 1KX5B 2IO5C 2YFVA 1P34A 5B2JB 1P3OA 1M19A 5DNMB 3REHD 4WU8D 4KHAA 5B33D 4Z66D 3WA9A 4Z5TD 3WAAB 3REKD 1P3KA 2CV5B 5B24C 4H9RB 3UTBC 3AZHA 5B31G 5AV6A 3LELC 2HIOC 4R8PC 5AV8C 3AZGA 3AV1B 5JA4B 1AOID 2FJ7D 1KX5D 5B2JD 5DNMD 3X1SB 3WAAD 1TZYC 3AZEA 4EO5B 5AY8B 2CV5D 5CPJB 3AYWB 5BNVA 3AV1D 3KWQC 3UT9C 5AV5B 5B2IB 1KX4B 2F8ND 3X1VC 1P3MB 3X1TC 5B1MA 1U35B 3X1SD 4YS3A 4ZBJC 5AY8D 3AZIB 3KUYC 1M1AB 1BH9B 5CPJD 4NE3A 4UUZA 3AYWD 1WWIA 1P3FA 4H9PB 5E5AB 5B40A 3C1CC 3MGPB 1ZLAC 5AV5D 5B2ID 4KGCC 3MGQB 1KX4D 4H9NB 5AVCD 1U35D 1P3MD 3AZLC 1HQ3C 3REHA 4WU8A 5B33A 4Z66A 4Z5TA 3AZID 3REKA 4LD9B 1M1AD 3TU4C 3AFAB 5E5AD 3MGPD 4XZQC 1AOIA 2FJ7A 3MGQD 5AVBB 1KX5A 5B2JA 5DNMA 4AWLB 3WAAA 5CP6B 1R4VA 4LD9D 5B1LC 2CV5A 3W97B 4H9RA 5B32G 3AZFC 3AFAD 4J8UC 5GSUC 3LZ0C 4WU9B 3X1UB 3B0DC 3NQUB 3AV1A 4E45A 2NZDD 3LZ1C 5JA4A 3C1BB 4CAYB 5AVBD 2F8NA 3B6GB 4XUJC 3X1SA 5CP6D 3VH6A 3W98B 5AY8A 3W97D 1P3BB 5GT0C 5CPJA 2RVQD 3AYWA 2NQBB 4WU9D 3X1UD 2F8NK 3C1BD 5B0ZB 3LJAC 3V9RB 5AV5A 5B2IA 4QLCB 1KX4A 3B6GD 1P3MA 1U35A 2F8NG 3WKJC 3W98D 3AZIA 1P3LC 5B24B 4NE6A 1A7WA 5CPKC 1P3BD 1BH9A 1M1AA 2NQBD 4R8PB 5AV8B 5E5AA 3MGPA 3REIC 5B0ZD 1M18C 4QLCD 3MGQA 4H9NA 5B31C 3MGRC 1TZYB 4YM6C 3MVDC 4LD9A 5B24D 4H9QB 3W96C 5B32B 3AFAA 1P3AB 1P3FC 1P34C 4R8PD 5AV8D 2PYOC 3AZMB 4WV4B 4JJNB 3AZKB 5AVBA 2FJ7B 3AZHC 3X1TB 4J8WC 5AV6C 1TZYD 3R45B 5CP6A 3VH6T 3WTPB 3W97A 5B32D 1P3AD 4WU9A 3X1UA 5C3IB 3NQUA 3C1BA 3UT9D 3AZMD 4HGAC 4JJND 4KGCB 1H3OB 4CAYA 3AZKD 4M6BA 2YFWA 3X1VD 4X23B 2AROB 4G91B 3X1TD 1P3GB 3B6GA 2F8NB 4WNNB 3UTAC 3W98A 3WTPD 5DNNB 3B0BA 3TU4B 3MGSC 1P3BA 5JRGC 1ID3B 3VH5A 5AV9B 2NQBA 5B1MC 4NFTA 4YS3C 4XZQB 5B0ZA 5F99C 3V9RA 4KGCD 4QLCA 1P3IB 1P3GD 4X23D 2AROD 5AVCB 5DNND 5B1LB 3TU4D 5B24A 1ID3D 3B0CT 5BS7A 5AV9D 5B0YB 3AZFB 3A6NB 4J8UB 3LZ0B 3B0DB 4R8PA 5AV8A 3REHC 4WU8C 4XZQD 4Z66C 4Z2MG 4Z5TC 3LZ1B 1P3ID 2HUEB 4H9SC 4XUJB 4WZSB 1TZYA 3WTPE 5B1LD 4H9QA 5B0YD 3AZFD 1KX3B 5B32A 3A6ND 1P3AA 4J8UD 3LZ0D 1KX5C 5CHLB 3LZ1D 3WAAC 3AZMA 3LJAB 4JJNA 2NZDB 1S32B 3AZKA 3AZJC 4XUJD 3X1TA 3R45A 3WKJB 1P3LB 3WTPA 1KX3D 3VH5T 3AV2C 2BYKB 4E44A 3X1SC 4EO5C 3REIB 3LJAD 1M18B 4J8VB 5AY8C 4KGCA 1H3OA 1S32D 2CWEA 3AZNB 3KXBB 1P3GA 4X23A 2AROA 2LY8A 3RELC 2YFWB 1F66C 4WNNA 3WKJD 3W99C 4YM6B 1P3LD 5DNNA 5BT1C 3TU4A 1ID3A 4G92B 5B2IC 5AV9A 3MNNC 3W96B 1U35C 3REJB 1P3PB 1M18D 4XZQA 5GT3C 3REID 4J8VD 2PYOB 3AZIC 3AZND 3KXBD 3AN2C 1P3IA 5CPIB 3MGRD 4J8WB 2IO5B 5AVCA 4YM6D 3MVDD 5B1LA 4ZUXC 3NQJB 5B0YA 3AZFA 3B6FC 3W96D 3A6NA 4J8UA 3LZ0A 3UTBB 3REJD 1P3PD 3LELB 2HIOB 3LZ1A 2PYOD 4KUDC 4LD9C 4J8XC 5CPID 3AFAC 1BH8B 4XUJA 4J8WD 5KDMB 3UTAB 4NE5A 1B67A 3O62C 3MGSB 5JRGB 1KX3A 5AVBC 1EQZC 5GXQC 3UTBD 4AWLC 3LELD 1P3OC 2HIOD 1M19C 3LJAA 5F99B 2NZDA 3WA9C 3KWQB 1S32A 3UT9B 1P3KC 2RVQC 3X1VB 3UTAD 3WKJA 4DRAA 1P3LA 3AZGC 4ZBJB 3MGSD 5JRGD 3KUYB 2BYKA 1M18A 3REIA 5F99D 4J8VA 3KWQD 3AZEC 3C1CB 3AZNA 3KXBA 1ZLAB 3VH6W 3AZLB 1HQ3B 2L5AA 4YM6A 3MVDA 5B0ZC 3KUYD 3W96A 1N1JB 3REJA 1P3PA 2PYOA 3C1CD 1ZLAD 5BS7C 3AZJB 5CPIA 4J8WA 4CSRB 3AZLD 1HQ3D
chains in the Genus database with same CATH superfamily
2JSSA 2F8NH 3NQJA 5B40C 4H9OB 1KU5A 3AV2B 3UTBA 5GSUB 3LELA 2HIOA 5B33C 3REKC 3AZJD 5B32C 1P3AC 3B0CW 1BH8A 3RELB 1F66B 5G49B 5KDMA 5FUGB 3UTAA 3W99B 3KFUG 3AZMC 3EPJA 4JJNC 3MGSA 5JRGA 3AZKC 3MNNB 1AOIC 3A1KA 3AV2D 5GT0B 2FJ7C 5GSUD 5B2JC 5DNMC 5GT3B 5F99A 3WTPC 3KWQA 3UT9A 2CV5C 3AN2B 3RELD 1F66D 3X1VA 1JFIB 5C3IC 1WWSA 3W99D 3AV1C 5BT1D 4ZUXB 3F6TA 3KUYA 3MNND 5BO0B 3B6FB 5CPKB 5GT0D 1TAFB 1P3GC 3IP4C 2AROC 4G91C 4X23C 5GT3D 5BNXB 4KUDB 5DNNC 3C1CA 1ID3C 1ZLAA 3AN2D 4DRBA 4J8XB 5AV9C 4H9SA 5CPJC 3AYWC 3VH5W 5B31B 1BFMA 3MGRB 3AZLA 1HQ3A 2BYMB 1Q9CA 4ZUXD 1ULYA 3O62B 3MVDB 3B6FD 5CPKD 5AV5C 1N1JA 2ZM5A 1P3IC 5GXQB 1EQZB 1KX4C 1P34B 2YFVB 5AVCC 1P3MC 1P3OB 1M19B 4KUDD 4KHAB 3WA9B 4J8XD 5B0YC 3AZJA 3KSYA 1P3KB 1M1AC 3A6NC 5B31D 3AZHB 4CSRA 5AV6B 3AZGB 5E5AC 3O62D 4H9OA 3MGPC 2HUEC 5GXQD 3AV2A 1EQZD 3MGQC 1F1EA 1P34D 5GSUA 1P3OD 1M19D 3WA9D 3AZEB 2DQNC 4HGAB 1P3KD 1KX3C 4Z2MH 3RELA 2J8PA 1F66A 5G49A 3AZHD 5FUGA 5BNVB 5AV6D 3W99A 3AZGD 2NZDC 1S32C 3MNNA 5GT0A 5B1MB 5GT3A 3EPKA 4YS3B 3AZED 5CP6C 3AN2A 3W97C 4UUZB 1JFIA 1P3FB 4WU9C 4H9PA 3X1UC 4J8VC 4ZUXA 5B40B 3C1BC 3AZNC 5BO0A 3KXBC 5CPKA 3B6FA 1TAFA 2Y2GA 3B6GC 5B1MD 4YS3D 5BNXA 3REHB 4WU8B 1B6WA 4KUDA 5B33B 4Z66B 4Z5TB 3W98C 1HTAA 2Y2OA 4G92C 3REKB 4J8XA 1P3BC 5B31A 1P3FD 2NQBC 3MGRA 3REJC 1P3PC 2BYMA 5B40D 3O62A 1AOIB 1EQZA 5GXQA 5CPIC 4QLCC 1KX5B 2IO5C 2YFVA 3FDDA 5B2JB 1P34A 1P3OA 5DNMB 1M19A 3REHD 4WU8D 4KHAA 5B33D 4Z66D 3WA9A 4Z5TD 3WAAB 3REKD 1P3KA 2CV5B 5B24C 4H9RB 3UTBC 3AZHA 5B31G 5AV6A 3LELC 2HIOC 4R8PC 5AV8C 3AZGA 3AV1B 5JA4B 1AOID 2FJ7D 2ZY3A 1KX5D 5B2JD 5DNMD 3X1SB 3WAAD 1TZYC 3AZEA 4EO5B 5AY8B 2CV5D 5CPJB 3AYWB 5BNVA 3AV1D 3KWQC 3UT9C 5AV5B 5B2IB 1KX4B 2F8ND 3X1VC 1P3MB 3X1TC 5B1MA 1U35B 3X1SD 4YS3A 2Y2HA 4ZBJC 5AY8D 3AZIB 3KUYC 1M1AB 5CPJD 1BH9B 2Y2JA 4NE3A 4UUZA 3AYWD 1WWIA 1P3FA 2JCHA 4H9PB 5E5AB 5B40A 3C1CC 3MGPB 1ZLAC 5AV5D 5B2ID 4KGCC 3MGQB 1KX4D 4H9NB 5AVCD 1U35D 1P3MD 3AZLC 1HQ3C 3REHA 4WU8A 5B33A 4Z66A 4Z5TA 2Y2IA 3AZID 3REKA 4LD9B 1M1AD 3TU4C 3AFAB 5E5AD 3MGPD 4XZQC 1AOIA 1PZRA 2FJ7A 3MGQD 5AVBB 1KX5A 5B2JA 5DNMA 4AWLB 3WAAA 5CP6B 1R4VA 4LD9D 5B1LC 2CV5A 3W97B 4H9RA 5B32G 3AZFC 3AFAD 4J8UC 5GSUC 3LZ0C 4WU9B 3X1UB 3B0DC 3NQUB 3AV1A 4E45A 2NZDD 3LZ1C 5JA4A 3C1BB 3EPLA 4CAYB 5AVBD 2F8NA 3B6GB 4XUJC 3X1SA 4WJ3C 3H0MC 5CP6D 3VH6A 3W98B 5AY8A 3W97D 1P3BB 5GT0C 5CPJA 2RVQD 3AYWA 2NQBB 4WU9D 3X1UD 2F8NK 3C1BD 2ZY2A 5B0ZB 3LJAC 3V9RB 2Y2MA 5AV5A 5B2IA 1W2EA 4QLCB 1KX4A 3B6GD 1P3MA 1U35A 2F8NG 2XD1A 3WKJC 3W98D 3H0RC 3AZIA 1P3LC 5B24B 4NE6A 1A7WA 5CPKC 1P3BD 1BH9A 1M1AA 2NQBD 4R8PB 5AV8B 5E5AA 3MGPA 3REIC 5B0ZD 1M18C 3AL0C 4QLCD 3MGQA 2Y2NA 4H9NA 5B31C 2FFFB 3MGRC 1TZYB 2UWXA 4YM6C 3MVDC 4LD9A 5B24D 3H0LC 4H9QB 3W96C 5B32B 3AFAA 1P3AB 1P3FC 1P34C 4R8PD 5AV8D 2JE5A 2PYOC 3AZMB 4WV4B 4JJNB 2Y2KA 3AZKB 5AVBA 2FJ7B 4DQYB 3AZHC 3X1TB 4J8WC 5AV6C 1TZYD 2F2AC 3R45B 5CP6A 3VH6T 3WTPB 3W97A 5B32D 1P3AD 2DF4C 4WU9A 3X1UA 1Z2CB 5C3IB 3NQUA 3C1BA 3UT9D 3AZMD 4HGAC 4JJND 4KGCB 1H3OB 4CAYA 3AZKD 4M6BA 2YFWA 3X1VD 4X23B 2AROB 4G91B 3X1TD 1P3GB 3B6GA 2F8NB 4WNNB 3UTAC 3W98A 3WTPD 5DNNB 3B0BA 3TU4B 3MGSC 1P3BA 5JRGC 1ID3B 3VH5A 5AV9B 2NQBA 5B1MC 4NFTA 4YS3C 2G5HC 4XZQB 5B0ZA 5F99C 3V9RA 4KGCD 4QLCA 1P3IB 1P3GD 4X23D 2AROD 5AVCB 3P5JB 5DNND 5B1LB 3TU4D 5B24A 1ID3D 3B0CT 5BS7A 5AV9D 5B0YB 3AZFB 3A6NB 1T3UA 4J8UB 3LZ0B 2Y2QA 3B0DB 4R8PA 5AV8A 3REHC 4WU8C 4XZQD 4Z66C 4Z2MG 4Z5TC 3LZ1B 1P3ID 2HUEB 4H9SC 4XUJB 4WZSB 1TZYA 3WTPE 5B1LD 4H9QA 5B0YD 3AZFD 1KX3B 5B32A 3A6ND 1P3AA 4J8UD 3LZ0D 1KX5C 5CHLB 3LZ1D 3WAAC 3AZMA 3LJAB 4JJNA 2NZDB 1S32B 3AZKA 3AZJC 4XUJD 3X1TA 2RIQA 3R45A 3WKJB 1P3LB 3WTPA 1KX3D 2BG1A 3VH5T 3AV2C 2BYKB 4E44A 3X1SC 2W8SA 4EO5C 3REIB 3LJAD 1M18B 4J8VB 5AY8C 4KGCA 1H3OA 1S32D 2CWEA 3AZNB 3KXBB 1P3GA 4X23A 2AROA 2LY8A 3RELC 2YFWB 1F66C 4WNNA 3WKJD 3W99C 4YM6B 1P3LD 5DNNA 5BT1C 3TU4A 1ID3A 4G92B 5B2IC 5AV9A 3MNNC 3W96B 3A1IA 1U35C 3REJB 1P3PB 1M18D 4XZQA 5GT3C 3REID 4J8VD 2PYOB 3AZIC 3AZND 2G5IC 3KXBD 3AN2C 1P3IA 5CPIB 3MGRD 4J8WB 2IO5B 5AVCA 2Y2LA 4YM6D 3MVDD 5B1LA 3EPHA 4ZUXC 3NQJB 2ZY5A 5B0YA 3AZFA 3B6FC 3W96D 3A6NA 4J8UA 3LZ0A 3UTBB 3REJD 1P3PD 3LELB 2HIOB 3LZ1A 2PYOD 4KUDC 4LD9C 4J8XC 5CPID 3AFAC 1BH8B 4XUJA 4J8WD 5KDMB 3UTAB 4NE5A 1B67A 3O62C 3MGSB 5JRGB 1KX3A 5AVBC 1EQZC 5GXQC 3UTBD 4AWLC 2VQRA 3LELD 2HIOD 1P3OC 1M19C 3LJAA 5F99B 2NZDA 3WA9C 3KWQB 1S32A 3UT9B 1P3KC 2RVQC 3X1VB 3UTAD 2Y2PA 3WKJA 4DRAA 1P3LA 3AZGC 4ZBJB 3MGSD 5JRGD 3KUYB 2BYKA 2XD5A 1M18A 3REIA 3EG5B 5F99D 4J8VA 3KWQD 3AZEC 3C1CB 3AZNA 3KXBA 1ZLAB 3VH6W 4UPKA 3AZLB 1HQ3B 2L5AA 4YM6A 3MVDA 5B0ZC 3KUYD 3W96A 1N1JB 2ZY4A 3REJA 1P3PA 2PYOA 3C1CD 1ZLAD 5BS7C 3AZJB 5CPIA 4J8WA 4CSRB 3AZLD 1HQ3D
chains in the Genus database with same CATH topology
2JSSA 2F8NH 3NQJA 5B40C 4H9OB 1KU5A 3AV2B 3UTBA 5GSUB 3LELA 2HIOA 5B33C 3REKC 3AZJD 5B32C 1P3AC 3B0CW 1BH8A 3RELB 1F66B 5G49B 5KDMA 5FUGB 3UTAA 3W99B 3KFUG 3AZMC 3EPJA 4JJNC 3MGSA 5JRGA 3AZKC 3MNNB 1AOIC 3A1KA 3AV2D 5GT0B 2FJ7C 5GSUD 5B2JC 5DNMC 5GT3B 5F99A 3WTPC 3KWQA 3UT9A 2CV5C 3AN2B 3RELD 1F66D 3X1VA 1JFIB 5C3IC 1WWSA 3W99D 3AV1C 5BT1D 4ZUXB 3F6TA 3KUYA 3MNND 5BO0B 3B6FB 5CPKB 5GT0D 1TAFB 1P3GC 3IP4C 2AROC 4G91C 4X23C 5GT3D 5BNXB 4KUDB 5DNNC 3C1CA 1ID3C 1ZLAA 3AN2D 4DRBA 4J8XB 5AV9C 4H9SA 5CPJC 3AYWC 3VH5W 5B31B 1BFMA 3MGRB 3AZLA 1HQ3A 2BYMB 1Q9CA 4ZUXD 1ULYA 3O62B 3MVDB 3B6FD 5CPKD 5AV5C 1N1JA 2ZM5A 1P3IC 5GXQB 1EQZB 1KX4C 1P34B 2YFVB 5AVCC 1P3MC 1P3OB 1M19B 4KUDD 4KHAB 3WA9B 4J8XD 5B0YC 3AZJA 3KSYA 1P3KB 1M1AC 3A6NC 5B31D 3AZHB 4CSRA 5AV6B 3AZGB 5E5AC 3O62D 4H9OA 3MGPC 2HUEC 5GXQD 3AV2A 1EQZD 3MGQC 1F1EA 1P34D 5GSUA 1P3OD 1M19D 3WA9D 3AZEB 2DQNC 4HGAB 1P3KD 1KX3C 4Z2MH 3RELA 2J8PA 1F66A 5G49A 3AZHD 5FUGA 5BNVB 5AV6D 3W99A 3AZGD 2NZDC 1S32C 3MNNA 5GT0A 5B1MB 5GT3A 3EPKA 4YS3B 3AZED 5CP6C 3AN2A 3W97C 4UUZB 1JFIA 1P3FB 4WU9C 4H9PA 3X1UC 4J8VC 4ZUXA 5B40B 3C1BC 3AZNC 5BO0A 3KXBC 5CPKA 3B6FA 1TAFA 2Y2GA 3B6GC 5B1MD 4YS3D 5BNXA 3REHB 4WU8B 1B6WA 4KUDA 5B33B 4Z66B 4Z5TB 3W98C 1HTAA 2Y2OA 4G92C 3REKB 4J8XA 1P3BC 5B31A 1P3FD 2NQBC 3MGRA 3REJC 1P3PC 2BYMA 5B40D 3O62A 1AOIB 1EQZA 5GXQA 5CPIC 4QLCC 1KX5B 2IO5C 2YFVA 3FDDA 5B2JB 1P34A 1P3OA 5DNMB 1M19A 3REHD 4WU8D 4KHAA 5B33D 4Z66D 3WA9A 4Z5TD 3WAAB 3REKD 1P3KA 2CV5B 5B24C 4H9RB 3UTBC 3AZHA 5B31G 5AV6A 3LELC 2HIOC 4R8PC 5AV8C 3AZGA 3AV1B 5JA4B 1AOID 2FJ7D 2ZY3A 1KX5D 5B2JD 5DNMD 3X1SB 3WAAD 1TZYC 3AZEA 4EO5B 5AY8B 2CV5D 5CPJB 3AYWB 5BNVA 3AV1D 3KWQC 3UT9C 5AV5B 5B2IB 1KX4B 2F8ND 3X1VC 1P3MB 3X1TC 5B1MA 1U35B 3X1SD 4YS3A 2Y2HA 4ZBJC 5AY8D 3AZIB 3KUYC 1M1AB 5CPJD 1BH9B 2Y2JA 4NE3A 4UUZA 3AYWD 1WWIA 1P3FA 2JCHA 4H9PB 5E5AB 5B40A 3C1CC 3MGPB 1ZLAC 5AV5D 5B2ID 4KGCC 3MGQB 1KX4D 4H9NB 5AVCD 1U35D 1P3MD 3AZLC 1HQ3C 3REHA 4WU8A 5B33A 4Z66A 4Z5TA 2Y2IA 3AZID 3REKA 4LD9B 1M1AD 3TU4C 3AFAB 5E5AD 3MGPD 4XZQC 1AOIA 1PZRA 2FJ7A 3MGQD 5AVBB 1KX5A 5B2JA 5DNMA 4AWLB 3WAAA 5CP6B 1R4VA 4LD9D 5B1LC 2CV5A 3W97B 4H9RA 5B32G 3AZFC 3AFAD 4J8UC 5GSUC 3LZ0C 4WU9B 3X1UB 3B0DC 3NQUB 3AV1A 4E45A 2NZDD 3LZ1C 5JA4A 3C1BB 3EPLA 4CAYB 5AVBD 2F8NA 3B6GB 4XUJC 3X1SA 4WJ3C 3H0MC 5CP6D 3VH6A 3W98B 5AY8A 3W97D 1P3BB 5GT0C 5CPJA 2RVQD 3AYWA 2NQBB 4WU9D 3X1UD 2F8NK 3C1BD 2ZY2A 5B0ZB 3LJAC 3V9RB 2Y2MA 5AV5A 5B2IA 1W2EA 4QLCB 1KX4A 3B6GD 1P3MA 1U35A 2F8NG 2XD1A 3WKJC 3W98D 3H0RC 3AZIA 1P3LC 5B24B 4NE6A 1A7WA 5CPKC 1P3BD 1BH9A 1M1AA 2NQBD 4R8PB 5AV8B 5E5AA 3MGPA 3REIC 5B0ZD 1M18C 3AL0C 4QLCD 3MGQA 2Y2NA 4H9NA 5B31C 2FFFB 3MGRC 1TZYB 2UWXA 4YM6C 3MVDC 4LD9A 5B24D 3H0LC 4H9QB 3W96C 5B32B 3AFAA 1P3AB 1P3FC 1P34C 4R8PD 5AV8D 2JE5A 2PYOC 3AZMB 4WV4B 4JJNB 2Y2KA 3AZKB 5AVBA 2FJ7B 4DQYB 3AZHC 3X1TB 4J8WC 5AV6C 1TZYD 2F2AC 3R45B 5CP6A 3VH6T 3WTPB 3W97A 5B32D 1P3AD 2DF4C 4WU9A 3X1UA 1Z2CB 5C3IB 3NQUA 3C1BA 3UT9D 3AZMD 4HGAC 4JJND 4KGCB 1H3OB 4CAYA 3AZKD 4M6BA 2YFWA 3X1VD 4X23B 2AROB 4G91B 3X1TD 1P3GB 3B6GA 2F8NB 4WNNB 3UTAC 3W98A 3WTPD 5DNNB 3B0BA 3TU4B 3MGSC 1P3BA 5JRGC 1ID3B 3VH5A 5AV9B 2NQBA 5B1MC 4NFTA 4YS3C 2G5HC 4XZQB 5B0ZA 5F99C 3V9RA 4KGCD 4QLCA 1P3IB 1P3GD 4X23D 2AROD 5AVCB 3P5JB 5DNND 5B1LB 3TU4D 5B24A 1ID3D 3B0CT 5BS7A 5AV9D 5B0YB 3AZFB 3A6NB 1T3UA 4J8UB 3LZ0B 2Y2QA 3B0DB 4R8PA 5AV8A 3REHC 4WU8C 4XZQD 4Z66C 4Z2MG 4Z5TC 3LZ1B 1P3ID 2HUEB 4H9SC 4XUJB 4WZSB 1TZYA 3WTPE 5B1LD 4H9QA 5B0YD 3AZFD 1KX3B 5B32A 3A6ND 1P3AA 4J8UD 3LZ0D 1KX5C 5CHLB 3LZ1D 3WAAC 3AZMA 3LJAB 4JJNA 2NZDB 1S32B 3AZKA 3AZJC 4XUJD 3X1TA 2RIQA 3R45A 3WKJB 1P3LB 3WTPA 1KX3D 2BG1A 3VH5T 3AV2C 2BYKB 4E44A 3X1SC 2W8SA 4EO5C 3REIB 3LJAD 1M18B 4J8VB 5AY8C 4KGCA 1H3OA 1S32D 2CWEA 3AZNB 3KXBB 1P3GA 4X23A 2AROA 2LY8A 3RELC 2YFWB 1F66C 4WNNA 3WKJD 3W99C 4YM6B 1P3LD 5DNNA 5BT1C 3TU4A 1ID3A 4G92B 5B2IC 5AV9A 3MNNC 3W96B 3A1IA 1U35C 3REJB 1P3PB 1M18D 4XZQA 5GT3C 3REID 4J8VD 2PYOB 3AZIC 3AZND 2G5IC 3KXBD 3AN2C 1P3IA 5CPIB 3MGRD 4J8WB 2IO5B 5AVCA 2Y2LA 4YM6D 3MVDD 5B1LA 3EPHA 4ZUXC 3NQJB 2ZY5A 5B0YA 3AZFA 3B6FC 3W96D 3A6NA 4J8UA 3LZ0A 3UTBB 3REJD 1P3PD 3LELB 2HIOB 3LZ1A 2PYOD 4KUDC 4LD9C 4J8XC 5CPID 3AFAC 1BH8B 4XUJA 4J8WD 5KDMB 3UTAB 4NE5A 1B67A 3O62C 3MGSB 5JRGB 1KX3A 5AVBC 1EQZC 5GXQC 3UTBD 4AWLC 2VQRA 3LELD 2HIOD 1P3OC 1M19C 3LJAA 5F99B 2NZDA 3WA9C 3KWQB 1S32A 3UT9B 1P3KC 2RVQC 3X1VB 3UTAD 2Y2PA 3WKJA 4DRAA 1P3LA 3AZGC 4ZBJB 3MGSD 5JRGD 3KUYB 2BYKA 2XD5A 1M18A 3REIA 3EG5B 5F99D 4J8VA 3KWQD 3AZEC 3C1CB 3AZNA 3KXBA 1ZLAB 3VH6W 4UPKA 3AZLB 1HQ3B 2L5AA 4YM6A 3MVDA 5B0ZC 3KUYD 3W96A 1N1JB 2ZY4A 3REJA 1P3PA 2PYOA 3C1CD 1ZLAD 5BS7C 3AZJB 5CPIA 4J8WA 4CSRB 3AZLD 1HQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSS A;  2F8N H;  3NQJ A;  5B40 C;  4H9O B;  1KU5 A;  3AV2 B;  3UTB A;  5GSU B;  3LEL A;  2HIO A;  5B33 C;  3REK C;  3AZJ D;  5B32 C;  1P3A C;  3B0C W;  1BH8 A;  3REL B;  1F66 B;  5G49 B;  5KDM A;  5FUG B;  3UTA A;  3W99 B;  3AZM C;  4JJN C;  3MGS A;  5JRG A;  3AZK C;  3MNN B;  1AOI C;  3AV2 D;  5GT0 B;  2FJ7 C;  5GSU D;  5B2J C;  5DNM C;  5GT3 B;  5F99 A;  3WTP C;  3KWQ A;  3UT9 A;  2CV5 C;  3AN2 B;  3REL D;  1F66 D;  3X1V A;  1JFI B;  5C3I C;  1WWS A;  3W99 D;  3AV1 C;  5BT1 D;  4ZUX B;  3KUY A;  3MNN D;  5BO0 B;  3B6F B;  5CPK B;  5GT0 D;  1TAF B;  1P3G C;  4X23 C;  2ARO C;  4G91 C;  5GT3 D;  5BNX B;  4KUD B;  5DNN C;  3C1C A;  1ID3 C;  1ZLA A;  3AN2 D;  4DRB A;  4J8X B;  5AV9 C;  4H9S A;  5CPJ C;  3AYW C;  3VH5 W;  5B31 B;  1BFM A;  3MGR B;  3AZL A;  1HQ3 A;  2BYM B;  1Q9C A;  4ZUX D;  1ULY A;  3O62 B;  3MVD B;  3B6F D;  5CPK D;  5AV5 C;  1N1J A;  1P3I C;  1EQZ B;  5GXQ B;  1KX4 C;  1P34 B;  2YFV B;  5AVC C;  1P3M C;  1P3O B;  1M19 B;  4KUD D;  4KHA B;  3WA9 B;  4J8X D;  5B0Y C;  3AZJ A;  3KSY A;  1P3K B;  1M1A C;  3A6N C;  5B31 D;  3AZH B;  4CSR A;  5AV6 B;  3AZG B;  5E5A C;  3O62 D;  4H9O A;  3MGP C;  2HUE C;  5GXQ D;  3AV2 A;  1EQZ D;  3MGQ C;  1F1E A;  1P34 D;  5GSU A;  1P3O D;  1M19 D;  3WA9 D;  3AZE B;  4HGA B;  1P3K D;  1KX3 C;  4Z2M H;  3REL A;  1F66 A;  5G49 A;  3AZH D;  5FUG A;  5BNV B;  5AV6 D;  3W99 A;  3AZG D;  2NZD C;  1S32 C;  3MNN A;  5GT0 A;  5B1M B;  5GT3 A;  4YS3 B;  3AZE D;  5CP6 C;  3AN2 A;  3W97 C;  4UUZ B;  1JFI A;  1P3F B;  4WU9 C;  4H9P A;  3X1U C;  4J8V C;  4ZUX A;  5B40 B;  3C1B C;  3AZN C;  5BO0 A;  3KXB C;  5CPK A;  3B6F A;  1TAF A;  3B6G C;  5B1M D;  4YS3 D;  5BNX A;  3REH B;  4WU8 B;  1B6W A;  4KUD A;  5B33 B;  4Z66 B;  4Z5T B;  3W98 C;  1HTA A;  4G92 C;  3REK B;  4J8X A;  1P3B C;  5B31 A;  1P3F D;  2NQB C;  3MGR A;  3REJ C;  1P3P C;  2BYM A;  5B40 D;  3O62 A;  1AOI B;  1EQZ A;  5GXQ A;  5CPI C;  4QLC C;  1KX5 B;  2IO5 C;  2YFV A;  1P34 A;  5B2J B;  1P3O A;  1M19 A;  5DNM B;  3REH D;  4WU8 D;  4KHA A;  5B33 D;  4Z66 D;  3WA9 A;  4Z5T D;  3WAA B;  3REK D;  1P3K A;  2CV5 B;  5B24 C;  4H9R B;  3UTB C;  3AZH A;  5B31 G;  5AV6 A;  3LEL C;  2HIO C;  4R8P C;  5AV8 C;  3AZG A;  3AV1 B;  5JA4 B;  1AOI D;  2FJ7 D;  1KX5 D;  5B2J D;  5DNM D;  3X1S B;  3WAA D;  1TZY C;  3AZE A;  4EO5 B;  5AY8 B;  2CV5 D;  5CPJ B;  3AYW B;  5BNV A;  3AV1 D;  3KWQ C;  3UT9 C;  5AV5 B;  5B2I B;  1KX4 B;  2F8N D;  3X1V C;  1P3M B;  3X1T C;  5B1M A;  1U35 B;  3X1S D;  4YS3 A;  4ZBJ C;  5AY8 D;  3AZI B;  3KUY C;  1M1A B;  1BH9 B;  5CPJ D;  4NE3 A;  4UUZ A;  3AYW D;  1WWI A;  1P3F A;  4H9P B;  5E5A B;  5B40 A;  3C1C C;  3MGP B;  1ZLA C;  5AV5 D;  5B2I D;  4KGC C;  3MGQ B;  1KX4 D;  4H9N B;  5AVC D;  1U35 D;  1P3M D;  3AZL C;  1HQ3 C;  3REH A;  4WU8 A;  5B33 A;  4Z66 A;  4Z5T A;  3AZI D;  3REK A;  4LD9 B;  1M1A D;  3TU4 C;  3AFA B;  5E5A D;  3MGP D;  4XZQ C;  1AOI A;  2FJ7 A;  3MGQ D;  5AVB B;  1KX5 A;  5B2J A;  5DNM A;  4AWL B;  3WAA A;  5CP6 B;  1R4V A;  4LD9 D;  5B1L C;  2CV5 A;  3W97 B;  4H9R A;  5B32 G;  3AZF C;  3AFA D;  4J8U C;  5GSU C;  3LZ0 C;  4WU9 B;  3X1U B;  3B0D C;  3NQU B;  3AV1 A;  4E45 A;  2NZD D;  3LZ1 C;  5JA4 A;  3C1B B;  4CAY B;  5AVB D;  2F8N A;  3B6G B;  4XUJ C;  3X1S A;  5CP6 D;  3VH6 A;  3W98 B;  5AY8 A;  3W97 D;  1P3B B;  5GT0 C;  5CPJ A;  2RVQ D;  3AYW A;  2NQB B;  4WU9 D;  3X1U D;  2F8N K;  3C1B D;  5B0Z B;  3LJA C;  3V9R B;  5AV5 A;  5B2I A;  4QLC B;  1KX4 A;  3B6G D;  1P3M A;  1U35 A;  2F8N G;  3WKJ C;  3W98 D;  3AZI A;  1P3L C;  5B24 B;  4NE6 A;  1A7W A;  5CPK C;  1P3B D;  1BH9 A;  1M1A A;  2NQB D;  4R8P B;  5AV8 B;  5E5A A;  3MGP A;  3REI C;  5B0Z D;  1M18 C;  4QLC D;  3MGQ A;  4H9N A;  5B31 C;  3MGR C;  1TZY B;  4YM6 C;  3MVD C;  4LD9 A;  5B24 D;  4H9Q B;  3W96 C;  5B32 B;  3AFA A;  1P3A B;  1P3F C;  1P34 C;  4R8P D;  5AV8 D;  2PYO C;  3AZM B;  4WV4 B;  4JJN B;  3AZK B;  5AVB A;  2FJ7 B;  3AZH C;  3X1T B;  4J8W C;  5AV6 C;  1TZY D;  3R45 B;  5CP6 A;  3VH6 T;  3WTP B;  3W97 A;  5B32 D;  1P3A D;  4WU9 A;  3X1U A;  5C3I B;  3NQU A;  3C1B A;  3UT9 D;  3AZM D;  4HGA C;  4JJN D;  4KGC B;  1H3O B;  4CAY A;  3AZK D;  4M6B A;  2YFW A;  3X1V D;  4X23 B;  2ARO B;  4G91 B;  3X1T D;  1P3G B;  3B6G A;  2F8N B;  4WNN B;  3UTA C;  3W98 A;  3WTP D;  5DNN B;  3B0B A;  3TU4 B;  3MGS C;  1P3B A;  5JRG C;  1ID3 B;  3VH5 A;  5AV9 B;  2NQB A;  5B1M C;  4NFT A;  4YS3 C;  4XZQ B;  5B0Z A;  5F99 C;  3V9R A;  4KGC D;  4QLC A;  1P3I B;  1P3G D;  4X23 D;  2ARO D;  5AVC B;  5DNN D;  5B1L B;  3TU4 D;  5B24 A;  1ID3 D;  3B0C T;  5BS7 A;  5AV9 D;  5B0Y B;  3AZF B;  3A6N B;  4J8U B;  3LZ0 B;  3B0D B;  4R8P A;  5AV8 A;  3REH C;  4WU8 C;  4XZQ D;  4Z66 C;  4Z2M G;  4Z5T C;  3LZ1 B;  1P3I D;  2HUE B;  4H9S C;  4XUJ B;  4WZS B;  1TZY A;  3WTP E;  5B1L D;  4H9Q A;  5B0Y D;  3AZF D;  1KX3 B;  5B32 A;  3A6N D;  1P3A A;  4J8U D;  3LZ0 D;  1KX5 C;  5CHL B;  3LZ1 D;  3WAA C;  3AZM A;  3LJA B;  4JJN A;  2NZD B;  1S32 B;  3AZK A;  3AZJ C;  4XUJ D;  3X1T A;  3R45 A;  3WKJ B;  1P3L B;  3WTP A;  1KX3 D;  3VH5 T;  3AV2 C;  2BYK B;  4E44 A;  3X1S C;  4EO5 C;  3REI B;  3LJA D;  1M18 B;  4J8V B;  5AY8 C;  4KGC A;  1H3O A;  1S32 D;  2CWE A;  3AZN B;  3KXB B;  1P3G A;  4X23 A;  2ARO A;  2LY8 A;  3REL C;  2YFW B;  1F66 C;  4WNN A;  3WKJ D;  3W99 C;  4YM6 B;  1P3L D;  5DNN A;  5BT1 C;  3TU4 A;  1ID3 A;  4G92 B;  5B2I C;  5AV9 A;  3MNN C;  3W96 B;  1U35 C;  3REJ B;  1P3P B;  1M18 D;  4XZQ A;  5GT3 C;  3REI D;  4J8V D;  2PYO B;  3AZI C;  3AZN D;  3KXB D;  3AN2 C;  1P3I A;  5CPI B;  3MGR D;  4J8W B;  2IO5 B;  5AVC A;  4YM6 D;  3MVD D;  5B1L A;  4ZUX C;  3NQJ B;  5B0Y A;  3AZF A;  3B6F C;  3W96 D;  3A6N A;  4J8U A;  3LZ0 A;  3UTB B;  3REJ D;  1P3P D;  3LEL B;  2HIO B;  3LZ1 A;  2PYO D;  4KUD C;  4LD9 C;  4J8X C;  5CPI D;  3AFA C;  1BH8 B;  4XUJ A;  4J8W D;  5KDM B;  3UTA B;  4NE5 A;  1B67 A;  3O62 C;  3MGS B;  5JRG B;  1KX3 A;  5AVB C;  1EQZ C;  5GXQ C;  3UTB D;  4AWL C;  3LEL D;  1P3O C;  2HIO D;  1M19 C;  3LJA A;  5F99 B;  2NZD A;  3WA9 C;  3KWQ B;  1S32 A;  3UT9 B;  1P3K C;  2RVQ C;  3X1V B;  3UTA D;  3WKJ A;  4DRA A;  1P3L A;  3AZG C;  4ZBJ B;  3MGS D;  5JRG D;  3KUY B;  2BYK A;  1M18 A;  3REI A;  5F99 D;  4J8V A;  3KWQ D;  3AZE C;  3C1C B;  3AZN A;  3KXB A;  1ZLA B;  3VH6 W;  3AZL B;  1HQ3 B;  2L5A A;  4YM6 A;  3MVD A;  5B0Z C;  3KUY D;  3W96 A;  1N1J B;  3REJ A;  1P3P A;  2PYO A;  3C1C D;  1ZLA D;  5BS7 C;  3AZJ B;  5CPI A;  4J8W A;  4CSR B;  3AZL D;  1HQ3 D; 
#chains in the Genus database with same CATH topology
 2JSS A;  2F8N H;  3NQJ A;  5B40 C;  4H9O B;  1KU5 A;  3AV2 B;  3UTB A;  5GSU B;  3LEL A;  2HIO A;  5B33 C;  3REK C;  3AZJ D;  5B32 C;  1P3A C;  3B0C W;  1BH8 A;  3REL B;  1F66 B;  5G49 B;  5KDM A;  5FUG B;  3UTA A;  3W99 B;  3KFU G;  3AZM C;  3EPJ A;  4JJN C;  3MGS A;  5JRG A;  3AZK C;  3MNN B;  1AOI C;  3A1K A;  3AV2 D;  5GT0 B;  2FJ7 C;  5GSU D;  5B2J C;  5DNM C;  5GT3 B;  5F99 A;  3WTP C;  3KWQ A;  3UT9 A;  2CV5 C;  3AN2 B;  3REL D;  1F66 D;  3X1V A;  1JFI B;  5C3I C;  1WWS A;  3W99 D;  3AV1 C;  5BT1 D;  4ZUX B;  3F6T A;  3KUY A;  3MNN D;  5BO0 B;  3B6F B;  5CPK B;  5GT0 D;  1TAF B;  1P3G C;  3IP4 C;  2ARO C;  4G91 C;  4X23 C;  5GT3 D;  5BNX B;  4KUD B;  5DNN C;  3C1C A;  1ID3 C;  1ZLA A;  3AN2 D;  4DRB A;  4J8X B;  5AV9 C;  4H9S A;  5CPJ C;  3AYW C;  3VH5 W;  5B31 B;  1BFM A;  3MGR B;  3AZL A;  1HQ3 A;  2BYM B;  1Q9C A;  4ZUX D;  1ULY A;  3O62 B;  3MVD B;  3B6F D;  5CPK D;  5AV5 C;  1N1J A;  2ZM5 A;  1P3I C;  5GXQ B;  1EQZ B;  1KX4 C;  1P34 B;  2YFV B;  5AVC C;  1P3M C;  1P3O B;  1M19 B;  4KUD D;  4KHA B;  3WA9 B;  4J8X D;  5B0Y C;  3AZJ A;  3KSY A;  1P3K B;  1M1A C;  3A6N C;  5B31 D;  3AZH B;  4CSR A;  5AV6 B;  3AZG B;  5E5A C;  3O62 D;  4H9O A;  3MGP C;  2HUE C;  5GXQ D;  3AV2 A;  1EQZ D;  3MGQ C;  1F1E A;  1P34 D;  5GSU A;  1P3O D;  1M19 D;  3WA9 D;  3AZE B;  2DQN C;  4HGA B;  1P3K D;  1KX3 C;  4Z2M H;  3REL A;  2J8P A;  1F66 A;  5G49 A;  3AZH D;  5FUG A;  5BNV B;  5AV6 D;  3W99 A;  3AZG D;  2NZD C;  1S32 C;  3MNN A;  5GT0 A;  5B1M B;  5GT3 A;  3EPK A;  4YS3 B;  3AZE D;  5CP6 C;  3AN2 A;  3W97 C;  4UUZ B;  1JFI A;  1P3F B;  4WU9 C;  4H9P A;  3X1U C;  4J8V C;  4ZUX A;  5B40 B;  3C1B C;  3AZN C;  5BO0 A;  3KXB C;  5CPK A;  3B6F A;  1TAF A;  2Y2G A;  3B6G C;  5B1M D;  4YS3 D;  5BNX A;  3REH B;  4WU8 B;  1B6W A;  4KUD A;  5B33 B;  4Z66 B;  4Z5T B;  3W98 C;  1HTA A;  2Y2O A;  4G92 C;  3REK B;  4J8X A;  1P3B C;  5B31 A;  1P3F D;  2NQB C;  3MGR A;  3REJ C;  1P3P C;  2BYM A;  5B40 D;  3O62 A;  1AOI B;  1EQZ A;  5GXQ A;  5CPI C;  4QLC C;  1KX5 B;  2IO5 C;  2YFV A;  3FDD A;  5B2J B;  1P34 A;  1P3O A;  5DNM B;  1M19 A;  3REH D;  4WU8 D;  4KHA A;  5B33 D;  4Z66 D;  3WA9 A;  4Z5T D;  3WAA B;  3REK D;  1P3K A;  2CV5 B;  5B24 C;  4H9R B;  3UTB C;  3AZH A;  5B31 G;  5AV6 A;  3LEL C;  2HIO C;  4R8P C;  5AV8 C;  3AZG A;  3AV1 B;  5JA4 B;  1AOI D;  2FJ7 D;  2ZY3 A;  1KX5 D;  5B2J D;  5DNM D;  3X1S B;  3WAA D;  1TZY C;  3AZE A;  4EO5 B;  5AY8 B;  2CV5 D;  5CPJ B;  3AYW B;  5BNV A;  3AV1 D;  3KWQ C;  3UT9 C;  5AV5 B;  5B2I B;  1KX4 B;  2F8N D;  3X1V C;  1P3M B;  3X1T C;  5B1M A;  1U35 B;  3X1S D;  4YS3 A;  2Y2H A;  4ZBJ C;  5AY8 D;  3AZI B;  3KUY C;  1M1A B;  5CPJ D;  1BH9 B;  2Y2J A;  4NE3 A;  4UUZ A;  3AYW D;  1WWI A;  1P3F A;  2JCH A;  4H9P B;  5E5A B;  5B40 A;  3C1C C;  3MGP B;  1ZLA C;  5AV5 D;  5B2I D;  4KGC C;  3MGQ B;  1KX4 D;  4H9N B;  5AVC D;  1U35 D;  1P3M D;  3AZL C;  1HQ3 C;  3REH A;  4WU8 A;  5B33 A;  4Z66 A;  4Z5T A;  2Y2I A;  3AZI D;  3REK A;  4LD9 B;  1M1A D;  3TU4 C;  3AFA B;  5E5A D;  3MGP D;  4XZQ C;  1AOI A;  1PZR A;  2FJ7 A;  3MGQ D;  5AVB B;  1KX5 A;  5B2J A;  5DNM A;  4AWL B;  3WAA A;  5CP6 B;  1R4V A;  4LD9 D;  5B1L C;  2CV5 A;  3W97 B;  4H9R A;  5B32 G;  3AZF C;  3AFA D;  4J8U C;  5GSU C;  3LZ0 C;  4WU9 B;  3X1U B;  3B0D C;  3NQU B;  3AV1 A;  4E45 A;  2NZD D;  3LZ1 C;  5JA4 A;  3C1B B;  3EPL A;  4CAY B;  5AVB D;  2F8N A;  3B6G B;  4XUJ C;  3X1S A;  4WJ3 C;  3H0M C;  5CP6 D;  3VH6 A;  3W98 B;  5AY8 A;  3W97 D;  1P3B B;  5GT0 C;  5CPJ A;  2RVQ D;  3AYW A;  2NQB B;  4WU9 D;  3X1U D;  2F8N K;  3C1B D;  2ZY2 A;  5B0Z B;  3LJA C;  3V9R B;  2Y2M A;  5AV5 A;  5B2I A;  1W2E A;  4QLC B;  1KX4 A;  3B6G D;  1P3M A;  1U35 A;  2F8N G;  2XD1 A;  3WKJ C;  3W98 D;  3H0R C;  3AZI A;  1P3L C;  5B24 B;  4NE6 A;  1A7W A;  5CPK C;  1P3B D;  1BH9 A;  1M1A A;  2NQB D;  4R8P B;  5AV8 B;  5E5A A;  3MGP A;  3REI C;  5B0Z D;  1M18 C;  3AL0 C;  4QLC D;  3MGQ A;  2Y2N A;  4H9N A;  5B31 C;  2FFF B;  3MGR C;  1TZY B;  2UWX A;  4YM6 C;  3MVD C;  4LD9 A;  5B24 D;  3H0L C;  4H9Q B;  3W96 C;  5B32 B;  3AFA A;  1P3A B;  1P3F C;  1P34 C;  4R8P D;  5AV8 D;  2JE5 A;  2PYO C;  3AZM B;  4WV4 B;  4JJN B;  2Y2K A;  3AZK B;  5AVB A;  2FJ7 B;  4DQY B;  3AZH C;  3X1T B;  4J8W C;  5AV6 C;  1TZY D;  2F2A C;  3R45 B;  5CP6 A;  3VH6 T;  3WTP B;  3W97 A;  5B32 D;  1P3A D;  2DF4 C;  4WU9 A;  3X1U A;  1Z2C B;  5C3I B;  3NQU A;  3C1B A;  3UT9 D;  3AZM D;  4HGA C;  4JJN D;  4KGC B;  1H3O B;  4CAY A;  3AZK D;  4M6B A;  2YFW A;  3X1V D;  4X23 B;  2ARO B;  4G91 B;  3X1T D;  1P3G B;  3B6G A;  2F8N B;  4WNN B;  3UTA C;  3W98 A;  3WTP D;  5DNN B;  3B0B A;  3TU4 B;  3MGS C;  1P3B A;  5JRG C;  1ID3 B;  3VH5 A;  5AV9 B;  2NQB A;  5B1M C;  4NFT A;  4YS3 C;  2G5H C;  4XZQ B;  5B0Z A;  5F99 C;  3V9R A;  4KGC D;  4QLC A;  1P3I B;  1P3G D;  4X23 D;  2ARO D;  5AVC B;  3P5J B;  5DNN D;  5B1L B;  3TU4 D;  5B24 A;  1ID3 D;  3B0C T;  5BS7 A;  5AV9 D;  5B0Y B;  3AZF B;  3A6N B;  1T3U A;  4J8U B;  3LZ0 B;  2Y2Q A;  3B0D B;  4R8P A;  5AV8 A;  3REH C;  4WU8 C;  4XZQ D;  4Z66 C;  4Z2M G;  4Z5T C;  3LZ1 B;  1P3I D;  2HUE B;  4H9S C;  4XUJ B;  4WZS B;  1TZY A;  3WTP E;  5B1L D;  4H9Q A;  5B0Y D;  3AZF D;  1KX3 B;  5B32 A;  3A6N D;  1P3A A;  4J8U D;  3LZ0 D;  1KX5 C;  5CHL B;  3LZ1 D;  3WAA C;  3AZM A;  3LJA B;  4JJN A;  2NZD B;  1S32 B;  3AZK A;  3AZJ C;  4XUJ D;  3X1T A;  2RIQ A;  3R45 A;  3WKJ B;  1P3L B;  3WTP A;  1KX3 D;  2BG1 A;  3VH5 T;  3AV2 C;  2BYK B;  4E44 A;  3X1S C;  2W8S A;  4EO5 C;  3REI B;  3LJA D;  1M18 B;  4J8V B;  5AY8 C;  4KGC A;  1H3O A;  1S32 D;  2CWE A;  3AZN B;  3KXB B;  1P3G A;  4X23 A;  2ARO A;  2LY8 A;  3REL C;  2YFW B;  1F66 C;  4WNN A;  3WKJ D;  3W99 C;  4YM6 B;  1P3L D;  5DNN A;  5BT1 C;  3TU4 A;  1ID3 A;  4G92 B;  5B2I C;  5AV9 A;  3MNN C;  3W96 B;  3A1I A;  1U35 C;  3REJ B;  1P3P B;  1M18 D;  4XZQ A;  5GT3 C;  3REI D;  4J8V D;  2PYO B;  3AZI C;  3AZN D;  2G5I C;  3KXB D;  3AN2 C;  1P3I A;  5CPI B;  3MGR D;  4J8W B;  2IO5 B;  5AVC A;  2Y2L A;  4YM6 D;  3MVD D;  5B1L A;  3EPH A;  4ZUX C;  3NQJ B;  2ZY5 A;  5B0Y A;  3AZF A;  3B6F C;  3W96 D;  3A6N A;  4J8U A;  3LZ0 A;  3UTB B;  3REJ D;  1P3P D;  3LEL B;  2HIO B;  3LZ1 A;  2PYO D;  4KUD C;  4LD9 C;  4J8X C;  5CPI D;  3AFA C;  1BH8 B;  4XUJ A;  4J8W D;  5KDM B;  3UTA B;  4NE5 A;  1B67 A;  3O62 C;  3MGS B;  5JRG B;  1KX3 A;  5AVB C;  1EQZ C;  5GXQ C;  3UTB D;  4AWL C;  2VQR A;  3LEL D;  2HIO D;  1P3O C;  1M19 C;  3LJA A;  5F99 B;  2NZD A;  3WA9 C;  3KWQ B;  1S32 A;  3UT9 B;  1P3K C;  2RVQ C;  3X1V B;  3UTA D;  2Y2P A;  3WKJ A;  4DRA A;  1P3L A;  3AZG C;  4ZBJ B;  3MGS D;  5JRG D;  3KUY B;  2BYK A;  2XD5 A;  1M18 A;  3REI A;  3EG5 B;  5F99 D;  4J8V A;  3KWQ D;  3AZE C;  3C1C B;  3AZN A;  3KXB A;  1ZLA B;  3VH6 W;  4UPK A;  3AZL B;  1HQ3 B;  2L5A A;  4YM6 A;  3MVD A;  5B0Z C;  3KUY D;  3W96 A;  1N1J B;  2ZY4 A;  3REJ A;  1P3P A;  2PYO A;  3C1C D;  1ZLA D;  5BS7 C;  3AZJ B;  5CPI A;  4J8W A;  4CSR B;  3AZL D;  1HQ3 D; 
#chains in the Genus database with same CATH homology
 2JSS A;  2F8N H;  3NQJ A;  5B40 C;  4H9O B;  1KU5 A;  3AV2 B;  3UTB A;  5GSU B;  3LEL A;  2HIO A;  5B33 C;  3REK C;  3AZJ D;  5B32 C;  1P3A C;  3B0C W;  1BH8 A;  3REL B;  1F66 B;  5G49 B;  5KDM A;  5FUG B;  3UTA A;  3W99 B;  3KFU G;  3AZM C;  3EPJ A;  4JJN C;  3MGS A;  5JRG A;  3AZK C;  3MNN B;  1AOI C;  3A1K A;  3AV2 D;  5GT0 B;  2FJ7 C;  5GSU D;  5B2J C;  5DNM C;  5GT3 B;  5F99 A;  3WTP C;  3KWQ A;  3UT9 A;  2CV5 C;  3AN2 B;  3REL D;  1F66 D;  3X1V A;  1JFI B;  5C3I C;  1WWS A;  3W99 D;  3AV1 C;  5BT1 D;  4ZUX B;  3F6T A;  3KUY A;  3MNN D;  5BO0 B;  3B6F B;  5CPK B;  5GT0 D;  1TAF B;  1P3G C;  3IP4 C;  2ARO C;  4G91 C;  4X23 C;  5GT3 D;  5BNX B;  4KUD B;  5DNN C;  3C1C A;  1ID3 C;  1ZLA A;  3AN2 D;  4DRB A;  4J8X B;  5AV9 C;  4H9S A;  5CPJ C;  3AYW C;  3VH5 W;  5B31 B;  1BFM A;  3MGR B;  3AZL A;  1HQ3 A;  2BYM B;  1Q9C A;  4ZUX D;  1ULY A;  3O62 B;  3MVD B;  3B6F D;  5CPK D;  5AV5 C;  1N1J A;  2ZM5 A;  1P3I C;  5GXQ B;  1EQZ B;  1KX4 C;  1P34 B;  2YFV B;  5AVC C;  1P3M C;  1P3O B;  1M19 B;  4KUD D;  4KHA B;  3WA9 B;  4J8X D;  5B0Y C;  3AZJ A;  3KSY A;  1P3K B;  1M1A C;  3A6N C;  5B31 D;  3AZH B;  4CSR A;  5AV6 B;  3AZG B;  5E5A C;  3O62 D;  4H9O A;  3MGP C;  2HUE C;  5GXQ D;  3AV2 A;  1EQZ D;  3MGQ C;  1F1E A;  1P34 D;  5GSU A;  1P3O D;  1M19 D;  3WA9 D;  3AZE B;  2DQN C;  4HGA B;  1P3K D;  1KX3 C;  4Z2M H;  3REL A;  2J8P A;  1F66 A;  5G49 A;  3AZH D;  5FUG A;  5BNV B;  5AV6 D;  3W99 A;  3AZG D;  2NZD C;  1S32 C;  3MNN A;  5GT0 A;  5B1M B;  5GT3 A;  3EPK A;  4YS3 B;  3AZE D;  5CP6 C;  3AN2 A;  3W97 C;  4UUZ B;  1JFI A;  1P3F B;  4WU9 C;  4H9P A;  3X1U C;  4J8V C;  4ZUX A;  5B40 B;  3C1B C;  3AZN C;  5BO0 A;  3KXB C;  5CPK A;  3B6F A;  1TAF A;  2Y2G A;  3B6G C;  5B1M D;  4YS3 D;  5BNX A;  3REH B;  4WU8 B;  1B6W A;  4KUD A;  5B33 B;  4Z66 B;  4Z5T B;  3W98 C;  1HTA A;  2Y2O A;  4G92 C;  3REK B;  4J8X A;  1P3B C;  5B31 A;  1P3F D;  2NQB C;  3MGR A;  3REJ C;  1P3P C;  2BYM A;  5B40 D;  3O62 A;  1AOI B;  1EQZ A;  5GXQ A;  5CPI C;  4QLC C;  1KX5 B;  2IO5 C;  2YFV A;  3FDD A;  5B2J B;  1P34 A;  1P3O A;  5DNM B;  1M19 A;  3REH D;  4WU8 D;  4KHA A;  5B33 D;  4Z66 D;  3WA9 A;  4Z5T D;  3WAA B;  3REK D;  1P3K A;  2CV5 B;  5B24 C;  4H9R B;  3UTB C;  3AZH A;  5B31 G;  5AV6 A;  3LEL C;  2HIO C;  4R8P C;  5AV8 C;  3AZG A;  3AV1 B;  5JA4 B;  1AOI D;  2FJ7 D;  2ZY3 A;  1KX5 D;  5B2J D;  5DNM D;  3X1S B;  3WAA D;  1TZY C;  3AZE A;  4EO5 B;  5AY8 B;  2CV5 D;  5CPJ B;  3AYW B;  5BNV A;  3AV1 D;  3KWQ C;  3UT9 C;  5AV5 B;  5B2I B;  1KX4 B;  2F8N D;  3X1V C;  1P3M B;  3X1T C;  5B1M A;  1U35 B;  3X1S D;  4YS3 A;  2Y2H A;  4ZBJ C;  5AY8 D;  3AZI B;  3KUY C;  1M1A B;  5CPJ D;  1BH9 B;  2Y2J A;  4NE3 A;  4UUZ A;  3AYW D;  1WWI A;  1P3F A;  2JCH A;  4H9P B;  5E5A B;  5B40 A;  3C1C C;  3MGP B;  1ZLA C;  5AV5 D;  5B2I D;  4KGC C;  3MGQ B;  1KX4 D;  4H9N B;  5AVC D;  1U35 D;  1P3M D;  3AZL C;  1HQ3 C;  3REH A;  4WU8 A;  5B33 A;  4Z66 A;  4Z5T A;  2Y2I A;  3AZI D;  3REK A;  4LD9 B;  1M1A D;  3TU4 C;  3AFA B;  5E5A D;  3MGP D;  4XZQ C;  1AOI A;  1PZR A;  2FJ7 A;  3MGQ D;  5AVB B;  1KX5 A;  5B2J A;  5DNM A;  4AWL B;  3WAA A;  5CP6 B;  1R4V A;  4LD9 D;  5B1L C;  2CV5 A;  3W97 B;  4H9R A;  5B32 G;  3AZF C;  3AFA D;  4J8U C;  5GSU C;  3LZ0 C;  4WU9 B;  3X1U B;  3B0D C;  3NQU B;  3AV1 A;  4E45 A;  2NZD D;  3LZ1 C;  5JA4 A;  3C1B B;  3EPL A;  4CAY B;  5AVB D;  2F8N A;  3B6G B;  4XUJ C;  3X1S A;  4WJ3 C;  3H0M C;  5CP6 D;  3VH6 A;  3W98 B;  5AY8 A;  3W97 D;  1P3B B;  5GT0 C;  5CPJ A;  2RVQ D;  3AYW A;  2NQB B;  4WU9 D;  3X1U D;  2F8N K;  3C1B D;  2ZY2 A;  5B0Z B;  3LJA C;  3V9R B;  2Y2M A;  5AV5 A;  5B2I A;  1W2E A;  4QLC B;  1KX4 A;  3B6G D;  1P3M A;  1U35 A;  2F8N G;  2XD1 A;  3WKJ C;  3W98 D;  3H0R C;  3AZI A;  1P3L C;  5B24 B;  4NE6 A;  1A7W A;  5CPK C;  1P3B D;  1BH9 A;  1M1A A;  2NQB D;  4R8P B;  5AV8 B;  5E5A A;  3MGP A;  3REI C;  5B0Z D;  1M18 C;  3AL0 C;  4QLC D;  3MGQ A;  2Y2N A;  4H9N A;  5B31 C;  2FFF B;  3MGR C;  1TZY B;  2UWX A;  4YM6 C;  3MVD C;  4LD9 A;  5B24 D;  3H0L C;  4H9Q B;  3W96 C;  5B32 B;  3AFA A;  1P3A B;  1P3F C;  1P34 C;  4R8P D;  5AV8 D;  2JE5 A;  2PYO C;  3AZM B;  4WV4 B;  4JJN B;  2Y2K A;  3AZK B;  5AVB A;  2FJ7 B;  4DQY B;  3AZH C;  3X1T B;  4J8W C;  5AV6 C;  1TZY D;  2F2A C;  3R45 B;  5CP6 A;  3VH6 T;  3WTP B;  3W97 A;  5B32 D;  1P3A D;  2DF4 C;  4WU9 A;  3X1U A;  1Z2C B;  5C3I B;  3NQU A;  3C1B A;  3UT9 D;  3AZM D;  4HGA C;  4JJN D;  4KGC B;  1H3O B;  4CAY A;  3AZK D;  4M6B A;  2YFW A;  3X1V D;  4X23 B;  2ARO B;  4G91 B;  3X1T D;  1P3G B;  3B6G A;  2F8N B;  4WNN B;  3UTA C;  3W98 A;  3WTP D;  5DNN B;  3B0B A;  3TU4 B;  3MGS C;  1P3B A;  5JRG C;  1ID3 B;  3VH5 A;  5AV9 B;  2NQB A;  5B1M C;  4NFT A;  4YS3 C;  2G5H C;  4XZQ B;  5B0Z A;  5F99 C;  3V9R A;  4KGC D;  4QLC A;  1P3I B;  1P3G D;  4X23 D;  2ARO D;  5AVC B;  3P5J B;  5DNN D;  5B1L B;  3TU4 D;  5B24 A;  1ID3 D;  3B0C T;  5BS7 A;  5AV9 D;  5B0Y B;  3AZF B;  3A6N B;  1T3U A;  4J8U B;  3LZ0 B;  2Y2Q A;  3B0D B;  4R8P A;  5AV8 A;  3REH C;  4WU8 C;  4XZQ D;  4Z66 C;  4Z2M G;  4Z5T C;  3LZ1 B;  1P3I D;  2HUE B;  4H9S C;  4XUJ B;  4WZS B;  1TZY A;  3WTP E;  5B1L D;  4H9Q A;  5B0Y D;  3AZF D;  1KX3 B;  5B32 A;  3A6N D;  1P3A A;  4J8U D;  3LZ0 D;  1KX5 C;  5CHL B;  3LZ1 D;  3WAA C;  3AZM A;  3LJA B;  4JJN A;  2NZD B;  1S32 B;  3AZK A;  3AZJ C;  4XUJ D;  3X1T A;  2RIQ A;  3R45 A;  3WKJ B;  1P3L B;  3WTP A;  1KX3 D;  2BG1 A;  3VH5 T;  3AV2 C;  2BYK B;  4E44 A;  3X1S C;  2W8S A;  4EO5 C;  3REI B;  3LJA D;  1M18 B;  4J8V B;  5AY8 C;  4KGC A;  1H3O A;  1S32 D;  2CWE A;  3AZN B;  3KXB B;  1P3G A;  4X23 A;  2ARO A;  2LY8 A;  3REL C;  2YFW B;  1F66 C;  4WNN A;  3WKJ D;  3W99 C;  4YM6 B;  1P3L D;  5DNN A;  5BT1 C;  3TU4 A;  1ID3 A;  4G92 B;  5B2I C;  5AV9 A;  3MNN C;  3W96 B;  3A1I A;  1U35 C;  3REJ B;  1P3P B;  1M18 D;  4XZQ A;  5GT3 C;  3REI D;  4J8V D;  2PYO B;  3AZI C;  3AZN D;  2G5I C;  3KXB D;  3AN2 C;  1P3I A;  5CPI B;  3MGR D;  4J8W B;  2IO5 B;  5AVC A;  2Y2L A;  4YM6 D;  3MVD D;  5B1L A;  3EPH A;  4ZUX C;  3NQJ B;  2ZY5 A;  5B0Y A;  3AZF A;  3B6F C;  3W96 D;  3A6N A;  4J8U A;  3LZ0 A;  3UTB B;  3REJ D;  1P3P D;  3LEL B;  2HIO B;  3LZ1 A;  2PYO D;  4KUD C;  4LD9 C;  4J8X C;  5CPI D;  3AFA C;  1BH8 B;  4XUJ A;  4J8W D;  5KDM B;  3UTA B;  4NE5 A;  1B67 A;  3O62 C;  3MGS B;  5JRG B;  1KX3 A;  5AVB C;  1EQZ C;  5GXQ C;  3UTB D;  4AWL C;  2VQR A;  3LEL D;  2HIO D;  1P3O C;  1M19 C;  3LJA A;  5F99 B;  2NZD A;  3WA9 C;  3KWQ B;  1S32 A;  3UT9 B;  1P3K C;  2RVQ C;  3X1V B;  3UTA D;  2Y2P A;  3WKJ A;  4DRA A;  1P3L A;  3AZG C;  4ZBJ B;  3MGS D;  5JRG D;  3KUY B;  2BYK A;  2XD5 A;  1M18 A;  3REI A;  3EG5 B;  5F99 D;  4J8V A;  3KWQ D;  3AZE C;  3C1C B;  3AZN A;  3KXB A;  1ZLA B;  3VH6 W;  4UPK A;  3AZL B;  1HQ3 B;  2L5A A;  4YM6 A;  3MVD A;  5B0Z C;  3KUY D;  3W96 A;  1N1J B;  2ZY4 A;  3REJ A;  1P3P A;  2PYO A;  3C1C D;  1ZLA D;  5BS7 C;  3AZJ B;  5CPI A;  4J8W A;  4CSR B;  3AZL D;  1HQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...