1EQZA

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
total genus 33
structure length 125
sequence length 125
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzA00
1P3KC 5AV8B 4WNNB 1P3IA 3LELA 3UTAC 5B2JC 2FJ7D 3AZGD 3KSYA 5B31C 4G92B 3A6NB 5C3IC 2AROB 3WTPB 5AV5C 1M1AC 1A7WA 3AYWB 5B32B 3AZEC 5AY8B 1P3KA 1EQZB 2HIOC 4NE3A 5B2IC 3AZJB 3UTAA 5B2JA 3REJD 4JJNC 5B31A 5BO0A 1BH9B 2F8NA 5AV8D 3O62C 5AV5A 1P3AC 2JSSA 1M1AA 4LD9B 1H3OB 5BNVA 5AV9C 4H9OB 3AZEA 2HIOA 3AV2B 5B2IA 2AROD 3WTPD 3X1VB 5E5AB 3AFAC 4JJNA 3AYWD 4NE6A 5B0YC 5GSUC 2NQBB 3O62A 1N1JB 1P3AA 3WAAC 3AZHC 3WTPE 3AZJD 3REIB 5AV9A 3AZFB 3VH6T 4ZUXB 1P3LB 3AFAA 3B6GC 5CHLB 4LD9D 5GT3C 3VH5T 5BNXB 5GSUA 5B0YA 3AV2D 3WAAA 3AZHA 5GXQB 5DNNB 3NQJB 5B24D 2CWEA 1HQ3C 3W96C 5E5AD 3X1VD 4WU8C 2NQBD 3V9RB 3B6GA 1ID3C 4UUZA 5GT3A 3REID 3AZFD 3UTBC 4H9PA 5DNMC 1AOIB 4ZUXD 5GT3D 4KGCC 1HQ3A 3W96A 4QLCC 4WU8A 3RELD 3X1SC 4CAYA 1KX5B 4NFTA 5JRGB 5GXQD 5B1MC 1ID3A 2BYMA 3KXBB 3UTBA 2IO5B 5DNMA 3X1TC 3AZIB 4KGCA 4KUDC 3X1SA 4QLCA 4Z66C 1ZLAC 5BT1D 3MNNB 1P34D 3W98B 4X23C 3C1CC 5BS7C 1F1EA 5B1MA 3X1SD 1JFIA 3C1BB 3TU4B 4DRBA 3X1TA 1KX5D 5JRGD 3WKJC 4KUDA 3LZ0B 4Z66A 1ZLAA 3B0DB 3MVDC 3X1TD 3KXBD 4HGAC 4X23A 3MGPB 3MGQB 3C1CA 5BS7A 5AVBC 4ZBJB 3AZID 3MGRB 4XUJB 4YS3B 2RVQC 4J8VB 3MNND 2CV5C 3W98D 3LJAC 1M19D 2LY8A 1WWSA 3WKJA 3AZLB 5GT0C 3KWQC 5AVCB 3MVDA 3C1BD 3X1UB 3TU4D 1M18B 4J8WC 5AVBA 5F99B 5CPJB 4Z2MG 3LZ0D 2CV5A 3UT9C 3LJAA 3AZMD 2HUEC 1P3OD 2FJ7B 2NZDC 3MGPD 3MGQD 4G91B 5GT0A 3KWQA 1P3IB 3LELB 5FUGA 1Q9CA 3MGRD 4YS3D 4J8WA 4J8VD 4H9RB 3WA9D 4M6BA 3AZLD 2F8NH 5B33C 5AVCD 4YM6C 3X1UD 3UT9A 1M18D 2NZDA 1KX3D 3REJB 1F66C 1P3KB 5F99D 5CPIC 5CPJD 3R45A 1S32C 4H9NA 3W97C 5B2JB 5B40C 3B0CW 5B31B 5BO0B 5C3IB 2PYOC 1BH8A 2F8NB 5AV5B 3AZKC 5B33A 1P3ID 3LELD 4YM6A 4EO5C 1M1AB 1TAFA 1F66A 5BNVB 3AZEB 1P3FC 3AV1C 2YFVA 5CPIA 1S32A 5B32G 3W97A 5B40A 4JJNB 2PYOA 3W99C 3REHC 1P3KD 3O62B 1P3GC 3AZKA 1P3AB 3UTAD 5B2JD 3REKC 5AV9B 1KU5A 5B31D 3AV1A 5CPKC 1P3FA 2F8ND 3NQUA 5G49A 5AV5D 3AFAB 1M1AD 4AWLB 3W99A 3REHA 5B0YB 5GSUB 5B24B 3AZED 3A6NC 2HIOD 1P3GA 5B2ID 3AZHB 3REKA 4JJND 4DRAA 5CPKA 5B32C 1EQZC 3O62D 1P3AD 4H9QA 5GT3B 5AV9D 3A6NA 3RELB 5B1LC 5KDMA 3AFAD 3W96B 3KUYC 4WU8B 4CAYB 5B32A 4WV4B 5GSUD 5B0YD 1EQZA 3WAAD 3AZHD 2BYMB 1P34B 5DNMB 5B1LA 3B6GD 3MGSC 3KUYA 3X1SB 4QLCB 4H9SC 1JFIB 1P3LC 1HQ3D 3W96D 4Z5TC 1U35C 4WU8D 3X1TB 3MGSA 4Z66B 5DNNC 1ID3D 4CSRB 4KHAA 4H9SA 4X23B 3UTBD 3C1CB 5DNMD 1P3LA 1M19B 4KGCD 4Z5TA 1U35A 4QLCD 4J8XC 1TZYC 3WKJB 5B1MD 1AOIC 5DNNA 3B6FC 3NQJA 3MVDB 4HGAB 3AZMB 1P3OB 3V9RA 1ULYA 4KUDD 1P3MC 4Z66D 2CV5B 1ZLAD 4J8XA 1P3PC 3LJAB 4X23D 1TZYA 5AV6C 3C1CD 5GT0B 1AOIA 3B6FA 3KWQB 3WA9B 5FUGB 4E44A 3LZ1C 3AZNC 3WKJD 1KX3B 1P3MA 3MVDD 3UT9B 1P3PA 2HUEB 5AV6A 2NZDB 4WU9C 1P3MD 5AVBD 3R45B 5CP6C 4H9NB 1KX4C 2RVQD 3B0DC 2CV5D 3LJAD 4R8PC 1BH8B 3LZ1A 3VH5A 3VH5W 3AZNA 5GT0D 5B33B 3KWQD 4J8UC 4YM6B 1TAFB 3AZND 4J8WD 4WU9A 1F66B 2YFVB 5CP6A 4NE5A 5B40B 1P3BC 1KX4A 4XZQC 3UT9D 2PYOB 4R8PA 3UTAB 2NZDD 5B31G 4J8UA 2F8NG 1P3FB 3AV1B 5JA4A 2FJ7C 3AZGC 3NQUB 5G49B 1P3BA 2HIOB 5B33D 3AN2C 4YM6D 4XZQA 5B2IB 3W99B 1F66D 5CPID 1P3GB 3B0BA 5B0ZC 1S32D 3W97D 5B40D 3REKB 2YFWA 5CPKB 2PYOD 2FJ7A 3AZGA 1WWIA 3REJC 3AZKD 3AN2A 4H9QB 5AV8C 2BYKA 1P3FD 3AV1D 4H9RA 3AN2D 5B0ZA 4G92C 5KDMB 3WAAB 3W99D 2AROC 5B0ZD 3REHD 3WTPC 3REJA 1P3GD 3AYWC 5AY8C 4WNNA 5AV8A 3REKD 5CPKD 3B6GB 3AZJC 4UUZB 5B1LB 4H9PB 3KUYB 2AROA 3WTPA 1HQ3B 1R4VA 3A6ND 2L5AA 3AYWA 4LD9C 5AY8A 3AV2C 3AZJA 4AWLC 1ID3B 5B32D 5B24C 3X1VC 5E5AC 5AY8D 1EQZD 3UTBB 3MGSB 1BH9A 2NQBC 4KHAB 4KGCB 4LD9A 3REIC 1H3OA 3AZFC 4H9OA 5B1LD 4Z5TB 3AV2A 1U35B 3KUYD 5B1MB 4ZUXC 1B6WA 5B24A 3X1VA 5E5AA 3RELC 2NQBA 4KUDB 1N1JA 5GXQC 1ZLAB 3REIA 3AZFA 1HTAA 3MGSD 4ZUXA 4J8XB 3B0CT 1TZYB 3RELA 5BT1C 1P34C 5BNXA 3B6FB 1P3LD 4Z5TD 1U35D 5GXQA 1BFMA 1P3MB 5AVBB 5DNND 1KX5C 1P3PB 5JRGC 5AV6B 1P34A 4E45A 3KXBC 2IO5C 4J8XD 3AZIC 1TZYD 3LZ1B 3AZNB 4J8WB 3MNNC 1AOID 3B6FD 3W98C 1KX5A 1M19C 5JRGA 4WU9B 3C1BC 3KXBA 3TU4C 5CP6B 1KX4B 3VH6A 3VH6W 4CSRA 1B67A 3AZIA 1P3PD 4R8PB 5AV6D 3LZ0C 3MNNA 3W98A 3AZMC 4J8UB 1P3OC 1M19A 3MGPC 3MGQC 4Z2MH 4ZBJC 3C1BA 5JA4B 3MGRC 3TU4A 4XUJC 3LZ1D 4YS3C 4J8VC 4WZSB 1P3BB 5CPIB 3WA9C 4XZQB 1S32B 3W97B 3AZLC 3LZ0A 4WU9D 5AVCC 3X1UC 3AZMA 1M18C 1P3OA 5CP6D 3MGPA 3MGQA 1KX3C 1KX4D 5F99C 5CPJC 2YFWB 3AZKB 4EO5B 4R8PD 3MGRA 4XUJA 3AZGB 4YS3A 4J8VA 3AN2B 3WA9A 4J8UD 4G91C 4XUJD 3AZLA 2F8NK 2BYKB 5AVCA 3LELC 3X1UA 1P3IC 1M18A 5B0ZB 3REHB 1KX3A 1P3BD 5F99A 5CPJA 4XZQD
chains in the Genus database with same CATH superfamily
1P3KC 5AV8B 4WNNB 1P3IA 3LELA 3UTAC 5B2JC 2FJ7D 3AZGD 3KSYA 5B31C 4G92B 3A6NB 5C3IC 2AROB 3WTPB 5AV5C 1M1AC 2UWXA 1A7WA 3AYWB 5B32B 3AZEC 5AY8B 2G5IC 1P3KA 2HIOC 1EQZB 4NE3A 3H0MC 5B2IC 3AZJB 3UTAA 5B2JA 3REJD 4JJNC 5B31A 5BO0A 1BH9B 2Y2NA 2F8NA 5AV8D 3O62C 5AV5A 1P3AC 2JSSA 1M1AA 4UPKA 4LD9B 1H3OB 5BNVA 5AV9C 4H9OB 3AZEA 2HIOA 3AV2B 5B2IA 2AROD 2Y2LA 3WTPD 3X1VB 5E5AB 3AFAC 4JJNA 3AYWD 4NE6A 5B0YC 5GSUC 3H0LC 2NQBB 3O62A 1N1JB 1P3AA 3WAAC 3AZHC 2Y2QA 3WTPE 3AZJD 3REIB 5AV9A 3AZFB 3VH6T 4ZUXB 1P3LB 3AFAA 3B6GC 5CHLB 2XD5A 4LD9D 5GT3C 3VH5T 5BNXB 5GSUA 5B0YA 4DQYB 3AV2D 3WAAA 3AZHA 5GXQB 5DNNB 3NQJB 5B24D 2CWEA 1HQ3C 3W96C 5E5AD 3X1VD 4WU8C 2NQBD 3EG5B 3V9RB 3B6GA 1ID3C 4UUZA 5GT3A 3REID 3AZFD 3UTBC 4H9PA 5DNMC 1AOIB 4ZUXD 5GT3D 4KGCC 1HQ3A 2Y2IA 3W96A 2Y2GA 4QLCC 4WU8A 3RELD 3X1SC 4CAYA 1KX5B 4NFTA 5JRGB 5GXQD 5B1MC 1ID3A 2BYMA 3KXBB 3EPJA 3UTBA 2IO5B 5DNMA 3X1TC 3AZIB 4KGCA 4KUDC 3X1SA 4QLCA 4Z66C 1ZLAC 5BT1D 3MNNB 1P34D 3W98B 2Y2PA 4X23C 3C1CC 5BS7C 1F1EA 5B1MA 3X1SD 1JFIA 3C1BB 3TU4B 2JE5A 4DRBA 3X1TA 1KX5D 5JRGD 3WKJC 4KUDA 2ZY3A 3LZ0B 4Z66A 1ZLAA 3B0DB 3MVDC 3X1TD 3KXBD 4HGAC 4X23A 3MGPB 3MGQB 3C1CA 5BS7A 5AVBC 4WJ3C 1Z2CB 4ZBJB 3AZID 3MGRB 4XUJB 4YS3B 2RVQC 4J8VB 3MNND 2VQRA 2CV5C 3W98D 3LJAC 1M19D 2LY8A 1WWSA 3WKJA 3AZLB 5GT0C 3KWQC 5AVCB 3MVDA 3C1BD 3X1UB 3TU4D 3A1KA 1M18B 4J8WC 5AVBA 5F99B 5CPJB 4Z2MG 3LZ0D 2DQNC 2CV5A 3UT9C 3LJAA 3AZMD 2HUEC 1P3OD 2FJ7B 2NZDC 3MGPD 3MGQD 4G91B 5GT0A 3KWQA 1P3IB 3LELB 5FUGA 1Q9CA 3MGRD 4YS3D 4J8WA 4J8VD 4H9RB 3WA9D 4M6BA 3AZLD 2F8NH 5B33C 5AVCD 4YM6C 3X1UD 3UT9A 1M18D 2NZDA 1KX3D 3REJB 1F66C 1P3KB 5F99D 5CPIC 5CPJD 3R45A 3EPKA 1S32C 4H9NA 3W97C 5B2JB 5B40C 2ZY2A 3B0CW 5B31B 5BO0B 5C3IB 2PYOC 1BH8A 2F8NB 2RIQA 5AV5B 3AZKC 5B33A 1P3ID 3LELD 4YM6A 4EO5C 1M1AB 1TAFA 1F66A 5BNVB 3AZEB 1P3FC 3AV1C 2YFVA 5CPIA 2G5HC 1S32A 5B32G 3W97A 5B40A 4JJNB 2PYOA 1PZRA 3W99C 3REHC 1P3KD 3O62B 1P3GC 3AZKA 1P3AB 3UTAD 5B2JD 3REKC 5AV9B 1KU5A 5B31D 3AV1A 5CPKC 1P3FA 2F8ND 3NQUA 5G49A 5AV5D 3AFAB 1M1AD 4AWLB 3W99A 3REHA 5B0YB 5GSUB 5B24B 3AZED 3A6NC 2HIOD 1P3GA 2Y2KA 3FDDA 5B2ID 3AZHB 3REKA 4JJND 4DRAA 5CPKA 3KFUG 5B32C 1EQZC 3O62D 1P3AD 2DF4C 4H9QA 5GT3B 5AV9D 3A6NA 3RELB 5B1LC 5KDMA 3AFAD 3W96B 3KUYC 4WU8B 4CAYB 5B32A 4WV4B 5GSUD 5B0YD 1EQZA 3WAAD 3AZHD 2BYMB 1P34B 5DNMB 3EPLA 5B1LA 3B6GD 3MGSC 3KUYA 3X1SB 4QLCB 4H9SC 1JFIB 1P3LC 1HQ3D 3W96D 4Z5TC 1U35C 3H0RC 4WU8D 3X1TB 3MGSA 4Z66B 5DNNC 1ID3D 4CSRB 4KHAA 4H9SA 4X23B 3UTBD 3AL0C 3C1CB 5DNMD 1P3LA 1M19B 4KGCD 4Z5TA 1U35A 4QLCD 4J8XC 1TZYC 3WKJB 5B1MD 1AOIC 5DNNA 3B6FC 3NQJA 3MVDB 4HGAB 3AZMB 1P3OB 3V9RA 1ULYA 4KUDD 1P3MC 2Y2HA 4Z66D 2CV5B 1ZLAD 4J8XA 2XD1A 1P3PC 3LJAB 4X23D 1TZYA 5AV6C 3C1CD 5GT0B 1AOIA 3B6FA 3KWQB 3WA9B 5FUGB 4E44A 3LZ1C 3AZNC 3WKJD 1KX3B 2J8PA 1P3MA 3MVDD 3UT9B 1P3PA 3A1IA 2HUEB 5AV6A 2NZDB 4WU9C 1P3MD 5AVBD 3R45B 5CP6C 4H9NB 1KX4C 2RVQD 3B0DC 2CV5D 3LJAD 4R8PC 1BH8B 3LZ1A 3VH5A 3VH5W 3AZNA 5GT0D 5B33B 3KWQD 4J8UC 4YM6B 1TAFB 3AZND 4J8WD 4WU9A 1F66B 2YFVB 5CP6A 4NE5A 5B40B 1P3BC 1KX4A 4XZQC 3UT9D 2PYOB 4R8PA 3UTAB 2NZDD 5B31G 4J8UA 2F8NG 3P5JB 1P3FB 3AV1B 5JA4A 2FJ7C 3AZGC 2ZY4A 3NQUB 5G49B 1P3BA 2HIOB 5B33D 3AN2C 4YM6D 4XZQA 5B2IB 3W99B 1F66D 5CPID 1P3GB 3B0BA 5B0ZC 1S32D 3W97D 5B40D 3REKB 2YFWA 5CPKB 2F2AC 2PYOD 2FJ7A 3AZGA 1WWIA 3REJC 3AZKD 3AN2A 4H9QB 5AV8C 2BYKA 1P3FD 3AV1D 4H9RA 3AN2D 5B0ZA 4G92C 5KDMB 3EPHA 2Y2MA 3WAAB 3W99D 2AROC 5B0ZD 3REHD 3WTPC 3REJA 1P3GD 3AYWC 5AY8C 4WNNA 5AV8A 3REKD 5CPKD 3B6GB 3AZJC 4UUZB 2FFFB 5B1LB 4H9PB 3KUYB 2AROA 3WTPA 1HQ3B 1R4VA 3A6ND 2L5AA 3AYWA 4LD9C 5AY8A 3AV2C 3AZJA 4AWLC 1ID3B 5B32D 5B24C 3X1VC 5E5AC 5AY8D 1EQZD 3UTBB 3MGSB 1BH9A 2NQBC 4KHAB 4KGCB 4LD9A 3REIC 1H3OA 3AZFC 4H9OA 5B1LD 4Z5TB 3AV2A 1U35B 3KUYD 5B1MB 4ZUXC 1B6WA 5B24A 3X1VA 5E5AA 3RELC 2NQBA 4KUDB 1N1JA 5GXQC 1ZLAB 3REIA 3AZFA 2Y2JA 1HTAA 3MGSD 4ZUXA 4J8XB 3B0CT 1TZYB 2Y2OA 3RELA 5BT1C 1P34C 5BNXA 3B6FB 1P3LD 4Z5TD 1U35D 5GXQA 1BFMA 2ZM5A 1P3MB 5AVBB 5DNND 1KX5C 2ZY5A 2W8SA 1P3PB 5JRGC 5AV6B 1P34A 4E45A 3KXBC 2IO5C 4J8XD 3AZIC 1TZYD 3LZ1B 3AZNB 4J8WB 3MNNC 1AOID 3B6FD 3W98C 1KX5A 1M19C 5JRGA 4WU9B 3C1BC 3KXBA 3TU4C 5CP6B 1KX4B 3VH6A 3VH6W 4CSRA 1B67A 3AZIA 1P3PD 4R8PB 5AV6D 3LZ0C 3MNNA 3W98A 3AZMC 4J8UB 1P3OC 1M19A 3MGPC 3MGQC 4Z2MH 1W2EA 4ZBJC 3C1BA 5JA4B 3MGRC 3TU4A 4XUJC 2JCHA 4YS3C 3LZ1D 4J8VC 4WZSB 1P3BB 5CPIB 3WA9C 4XZQB 1S32B 3W97B 3AZLC 3LZ0A 4WU9D 5AVCC 3X1UC 3AZMA 1M18C 1P3OA 5CP6D 3MGPA 3MGQA 1KX3C 1KX4D 5F99C 5CPJC 2YFWB 3AZKB 4EO5B 4R8PD 3MGRA 4XUJA 3AZGB 4YS3A 4J8VA 3AN2B 3WA9A 4J8UD 4G91C 4XUJD 3AZLA 2F8NK 2BYKB 3IP4C 5AVCA 3X1UA 3LELC 1P3IC 3F6TA 1M18A 5B0ZB 3REHB 1KX3A 1P3BD 2BG1A 5F99A 5CPJA 4XZQD 1T3UA
chains in the Genus database with same CATH topology
1P3KC 5AV8B 4WNNB 1P3IA 3LELA 3UTAC 5B2JC 2FJ7D 3AZGD 3KSYA 5B31C 4G92B 3A6NB 5C3IC 2AROB 3WTPB 5AV5C 1M1AC 2UWXA 1A7WA 3AYWB 5B32B 3AZEC 5AY8B 2G5IC 1P3KA 2HIOC 1EQZB 4NE3A 3H0MC 5B2IC 3AZJB 3UTAA 5B2JA 3REJD 4JJNC 5B31A 5BO0A 1BH9B 2Y2NA 2F8NA 5AV8D 3O62C 5AV5A 1P3AC 2JSSA 1M1AA 4UPKA 4LD9B 1H3OB 5BNVA 5AV9C 4H9OB 3AZEA 2HIOA 3AV2B 5B2IA 2AROD 2Y2LA 3WTPD 3X1VB 5E5AB 3AFAC 4JJNA 3AYWD 4NE6A 5B0YC 5GSUC 3H0LC 2NQBB 3O62A 1N1JB 1P3AA 3WAAC 3AZHC 2Y2QA 3WTPE 3AZJD 3REIB 5AV9A 3AZFB 3VH6T 4ZUXB 1P3LB 3AFAA 3B6GC 5CHLB 2XD5A 4LD9D 5GT3C 3VH5T 5BNXB 5GSUA 5B0YA 4DQYB 3AV2D 3WAAA 3AZHA 5GXQB 5DNNB 3NQJB 5B24D 2CWEA 1HQ3C 3W96C 5E5AD 3X1VD 4WU8C 2NQBD 3EG5B 3V9RB 3B6GA 1ID3C 4UUZA 5GT3A 3REID 3AZFD 3UTBC 4H9PA 5DNMC 1AOIB 4ZUXD 5GT3D 4KGCC 1HQ3A 2Y2IA 3W96A 2Y2GA 4QLCC 4WU8A 3RELD 3X1SC 4CAYA 1KX5B 4NFTA 5JRGB 5GXQD 5B1MC 1ID3A 2BYMA 3KXBB 3EPJA 3UTBA 2IO5B 5DNMA 3X1TC 3AZIB 4KGCA 4KUDC 3X1SA 4QLCA 4Z66C 1ZLAC 5BT1D 3MNNB 1P34D 3W98B 2Y2PA 4X23C 3C1CC 5BS7C 1F1EA 5B1MA 3X1SD 1JFIA 3C1BB 3TU4B 2JE5A 4DRBA 3X1TA 1KX5D 5JRGD 3WKJC 4KUDA 2ZY3A 3LZ0B 4Z66A 1ZLAA 3B0DB 3MVDC 3X1TD 3KXBD 4HGAC 4X23A 3MGPB 3MGQB 3C1CA 5BS7A 5AVBC 4WJ3C 1Z2CB 4ZBJB 3AZID 3MGRB 4XUJB 4YS3B 2RVQC 4J8VB 3MNND 2VQRA 2CV5C 3W98D 3LJAC 1M19D 2LY8A 1WWSA 3WKJA 3AZLB 5GT0C 3KWQC 5AVCB 3MVDA 3C1BD 3X1UB 3TU4D 3A1KA 1M18B 4J8WC 5AVBA 5F99B 5CPJB 4Z2MG 3LZ0D 2DQNC 2CV5A 3UT9C 3LJAA 3AZMD 2HUEC 1P3OD 2FJ7B 2NZDC 3MGPD 3MGQD 4G91B 5GT0A 3KWQA 1P3IB 3LELB 5FUGA 1Q9CA 3MGRD 4YS3D 4J8WA 4J8VD 4H9RB 3WA9D 4M6BA 3AZLD 2F8NH 5B33C 5AVCD 4YM6C 3X1UD 3UT9A 1M18D 2NZDA 1KX3D 3REJB 1F66C 1P3KB 5F99D 5CPIC 5CPJD 3R45A 3EPKA 1S32C 4H9NA 3W97C 5B2JB 5B40C 2ZY2A 3B0CW 5B31B 5BO0B 5C3IB 2PYOC 1BH8A 2F8NB 2RIQA 5AV5B 3AZKC 5B33A 1P3ID 3LELD 4YM6A 4EO5C 1M1AB 1TAFA 1F66A 5BNVB 3AZEB 1P3FC 3AV1C 2YFVA 5CPIA 2G5HC 1S32A 5B32G 3W97A 5B40A 4JJNB 2PYOA 1PZRA 3W99C 3REHC 1P3KD 3O62B 1P3GC 3AZKA 1P3AB 3UTAD 5B2JD 3REKC 5AV9B 1KU5A 5B31D 3AV1A 5CPKC 1P3FA 2F8ND 3NQUA 5G49A 5AV5D 3AFAB 1M1AD 4AWLB 3W99A 3REHA 5B0YB 5GSUB 5B24B 3AZED 3A6NC 2HIOD 1P3GA 2Y2KA 3FDDA 5B2ID 3AZHB 3REKA 4JJND 4DRAA 5CPKA 3KFUG 5B32C 1EQZC 3O62D 1P3AD 2DF4C 4H9QA 5GT3B 5AV9D 3A6NA 3RELB 5B1LC 5KDMA 3AFAD 3W96B 3KUYC 4WU8B 4CAYB 5B32A 4WV4B 5GSUD 5B0YD 1EQZA 3WAAD 3AZHD 2BYMB 1P34B 5DNMB 3EPLA 5B1LA 3B6GD 3MGSC 3KUYA 3X1SB 4QLCB 4H9SC 1JFIB 1P3LC 1HQ3D 3W96D 4Z5TC 1U35C 3H0RC 4WU8D 3X1TB 3MGSA 4Z66B 5DNNC 1ID3D 4CSRB 4KHAA 4H9SA 4X23B 3UTBD 3AL0C 3C1CB 5DNMD 1P3LA 1M19B 4KGCD 4Z5TA 1U35A 4QLCD 4J8XC 1TZYC 3WKJB 5B1MD 1AOIC 5DNNA 3B6FC 3NQJA 3MVDB 4HGAB 3AZMB 1P3OB 3V9RA 1ULYA 4KUDD 1P3MC 2Y2HA 4Z66D 2CV5B 1ZLAD 4J8XA 2XD1A 1P3PC 3LJAB 4X23D 1TZYA 5AV6C 3C1CD 5GT0B 1AOIA 3B6FA 3KWQB 3WA9B 5FUGB 4E44A 3LZ1C 3AZNC 3WKJD 1KX3B 2J8PA 1P3MA 3MVDD 3UT9B 1P3PA 3A1IA 2HUEB 5AV6A 2NZDB 4WU9C 1P3MD 5AVBD 3R45B 5CP6C 4H9NB 1KX4C 2RVQD 3B0DC 2CV5D 3LJAD 4R8PC 1BH8B 3LZ1A 3VH5A 3VH5W 3AZNA 5GT0D 5B33B 3KWQD 4J8UC 4YM6B 1TAFB 3AZND 4J8WD 4WU9A 1F66B 2YFVB 5CP6A 4NE5A 5B40B 1P3BC 1KX4A 4XZQC 3UT9D 2PYOB 4R8PA 3UTAB 2NZDD 5B31G 4J8UA 2F8NG 3P5JB 1P3FB 3AV1B 5JA4A 2FJ7C 3AZGC 2ZY4A 3NQUB 5G49B 1P3BA 2HIOB 5B33D 3AN2C 4YM6D 4XZQA 5B2IB 3W99B 1F66D 5CPID 1P3GB 3B0BA 5B0ZC 1S32D 3W97D 5B40D 3REKB 2YFWA 5CPKB 2F2AC 2PYOD 2FJ7A 3AZGA 1WWIA 3REJC 3AZKD 3AN2A 4H9QB 5AV8C 2BYKA 1P3FD 3AV1D 4H9RA 3AN2D 5B0ZA 4G92C 5KDMB 3EPHA 2Y2MA 3WAAB 3W99D 2AROC 5B0ZD 3REHD 3WTPC 3REJA 1P3GD 3AYWC 5AY8C 4WNNA 5AV8A 3REKD 5CPKD 3B6GB 3AZJC 4UUZB 2FFFB 5B1LB 4H9PB 3KUYB 2AROA 3WTPA 1HQ3B 1R4VA 3A6ND 2L5AA 3AYWA 4LD9C 5AY8A 3AV2C 3AZJA 4AWLC 1ID3B 5B32D 5B24C 3X1VC 5E5AC 5AY8D 1EQZD 3UTBB 3MGSB 1BH9A 2NQBC 4KHAB 4KGCB 4LD9A 3REIC 1H3OA 3AZFC 4H9OA 5B1LD 4Z5TB 3AV2A 1U35B 3KUYD 5B1MB 4ZUXC 1B6WA 5B24A 3X1VA 5E5AA 3RELC 2NQBA 4KUDB 1N1JA 5GXQC 1ZLAB 3REIA 3AZFA 2Y2JA 1HTAA 3MGSD 4ZUXA 4J8XB 3B0CT 1TZYB 2Y2OA 3RELA 5BT1C 1P34C 5BNXA 3B6FB 1P3LD 4Z5TD 1U35D 5GXQA 1BFMA 2ZM5A 1P3MB 5AVBB 5DNND 1KX5C 2ZY5A 2W8SA 1P3PB 5JRGC 5AV6B 1P34A 4E45A 3KXBC 2IO5C 4J8XD 3AZIC 1TZYD 3LZ1B 3AZNB 4J8WB 3MNNC 1AOID 3B6FD 3W98C 1KX5A 1M19C 5JRGA 4WU9B 3C1BC 3KXBA 3TU4C 5CP6B 1KX4B 3VH6A 3VH6W 4CSRA 1B67A 3AZIA 1P3PD 4R8PB 5AV6D 3LZ0C 3MNNA 3W98A 3AZMC 4J8UB 1P3OC 1M19A 3MGPC 3MGQC 4Z2MH 1W2EA 4ZBJC 3C1BA 5JA4B 3MGRC 3TU4A 4XUJC 2JCHA 4YS3C 3LZ1D 4J8VC 4WZSB 1P3BB 5CPIB 3WA9C 4XZQB 1S32B 3W97B 3AZLC 3LZ0A 4WU9D 5AVCC 3X1UC 3AZMA 1M18C 1P3OA 5CP6D 3MGPA 3MGQA 1KX3C 1KX4D 5F99C 5CPJC 2YFWB 3AZKB 4EO5B 4R8PD 3MGRA 4XUJA 3AZGB 4YS3A 4J8VA 3AN2B 3WA9A 4J8UD 4G91C 4XUJD 3AZLA 2F8NK 2BYKB 3IP4C 5AVCA 3X1UA 3LELC 1P3IC 3F6TA 1M18A 5B0ZB 3REHB 1KX3A 1P3BD 2BG1A 5F99A 5CPJA 4XZQD 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K C;  5AV8 B;  4WNN B;  1P3I A;  3LEL A;  3UTA C;  5B2J C;  2FJ7 D;  3AZG D;  3KSY A;  5B31 C;  4G92 B;  3A6N B;  5C3I C;  2ARO B;  3WTP B;  5AV5 C;  1M1A C;  1A7W A;  3AYW B;  5B32 B;  3AZE C;  5AY8 B;  1P3K A;  1EQZ B;  2HIO C;  4NE3 A;  5B2I C;  3AZJ B;  3UTA A;  5B2J A;  3REJ D;  4JJN C;  5B31 A;  5BO0 A;  1BH9 B;  2F8N A;  5AV8 D;  3O62 C;  5AV5 A;  1P3A C;  2JSS A;  1M1A A;  4LD9 B;  1H3O B;  5BNV A;  5AV9 C;  4H9O B;  3AZE A;  2HIO A;  3AV2 B;  5B2I A;  2ARO D;  3WTP D;  3X1V B;  5E5A B;  3AFA C;  4JJN A;  3AYW D;  4NE6 A;  5B0Y C;  5GSU C;  2NQB B;  3O62 A;  1N1J B;  1P3A A;  3WAA C;  3AZH C;  3WTP E;  3AZJ D;  3REI B;  5AV9 A;  3AZF B;  3VH6 T;  4ZUX B;  1P3L B;  3AFA A;  3B6G C;  5CHL B;  4LD9 D;  5GT3 C;  3VH5 T;  5BNX B;  5GSU A;  5B0Y A;  3AV2 D;  3WAA A;  3AZH A;  5GXQ B;  5DNN B;  3NQJ B;  5B24 D;  2CWE A;  1HQ3 C;  3W96 C;  5E5A D;  3X1V D;  4WU8 C;  2NQB D;  3V9R B;  3B6G A;  1ID3 C;  4UUZ A;  5GT3 A;  3REI D;  3AZF D;  3UTB C;  4H9P A;  5DNM C;  1AOI B;  4ZUX D;  5GT3 D;  4KGC C;  1HQ3 A;  3W96 A;  4QLC C;  4WU8 A;  3REL D;  3X1S C;  4CAY A;  1KX5 B;  4NFT A;  5JRG B;  5GXQ D;  5B1M C;  1ID3 A;  2BYM A;  3KXB B;  3UTB A;  2IO5 B;  5DNM A;  3X1T C;  3AZI B;  4KGC A;  4KUD C;  3X1S A;  4QLC A;  4Z66 C;  1ZLA C;  5BT1 D;  3MNN B;  1P34 D;  3W98 B;  4X23 C;  3C1C C;  5BS7 C;  1F1E A;  5B1M A;  3X1S D;  1JFI A;  3C1B B;  3TU4 B;  4DRB A;  3X1T A;  1KX5 D;  5JRG D;  3WKJ C;  4KUD A;  3LZ0 B;  4Z66 A;  1ZLA A;  3B0D B;  3MVD C;  3X1T D;  3KXB D;  4HGA C;  4X23 A;  3MGP B;  3MGQ B;  3C1C A;  5BS7 A;  5AVB C;  4ZBJ B;  3AZI D;  3MGR B;  4XUJ B;  4YS3 B;  2RVQ C;  4J8V B;  3MNN D;  2CV5 C;  3W98 D;  3LJA C;  1M19 D;  2LY8 A;  1WWS A;  3WKJ A;  3AZL B;  5GT0 C;  3KWQ C;  5AVC B;  3MVD A;  3C1B D;  3X1U B;  3TU4 D;  1M18 B;  4J8W C;  5AVB A;  5F99 B;  5CPJ B;  4Z2M G;  3LZ0 D;  2CV5 A;  3UT9 C;  3LJA A;  3AZM D;  2HUE C;  1P3O D;  2FJ7 B;  2NZD C;  3MGP D;  3MGQ D;  4G91 B;  5GT0 A;  3KWQ A;  1P3I B;  3LEL B;  5FUG A;  1Q9C A;  3MGR D;  4YS3 D;  4J8W A;  4J8V D;  4H9R B;  3WA9 D;  4M6B A;  3AZL D;  2F8N H;  5B33 C;  5AVC D;  4YM6 C;  3X1U D;  3UT9 A;  1M18 D;  2NZD A;  1KX3 D;  3REJ B;  1F66 C;  1P3K B;  5F99 D;  5CPI C;  5CPJ D;  3R45 A;  1S32 C;  4H9N A;  3W97 C;  5B2J B;  5B40 C;  3B0C W;  5B31 B;  5BO0 B;  5C3I B;  2PYO C;  1BH8 A;  2F8N B;  5AV5 B;  3AZK C;  5B33 A;  1P3I D;  3LEL D;  4YM6 A;  4EO5 C;  1M1A B;  1TAF A;  1F66 A;  5BNV B;  3AZE B;  1P3F C;  3AV1 C;  2YFV A;  5CPI A;  1S32 A;  5B32 G;  3W97 A;  5B40 A;  4JJN B;  2PYO A;  3W99 C;  3REH C;  1P3K D;  3O62 B;  1P3G C;  3AZK A;  1P3A B;  3UTA D;  5B2J D;  3REK C;  5AV9 B;  1KU5 A;  5B31 D;  3AV1 A;  5CPK C;  1P3F A;  2F8N D;  3NQU A;  5G49 A;  5AV5 D;  3AFA B;  1M1A D;  4AWL B;  3W99 A;  3REH A;  5B0Y B;  5GSU B;  5B24 B;  3AZE D;  3A6N C;  2HIO D;  1P3G A;  5B2I D;  3AZH B;  3REK A;  4JJN D;  4DRA A;  5CPK A;  5B32 C;  1EQZ C;  3O62 D;  1P3A D;  4H9Q A;  5GT3 B;  5AV9 D;  3A6N A;  3REL B;  5B1L C;  5KDM A;  3AFA D;  3W96 B;  3KUY C;  4WU8 B;  4CAY B;  5B32 A;  4WV4 B;  5GSU D;  5B0Y D;  1EQZ A;  3WAA D;  3AZH D;  2BYM B;  1P34 B;  5DNM B;  5B1L A;  3B6G D;  3MGS C;  3KUY A;  3X1S B;  4QLC B;  4H9S C;  1JFI B;  1P3L C;  1HQ3 D;  3W96 D;  4Z5T C;  1U35 C;  4WU8 D;  3X1T B;  3MGS A;  4Z66 B;  5DNN C;  1ID3 D;  4CSR B;  4KHA A;  4H9S A;  4X23 B;  3UTB D;  3C1C B;  5DNM D;  1P3L A;  1M19 B;  4KGC D;  4Z5T A;  1U35 A;  4QLC D;  4J8X C;  1TZY C;  3WKJ B;  5B1M D;  1AOI C;  5DNN A;  3B6F C;  3NQJ A;  3MVD B;  4HGA B;  3AZM B;  1P3O B;  3V9R A;  1ULY A;  4KUD D;  1P3M C;  4Z66 D;  2CV5 B;  1ZLA D;  4J8X A;  1P3P C;  3LJA B;  4X23 D;  1TZY A;  5AV6 C;  3C1C D;  5GT0 B;  1AOI A;  3B6F A;  3KWQ B;  3WA9 B;  5FUG B;  4E44 A;  3LZ1 C;  3AZN C;  3WKJ D;  1KX3 B;  1P3M A;  3MVD D;  3UT9 B;  1P3P A;  2HUE B;  5AV6 A;  2NZD B;  4WU9 C;  1P3M D;  5AVB D;  3R45 B;  5CP6 C;  4H9N B;  1KX4 C;  2RVQ D;  3B0D C;  2CV5 D;  3LJA D;  4R8P C;  1BH8 B;  3LZ1 A;  3VH5 A;  3VH5 W;  3AZN A;  5GT0 D;  5B33 B;  3KWQ D;  4J8U C;  4YM6 B;  1TAF B;  3AZN D;  4J8W D;  4WU9 A;  1F66 B;  2YFV B;  5CP6 A;  4NE5 A;  5B40 B;  1P3B C;  1KX4 A;  4XZQ C;  3UT9 D;  2PYO B;  4R8P A;  3UTA B;  2NZD D;  5B31 G;  4J8U A;  2F8N G;  1P3F B;  3AV1 B;  5JA4 A;  2FJ7 C;  3AZG C;  3NQU B;  5G49 B;  1P3B A;  2HIO B;  5B33 D;  3AN2 C;  4YM6 D;  4XZQ A;  5B2I B;  3W99 B;  1F66 D;  5CPI D;  1P3G B;  3B0B A;  5B0Z C;  1S32 D;  3W97 D;  5B40 D;  3REK B;  2YFW A;  5CPK B;  2PYO D;  2FJ7 A;  3AZG A;  1WWI A;  3REJ C;  3AZK D;  3AN2 A;  4H9Q B;  5AV8 C;  2BYK A;  1P3F D;  3AV1 D;  4H9R A;  3AN2 D;  5B0Z A;  4G92 C;  5KDM B;  3WAA B;  3W99 D;  2ARO C;  5B0Z D;  3REH D;  3WTP C;  3REJ A;  1P3G D;  3AYW C;  5AY8 C;  4WNN A;  5AV8 A;  3REK D;  5CPK D;  3B6G B;  3AZJ C;  4UUZ B;  5B1L B;  4H9P B;  3KUY B;  2ARO A;  3WTP A;  1HQ3 B;  1R4V A;  3A6N D;  2L5A A;  3AYW A;  4LD9 C;  5AY8 A;  3AV2 C;  3AZJ A;  4AWL C;  1ID3 B;  5B32 D;  5B24 C;  3X1V C;  5E5A C;  5AY8 D;  1EQZ D;  3UTB B;  3MGS B;  1BH9 A;  2NQB C;  4KHA B;  4KGC B;  4LD9 A;  3REI C;  1H3O A;  3AZF C;  4H9O A;  5B1L D;  4Z5T B;  3AV2 A;  1U35 B;  3KUY D;  5B1M B;  4ZUX C;  1B6W A;  5B24 A;  3X1V A;  5E5A A;  3REL C;  2NQB A;  4KUD B;  1N1J A;  5GXQ C;  1ZLA B;  3REI A;  3AZF A;  1HTA A;  3MGS D;  4ZUX A;  4J8X B;  3B0C T;  1TZY B;  3REL A;  5BT1 C;  1P34 C;  5BNX A;  3B6F B;  1P3L D;  4Z5T D;  1U35 D;  5GXQ A;  1BFM A;  1P3M B;  5AVB B;  5DNN D;  1KX5 C;  1P3P B;  5JRG C;  5AV6 B;  1P34 A;  4E45 A;  3KXB C;  2IO5 C;  4J8X D;  3AZI C;  1TZY D;  3LZ1 B;  3AZN B;  4J8W B;  3MNN C;  1AOI D;  3B6F D;  3W98 C;  1KX5 A;  1M19 C;  5JRG A;  4WU9 B;  3C1B C;  3KXB A;  3TU4 C;  5CP6 B;  1KX4 B;  3VH6 A;  3VH6 W;  4CSR A;  1B67 A;  3AZI A;  1P3P D;  4R8P B;  5AV6 D;  3LZ0 C;  3MNN A;  3W98 A;  3AZM C;  4J8U B;  1P3O C;  1M19 A;  3MGP C;  3MGQ C;  4Z2M H;  4ZBJ C;  3C1B A;  5JA4 B;  3MGR C;  3TU4 A;  4XUJ C;  3LZ1 D;  4YS3 C;  4J8V C;  4WZS B;  1P3B B;  5CPI B;  3WA9 C;  4XZQ B;  1S32 B;  3W97 B;  3AZL C;  3LZ0 A;  4WU9 D;  5AVC C;  3X1U C;  3AZM A;  1M18 C;  1P3O A;  5CP6 D;  3MGP A;  3MGQ A;  1KX3 C;  1KX4 D;  5F99 C;  5CPJ C;  2YFW B;  3AZK B;  4EO5 B;  4R8P D;  3MGR A;  4XUJ A;  3AZG B;  4YS3 A;  4J8V A;  3AN2 B;  3WA9 A;  4J8U D;  4G91 C;  4XUJ D;  3AZL A;  2F8N K;  2BYK B;  5AVC A;  3LEL C;  3X1U A;  1P3I C;  1M18 A;  5B0Z B;  3REH B;  1KX3 A;  1P3B D;  5F99 A;  5CPJ A;  4XZQ D; 
#chains in the Genus database with same CATH topology
 1P3K C;  5AV8 B;  4WNN B;  1P3I A;  3LEL A;  3UTA C;  5B2J C;  2FJ7 D;  3AZG D;  3KSY A;  5B31 C;  4G92 B;  3A6N B;  5C3I C;  2ARO B;  3WTP B;  5AV5 C;  1M1A C;  2UWX A;  1A7W A;  3AYW B;  5B32 B;  3AZE C;  5AY8 B;  2G5I C;  1P3K A;  2HIO C;  1EQZ B;  4NE3 A;  3H0M C;  5B2I C;  3AZJ B;  3UTA A;  5B2J A;  3REJ D;  4JJN C;  5B31 A;  5BO0 A;  1BH9 B;  2Y2N A;  2F8N A;  5AV8 D;  3O62 C;  5AV5 A;  1P3A C;  2JSS A;  1M1A A;  4UPK A;  4LD9 B;  1H3O B;  5BNV A;  5AV9 C;  4H9O B;  3AZE A;  2HIO A;  3AV2 B;  5B2I A;  2ARO D;  2Y2L A;  3WTP D;  3X1V B;  5E5A B;  3AFA C;  4JJN A;  3AYW D;  4NE6 A;  5B0Y C;  5GSU C;  3H0L C;  2NQB B;  3O62 A;  1N1J B;  1P3A A;  3WAA C;  3AZH C;  2Y2Q A;  3WTP E;  3AZJ D;  3REI B;  5AV9 A;  3AZF B;  3VH6 T;  4ZUX B;  1P3L B;  3AFA A;  3B6G C;  5CHL B;  2XD5 A;  4LD9 D;  5GT3 C;  3VH5 T;  5BNX B;  5GSU A;  5B0Y A;  4DQY B;  3AV2 D;  3WAA A;  3AZH A;  5GXQ B;  5DNN B;  3NQJ B;  5B24 D;  2CWE A;  1HQ3 C;  3W96 C;  5E5A D;  3X1V D;  4WU8 C;  2NQB D;  3EG5 B;  3V9R B;  3B6G A;  1ID3 C;  4UUZ A;  5GT3 A;  3REI D;  3AZF D;  3UTB C;  4H9P A;  5DNM C;  1AOI B;  4ZUX D;  5GT3 D;  4KGC C;  1HQ3 A;  2Y2I A;  3W96 A;  2Y2G A;  4QLC C;  4WU8 A;  3REL D;  3X1S C;  4CAY A;  1KX5 B;  4NFT A;  5JRG B;  5GXQ D;  5B1M C;  1ID3 A;  2BYM A;  3KXB B;  3EPJ A;  3UTB A;  2IO5 B;  5DNM A;  3X1T C;  3AZI B;  4KGC A;  4KUD C;  3X1S A;  4QLC A;  4Z66 C;  1ZLA C;  5BT1 D;  3MNN B;  1P34 D;  3W98 B;  2Y2P A;  4X23 C;  3C1C C;  5BS7 C;  1F1E A;  5B1M A;  3X1S D;  1JFI A;  3C1B B;  3TU4 B;  2JE5 A;  4DRB A;  3X1T A;  1KX5 D;  5JRG D;  3WKJ C;  4KUD A;  2ZY3 A;  3LZ0 B;  4Z66 A;  1ZLA A;  3B0D B;  3MVD C;  3X1T D;  3KXB D;  4HGA C;  4X23 A;  3MGP B;  3MGQ B;  3C1C A;  5BS7 A;  5AVB C;  4WJ3 C;  1Z2C B;  4ZBJ B;  3AZI D;  3MGR B;  4XUJ B;  4YS3 B;  2RVQ C;  4J8V B;  3MNN D;  2VQR A;  2CV5 C;  3W98 D;  3LJA C;  1M19 D;  2LY8 A;  1WWS A;  3WKJ A;  3AZL B;  5GT0 C;  3KWQ C;  5AVC B;  3MVD A;  3C1B D;  3X1U B;  3TU4 D;  3A1K A;  1M18 B;  4J8W C;  5AVB A;  5F99 B;  5CPJ B;  4Z2M G;  3LZ0 D;  2DQN C;  2CV5 A;  3UT9 C;  3LJA A;  3AZM D;  2HUE C;  1P3O D;  2FJ7 B;  2NZD C;  3MGP D;  3MGQ D;  4G91 B;  5GT0 A;  3KWQ A;  1P3I B;  3LEL B;  5FUG A;  1Q9C A;  3MGR D;  4YS3 D;  4J8W A;  4J8V D;  4H9R B;  3WA9 D;  4M6B A;  3AZL D;  2F8N H;  5B33 C;  5AVC D;  4YM6 C;  3X1U D;  3UT9 A;  1M18 D;  2NZD A;  1KX3 D;  3REJ B;  1F66 C;  1P3K B;  5F99 D;  5CPI C;  5CPJ D;  3R45 A;  3EPK A;  1S32 C;  4H9N A;  3W97 C;  5B2J B;  5B40 C;  2ZY2 A;  3B0C W;  5B31 B;  5BO0 B;  5C3I B;  2PYO C;  1BH8 A;  2F8N B;  2RIQ A;  5AV5 B;  3AZK C;  5B33 A;  1P3I D;  3LEL D;  4YM6 A;  4EO5 C;  1M1A B;  1TAF A;  1F66 A;  5BNV B;  3AZE B;  1P3F C;  3AV1 C;  2YFV A;  5CPI A;  2G5H C;  1S32 A;  5B32 G;  3W97 A;  5B40 A;  4JJN B;  2PYO A;  1PZR A;  3W99 C;  3REH C;  1P3K D;  3O62 B;  1P3G C;  3AZK A;  1P3A B;  3UTA D;  5B2J D;  3REK C;  5AV9 B;  1KU5 A;  5B31 D;  3AV1 A;  5CPK C;  1P3F A;  2F8N D;  3NQU A;  5G49 A;  5AV5 D;  3AFA B;  1M1A D;  4AWL B;  3W99 A;  3REH A;  5B0Y B;  5GSU B;  5B24 B;  3AZE D;  3A6N C;  2HIO D;  1P3G A;  2Y2K A;  3FDD A;  5B2I D;  3AZH B;  3REK A;  4JJN D;  4DRA A;  5CPK A;  3KFU G;  5B32 C;  1EQZ C;  3O62 D;  1P3A D;  2DF4 C;  4H9Q A;  5GT3 B;  5AV9 D;  3A6N A;  3REL B;  5B1L C;  5KDM A;  3AFA D;  3W96 B;  3KUY C;  4WU8 B;  4CAY B;  5B32 A;  4WV4 B;  5GSU D;  5B0Y D;  1EQZ A;  3WAA D;  3AZH D;  2BYM B;  1P34 B;  5DNM B;  3EPL A;  5B1L A;  3B6G D;  3MGS C;  3KUY A;  3X1S B;  4QLC B;  4H9S C;  1JFI B;  1P3L C;  1HQ3 D;  3W96 D;  4Z5T C;  1U35 C;  3H0R C;  4WU8 D;  3X1T B;  3MGS A;  4Z66 B;  5DNN C;  1ID3 D;  4CSR B;  4KHA A;  4H9S A;  4X23 B;  3UTB D;  3AL0 C;  3C1C B;  5DNM D;  1P3L A;  1M19 B;  4KGC D;  4Z5T A;  1U35 A;  4QLC D;  4J8X C;  1TZY C;  3WKJ B;  5B1M D;  1AOI C;  5DNN A;  3B6F C;  3NQJ A;  3MVD B;  4HGA B;  3AZM B;  1P3O B;  3V9R A;  1ULY A;  4KUD D;  1P3M C;  2Y2H A;  4Z66 D;  2CV5 B;  1ZLA D;  4J8X A;  2XD1 A;  1P3P C;  3LJA B;  4X23 D;  1TZY A;  5AV6 C;  3C1C D;  5GT0 B;  1AOI A;  3B6F A;  3KWQ B;  3WA9 B;  5FUG B;  4E44 A;  3LZ1 C;  3AZN C;  3WKJ D;  1KX3 B;  2J8P A;  1P3M A;  3MVD D;  3UT9 B;  1P3P A;  3A1I A;  2HUE B;  5AV6 A;  2NZD B;  4WU9 C;  1P3M D;  5AVB D;  3R45 B;  5CP6 C;  4H9N B;  1KX4 C;  2RVQ D;  3B0D C;  2CV5 D;  3LJA D;  4R8P C;  1BH8 B;  3LZ1 A;  3VH5 A;  3VH5 W;  3AZN A;  5GT0 D;  5B33 B;  3KWQ D;  4J8U C;  4YM6 B;  1TAF B;  3AZN D;  4J8W D;  4WU9 A;  1F66 B;  2YFV B;  5CP6 A;  4NE5 A;  5B40 B;  1P3B C;  1KX4 A;  4XZQ C;  3UT9 D;  2PYO B;  4R8P A;  3UTA B;  2NZD D;  5B31 G;  4J8U A;  2F8N G;  3P5J B;  1P3F B;  3AV1 B;  5JA4 A;  2FJ7 C;  3AZG C;  2ZY4 A;  3NQU B;  5G49 B;  1P3B A;  2HIO B;  5B33 D;  3AN2 C;  4YM6 D;  4XZQ A;  5B2I B;  3W99 B;  1F66 D;  5CPI D;  1P3G B;  3B0B A;  5B0Z C;  1S32 D;  3W97 D;  5B40 D;  3REK B;  2YFW A;  5CPK B;  2F2A C;  2PYO D;  2FJ7 A;  3AZG A;  1WWI A;  3REJ C;  3AZK D;  3AN2 A;  4H9Q B;  5AV8 C;  2BYK A;  1P3F D;  3AV1 D;  4H9R A;  3AN2 D;  5B0Z A;  4G92 C;  5KDM B;  3EPH A;  2Y2M A;  3WAA B;  3W99 D;  2ARO C;  5B0Z D;  3REH D;  3WTP C;  3REJ A;  1P3G D;  3AYW C;  5AY8 C;  4WNN A;  5AV8 A;  3REK D;  5CPK D;  3B6G B;  3AZJ C;  4UUZ B;  2FFF B;  5B1L B;  4H9P B;  3KUY B;  2ARO A;  3WTP A;  1HQ3 B;  1R4V A;  3A6N D;  2L5A A;  3AYW A;  4LD9 C;  5AY8 A;  3AV2 C;  3AZJ A;  4AWL C;  1ID3 B;  5B32 D;  5B24 C;  3X1V C;  5E5A C;  5AY8 D;  1EQZ D;  3UTB B;  3MGS B;  1BH9 A;  2NQB C;  4KHA B;  4KGC B;  4LD9 A;  3REI C;  1H3O A;  3AZF C;  4H9O A;  5B1L D;  4Z5T B;  3AV2 A;  1U35 B;  3KUY D;  5B1M B;  4ZUX C;  1B6W A;  5B24 A;  3X1V A;  5E5A A;  3REL C;  2NQB A;  4KUD B;  1N1J A;  5GXQ C;  1ZLA B;  3REI A;  3AZF A;  2Y2J A;  1HTA A;  3MGS D;  4ZUX A;  4J8X B;  3B0C T;  1TZY B;  2Y2O A;  3REL A;  5BT1 C;  1P34 C;  5BNX A;  3B6F B;  1P3L D;  4Z5T D;  1U35 D;  5GXQ A;  1BFM A;  2ZM5 A;  1P3M B;  5AVB B;  5DNN D;  1KX5 C;  2ZY5 A;  2W8S A;  1P3P B;  5JRG C;  5AV6 B;  1P34 A;  4E45 A;  3KXB C;  2IO5 C;  4J8X D;  3AZI C;  1TZY D;  3LZ1 B;  3AZN B;  4J8W B;  3MNN C;  1AOI D;  3B6F D;  3W98 C;  1KX5 A;  1M19 C;  5JRG A;  4WU9 B;  3C1B C;  3KXB A;  3TU4 C;  5CP6 B;  1KX4 B;  3VH6 A;  3VH6 W;  4CSR A;  1B67 A;  3AZI A;  1P3P D;  4R8P B;  5AV6 D;  3LZ0 C;  3MNN A;  3W98 A;  3AZM C;  4J8U B;  1P3O C;  1M19 A;  3MGP C;  3MGQ C;  4Z2M H;  1W2E A;  4ZBJ C;  3C1B A;  5JA4 B;  3MGR C;  3TU4 A;  4XUJ C;  2JCH A;  4YS3 C;  3LZ1 D;  4J8V C;  4WZS B;  1P3B B;  5CPI B;  3WA9 C;  4XZQ B;  1S32 B;  3W97 B;  3AZL C;  3LZ0 A;  4WU9 D;  5AVC C;  3X1U C;  3AZM A;  1M18 C;  1P3O A;  5CP6 D;  3MGP A;  3MGQ A;  1KX3 C;  1KX4 D;  5F99 C;  5CPJ C;  2YFW B;  3AZK B;  4EO5 B;  4R8P D;  3MGR A;  4XUJ A;  3AZG B;  4YS3 A;  4J8V A;  3AN2 B;  3WA9 A;  4J8U D;  4G91 C;  4XUJ D;  3AZL A;  2F8N K;  2BYK B;  3IP4 C;  5AVC A;  3X1U A;  3LEL C;  1P3I C;  3F6T A;  1M18 A;  5B0Z B;  3REH B;  1KX3 A;  1P3B D;  2BG1 A;  5F99 A;  5CPJ A;  4XZQ D;  1T3U A; 
#chains in the Genus database with same CATH homology
 1P3K C;  5AV8 B;  4WNN B;  1P3I A;  3LEL A;  3UTA C;  5B2J C;  2FJ7 D;  3AZG D;  3KSY A;  5B31 C;  4G92 B;  3A6N B;  5C3I C;  2ARO B;  3WTP B;  5AV5 C;  1M1A C;  2UWX A;  1A7W A;  3AYW B;  5B32 B;  3AZE C;  5AY8 B;  2G5I C;  1P3K A;  2HIO C;  1EQZ B;  4NE3 A;  3H0M C;  5B2I C;  3AZJ B;  3UTA A;  5B2J A;  3REJ D;  4JJN C;  5B31 A;  5BO0 A;  1BH9 B;  2Y2N A;  2F8N A;  5AV8 D;  3O62 C;  5AV5 A;  1P3A C;  2JSS A;  1M1A A;  4UPK A;  4LD9 B;  1H3O B;  5BNV A;  5AV9 C;  4H9O B;  3AZE A;  2HIO A;  3AV2 B;  5B2I A;  2ARO D;  2Y2L A;  3WTP D;  3X1V B;  5E5A B;  3AFA C;  4JJN A;  3AYW D;  4NE6 A;  5B0Y C;  5GSU C;  3H0L C;  2NQB B;  3O62 A;  1N1J B;  1P3A A;  3WAA C;  3AZH C;  2Y2Q A;  3WTP E;  3AZJ D;  3REI B;  5AV9 A;  3AZF B;  3VH6 T;  4ZUX B;  1P3L B;  3AFA A;  3B6G C;  5CHL B;  2XD5 A;  4LD9 D;  5GT3 C;  3VH5 T;  5BNX B;  5GSU A;  5B0Y A;  4DQY B;  3AV2 D;  3WAA A;  3AZH A;  5GXQ B;  5DNN B;  3NQJ B;  5B24 D;  2CWE A;  1HQ3 C;  3W96 C;  5E5A D;  3X1V D;  4WU8 C;  2NQB D;  3EG5 B;  3V9R B;  3B6G A;  1ID3 C;  4UUZ A;  5GT3 A;  3REI D;  3AZF D;  3UTB C;  4H9P A;  5DNM C;  1AOI B;  4ZUX D;  5GT3 D;  4KGC C;  1HQ3 A;  2Y2I A;  3W96 A;  2Y2G A;  4QLC C;  4WU8 A;  3REL D;  3X1S C;  4CAY A;  1KX5 B;  4NFT A;  5JRG B;  5GXQ D;  5B1M C;  1ID3 A;  2BYM A;  3KXB B;  3EPJ A;  3UTB A;  2IO5 B;  5DNM A;  3X1T C;  3AZI B;  4KGC A;  4KUD C;  3X1S A;  4QLC A;  4Z66 C;  1ZLA C;  5BT1 D;  3MNN B;  1P34 D;  3W98 B;  2Y2P A;  4X23 C;  3C1C C;  5BS7 C;  1F1E A;  5B1M A;  3X1S D;  1JFI A;  3C1B B;  3TU4 B;  2JE5 A;  4DRB A;  3X1T A;  1KX5 D;  5JRG D;  3WKJ C;  4KUD A;  2ZY3 A;  3LZ0 B;  4Z66 A;  1ZLA A;  3B0D B;  3MVD C;  3X1T D;  3KXB D;  4HGA C;  4X23 A;  3MGP B;  3MGQ B;  3C1C A;  5BS7 A;  5AVB C;  4WJ3 C;  1Z2C B;  4ZBJ B;  3AZI D;  3MGR B;  4XUJ B;  4YS3 B;  2RVQ C;  4J8V B;  3MNN D;  2VQR A;  2CV5 C;  3W98 D;  3LJA C;  1M19 D;  2LY8 A;  1WWS A;  3WKJ A;  3AZL B;  5GT0 C;  3KWQ C;  5AVC B;  3MVD A;  3C1B D;  3X1U B;  3TU4 D;  3A1K A;  1M18 B;  4J8W C;  5AVB A;  5F99 B;  5CPJ B;  4Z2M G;  3LZ0 D;  2DQN C;  2CV5 A;  3UT9 C;  3LJA A;  3AZM D;  2HUE C;  1P3O D;  2FJ7 B;  2NZD C;  3MGP D;  3MGQ D;  4G91 B;  5GT0 A;  3KWQ A;  1P3I B;  3LEL B;  5FUG A;  1Q9C A;  3MGR D;  4YS3 D;  4J8W A;  4J8V D;  4H9R B;  3WA9 D;  4M6B A;  3AZL D;  2F8N H;  5B33 C;  5AVC D;  4YM6 C;  3X1U D;  3UT9 A;  1M18 D;  2NZD A;  1KX3 D;  3REJ B;  1F66 C;  1P3K B;  5F99 D;  5CPI C;  5CPJ D;  3R45 A;  3EPK A;  1S32 C;  4H9N A;  3W97 C;  5B2J B;  5B40 C;  2ZY2 A;  3B0C W;  5B31 B;  5BO0 B;  5C3I B;  2PYO C;  1BH8 A;  2F8N B;  2RIQ A;  5AV5 B;  3AZK C;  5B33 A;  1P3I D;  3LEL D;  4YM6 A;  4EO5 C;  1M1A B;  1TAF A;  1F66 A;  5BNV B;  3AZE B;  1P3F C;  3AV1 C;  2YFV A;  5CPI A;  2G5H C;  1S32 A;  5B32 G;  3W97 A;  5B40 A;  4JJN B;  2PYO A;  1PZR A;  3W99 C;  3REH C;  1P3K D;  3O62 B;  1P3G C;  3AZK A;  1P3A B;  3UTA D;  5B2J D;  3REK C;  5AV9 B;  1KU5 A;  5B31 D;  3AV1 A;  5CPK C;  1P3F A;  2F8N D;  3NQU A;  5G49 A;  5AV5 D;  3AFA B;  1M1A D;  4AWL B;  3W99 A;  3REH A;  5B0Y B;  5GSU B;  5B24 B;  3AZE D;  3A6N C;  2HIO D;  1P3G A;  2Y2K A;  3FDD A;  5B2I D;  3AZH B;  3REK A;  4JJN D;  4DRA A;  5CPK A;  3KFU G;  5B32 C;  1EQZ C;  3O62 D;  1P3A D;  2DF4 C;  4H9Q A;  5GT3 B;  5AV9 D;  3A6N A;  3REL B;  5B1L C;  5KDM A;  3AFA D;  3W96 B;  3KUY C;  4WU8 B;  4CAY B;  5B32 A;  4WV4 B;  5GSU D;  5B0Y D;  1EQZ A;  3WAA D;  3AZH D;  2BYM B;  1P34 B;  5DNM B;  3EPL A;  5B1L A;  3B6G D;  3MGS C;  3KUY A;  3X1S B;  4QLC B;  4H9S C;  1JFI B;  1P3L C;  1HQ3 D;  3W96 D;  4Z5T C;  1U35 C;  3H0R C;  4WU8 D;  3X1T B;  3MGS A;  4Z66 B;  5DNN C;  1ID3 D;  4CSR B;  4KHA A;  4H9S A;  4X23 B;  3UTB D;  3AL0 C;  3C1C B;  5DNM D;  1P3L A;  1M19 B;  4KGC D;  4Z5T A;  1U35 A;  4QLC D;  4J8X C;  1TZY C;  3WKJ B;  5B1M D;  1AOI C;  5DNN A;  3B6F C;  3NQJ A;  3MVD B;  4HGA B;  3AZM B;  1P3O B;  3V9R A;  1ULY A;  4KUD D;  1P3M C;  2Y2H A;  4Z66 D;  2CV5 B;  1ZLA D;  4J8X A;  2XD1 A;  1P3P C;  3LJA B;  4X23 D;  1TZY A;  5AV6 C;  3C1C D;  5GT0 B;  1AOI A;  3B6F A;  3KWQ B;  3WA9 B;  5FUG B;  4E44 A;  3LZ1 C;  3AZN C;  3WKJ D;  1KX3 B;  2J8P A;  1P3M A;  3MVD D;  3UT9 B;  1P3P A;  3A1I A;  2HUE B;  5AV6 A;  2NZD B;  4WU9 C;  1P3M D;  5AVB D;  3R45 B;  5CP6 C;  4H9N B;  1KX4 C;  2RVQ D;  3B0D C;  2CV5 D;  3LJA D;  4R8P C;  1BH8 B;  3LZ1 A;  3VH5 A;  3VH5 W;  3AZN A;  5GT0 D;  5B33 B;  3KWQ D;  4J8U C;  4YM6 B;  1TAF B;  3AZN D;  4J8W D;  4WU9 A;  1F66 B;  2YFV B;  5CP6 A;  4NE5 A;  5B40 B;  1P3B C;  1KX4 A;  4XZQ C;  3UT9 D;  2PYO B;  4R8P A;  3UTA B;  2NZD D;  5B31 G;  4J8U A;  2F8N G;  3P5J B;  1P3F B;  3AV1 B;  5JA4 A;  2FJ7 C;  3AZG C;  2ZY4 A;  3NQU B;  5G49 B;  1P3B A;  2HIO B;  5B33 D;  3AN2 C;  4YM6 D;  4XZQ A;  5B2I B;  3W99 B;  1F66 D;  5CPI D;  1P3G B;  3B0B A;  5B0Z C;  1S32 D;  3W97 D;  5B40 D;  3REK B;  2YFW A;  5CPK B;  2F2A C;  2PYO D;  2FJ7 A;  3AZG A;  1WWI A;  3REJ C;  3AZK D;  3AN2 A;  4H9Q B;  5AV8 C;  2BYK A;  1P3F D;  3AV1 D;  4H9R A;  3AN2 D;  5B0Z A;  4G92 C;  5KDM B;  3EPH A;  2Y2M A;  3WAA B;  3W99 D;  2ARO C;  5B0Z D;  3REH D;  3WTP C;  3REJ A;  1P3G D;  3AYW C;  5AY8 C;  4WNN A;  5AV8 A;  3REK D;  5CPK D;  3B6G B;  3AZJ C;  4UUZ B;  2FFF B;  5B1L B;  4H9P B;  3KUY B;  2ARO A;  3WTP A;  1HQ3 B;  1R4V A;  3A6N D;  2L5A A;  3AYW A;  4LD9 C;  5AY8 A;  3AV2 C;  3AZJ A;  4AWL C;  1ID3 B;  5B32 D;  5B24 C;  3X1V C;  5E5A C;  5AY8 D;  1EQZ D;  3UTB B;  3MGS B;  1BH9 A;  2NQB C;  4KHA B;  4KGC B;  4LD9 A;  3REI C;  1H3O A;  3AZF C;  4H9O A;  5B1L D;  4Z5T B;  3AV2 A;  1U35 B;  3KUY D;  5B1M B;  4ZUX C;  1B6W A;  5B24 A;  3X1V A;  5E5A A;  3REL C;  2NQB A;  4KUD B;  1N1J A;  5GXQ C;  1ZLA B;  3REI A;  3AZF A;  2Y2J A;  1HTA A;  3MGS D;  4ZUX A;  4J8X B;  3B0C T;  1TZY B;  2Y2O A;  3REL A;  5BT1 C;  1P34 C;  5BNX A;  3B6F B;  1P3L D;  4Z5T D;  1U35 D;  5GXQ A;  1BFM A;  2ZM5 A;  1P3M B;  5AVB B;  5DNN D;  1KX5 C;  2ZY5 A;  2W8S A;  1P3P B;  5JRG C;  5AV6 B;  1P34 A;  4E45 A;  3KXB C;  2IO5 C;  4J8X D;  3AZI C;  1TZY D;  3LZ1 B;  3AZN B;  4J8W B;  3MNN C;  1AOI D;  3B6F D;  3W98 C;  1KX5 A;  1M19 C;  5JRG A;  4WU9 B;  3C1B C;  3KXB A;  3TU4 C;  5CP6 B;  1KX4 B;  3VH6 A;  3VH6 W;  4CSR A;  1B67 A;  3AZI A;  1P3P D;  4R8P B;  5AV6 D;  3LZ0 C;  3MNN A;  3W98 A;  3AZM C;  4J8U B;  1P3O C;  1M19 A;  3MGP C;  3MGQ C;  4Z2M H;  1W2E A;  4ZBJ C;  3C1B A;  5JA4 B;  3MGR C;  3TU4 A;  4XUJ C;  2JCH A;  4YS3 C;  3LZ1 D;  4J8V C;  4WZS B;  1P3B B;  5CPI B;  3WA9 C;  4XZQ B;  1S32 B;  3W97 B;  3AZL C;  3LZ0 A;  4WU9 D;  5AVC C;  3X1U C;  3AZM A;  1M18 C;  1P3O A;  5CP6 D;  3MGP A;  3MGQ A;  1KX3 C;  1KX4 D;  5F99 C;  5CPJ C;  2YFW B;  3AZK B;  4EO5 B;  4R8P D;  3MGR A;  4XUJ A;  3AZG B;  4YS3 A;  4J8V A;  3AN2 B;  3WA9 A;  4J8U D;  4G91 C;  4XUJ D;  3AZL A;  2F8N K;  2BYK B;  3IP4 C;  5AVC A;  3X1U A;  3LEL C;  1P3I C;  3F6T A;  1M18 A;  5B0Z B;  3REH B;  1KX3 A;  1P3B D;  2BG1 A;  5F99 A;  5CPJ A;  4XZQ D;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...