5JA4B

Crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
KGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title H4K20me0 marks post-replicative chromatin and recruits the TONSL-MMS22L DNA repair complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ja4B00
1TAFB 3AV1A 2YFWB 5GT3A 3AZHB 4H9NA 3AZGA 5KDMB 1TZYC 3AZFB 4J8WD 5JA4B 3AZHC 1KU5A 3AZIB 4DRAA 3REIA 1P3OA 1P3GC 5CPKD 2NZDB 3AZIC 5B31D 3AV1B 5AV6D 5B24D 3WA9D 5GT3B 3REHC 3RELC 4H9NB 3MGQA 3AZGB 2NQBA 1P3MA 5BT1C 3UTAC 1ULYA 1KX4D 2F8NB 3AV1C 1P3PD 5B33A 5DNMA 5GT3C 5B32D 3MVDA 3W99A 3AZGC 4WU9D 5BS7A 3REIB 2RVQD 3O62D 1P3OB 4WU8D 5B1LA 5GSUA 4CAYA 5GT0A 1TZYD 2CV5C 3MGQB 2NQBB 1P3MB 3KSYA 3AZND 1M18A 5B33B 3VH5A 1P3AA 5DNMB 3MVDB 3W99B 3MGQC 3X1SC 2NQBC 5B31G 1BH8A 1P3GD 3W97A 5JRGA 3MVDC 3W99C 3AYWD 5GSUB 4CAYB 1KX5A 5GT0B 1AOIC 3REHD 3RELD 4WV4B 5CPIA 5BT1D 3REKA 3UTAD 5B1LC 5AV5B 3AV1D 5GT0C 4X23C 1M18B 1P3AB 3AFAC 4G92B 4XZQB 3AN2C 3KXBA 4H9PA 1KX3D 1BH8B 1P3AC 4ZBJC 4KGCC 4G92C 5JRGB 3B6FC 3B0CW 3MGPA 3AZKC 1F1EA 3AZLC 1KX5B 2CV5D 5CPIB 4E45A 3W97C 4J8WA 5JRGC 3REKB 3WTPC 1KX5C 3B6GA 3X1SD 3MGQD 3REKC 3KXBB 4YS3A 5AV6A 1M1AA 5B24A 3LJAD 1AOID 2FJ7C 1KX4A 2BYMA 4EO5B 1P3KC 5B1LD 1P3PA 4Z66C 4J8WB 5B32A 4X23D 3MGPC 4LD9A 4WU9A 3AFAD 4EO5C 3AN2D 3B6GB 3O62A 4WU8A 1P3AD 4KGCD 4YS3B 1N1JA 3B6GC 3B6FD 2F8NK 5AV6B 1M1AB 5B24B 3AZKD 1TZYA 3AZLD 4DRBA 4YS3C 3W97D 4NE3A 3AZNA 2BYMB 1KX4B 3WTPD 1P3PB 5AV6C 1M1AC 5B24C 4YM6A 5B32B 3WAAC 4LD9B 4WU9B 3REKD 3O62B 3NQJA 4NFTA 3MGRD 1P3GA 4KUDD 4WU8B 3AYWA 4LD9C 4WU9C 3VH6T 2RVQC 1ID3A 3REHA 3RELA 2FJ7D 1TZYB 4WU8C 1P3KD 4Z66D 3AZNB 3AV2C 1B67A 3MGPD 4YM6B 3NQUA 3VH6W 5GXQD 3KWQA 4G91B 3AZNC 5BNVA 1M19A 1KX3A 3NQJB 1P3GB 5E5AD 4YM6C 3B6GD 5B0ZC 1P3BA 3AYWB 4G91C 4JJNC 2CV5A 4NE6A 3REHB 3RELB 1P3IC 4YS3D 3UTAB 1P34A 3AYWC 1BFMA 1M1AD 5B2IA 1ID3C 3WAAD 3X1SA 3MNNC 3B0DB 3NQUB 3KWQB 5BNVB 1M19B 1KX3B 4LD9D 3B0DC 4Z5TA 3LJAA 1P3BB 1AOIA 3KWQC 1M19C 5AY8C 1KX3C 2CV5B 3LZ0C 3AV2D 1P34B 1P3BC 3AZJC 4X23A 3AFAA 3AN2A 3X1SB 1P34C 5B2IC 4KGCA 4YM6D 1B6WA 3B6FA 1H3OA 5B0ZD 3WKJC 4Z5TB 3AZKA 4JJND 3LJAB 3AZLA 1AOIB 1P3ID 1P3LA 5B0YA 3WTPA 5AVCC 5B1LB 4R8PA 4Z5TC 3LJAC 4H9QA 4X23B 1ID3D 5B32G 3MNND 2IO5B 3AFAB 3AN2B 3B0CT 3MGRA 5BO0A 4KHAA 4KUDA 4ZBJB 4KGCB 2IO5C 2PYOD 3B6FB 1H3OB 2FJ7A 3KWQD 3AZKB 2AROC 1M19D 1F66D 5AY8D 3AZLB 4J8UD 1P3KA 3LZ0D 1P3LB 3W97B 4Z66A 3WTPB 1P3BD 3AZJD 4R8PB 3TU4C 4ZUXA 3UT9A 4H9QB 1P3LC 5B0YC 5GXQA 1P34D 2HUEC 3A6NA 4R8PC 5B2ID 3MGRB 5E5AA 4KHAB 5DNNC 3C1BA 1U35A 4KUDB 3X1VA 5G49A 3WKJD 1P3FC 3KUYC 5AV9A 2FJ7B 3MGRC 4H9PB 4KUDC 5B40C 5AVCD 1P3KB 4Z66B 4Z5TD 3WAAA 4ZUXB 3MGPB 3REJD 5GXQB 3A6NB 1ZLAD 4ZUXC 5CP6A 5E5AB 3C1BB 1U35B 3UT9C 4AWLC 3X1VB 5G49B 5GXQC 2AROD 3A6NC 5AV9B 5E5AC 3C1BC 4H9RA 1U35C 3AV2A 3X1VC 3TU4D 4J8VD 5AV9C 3AZEA 3WAAB 2JSSA 1S32A 1P3LD 5B0YD 4R8PD 4WZSB 5DNND 1EQZA 5B0ZA 3X1UD 5CP6B 3MGSA 1P3FD 4JJNA 3KUYD 1P3IA 5B40D 3LZ1C 5CP6C 4H9RB 1N1JB 3AV2B 2YFVA 3X1TA 3MNNA 4Z2MH 1BH9A 3AZMA 1S32B 5CPJA 1TAFA 4ZUXD 3UT9D 3AZEC 2PYOA 4J8XA 5B0ZB 3W98D 1S32C 4QLCC 1WWIA 1F66A 4JJNB 5AY8A 3A6ND 4J8UA 3LZ0A 3C1BD 1U35D 1P3IB 1EQZC 3X1VD 3AZJA 3MGSC 4UUZA 4H9OA 2YFVB 5AV9D 1ID3B 3MNNB 3B0BA 1BH9B 2HIOA 3AZMB 3VH5W 5CPJB 3X1TC 4CSRA 5B2JD 3WKJA 2L5AA 2PYOB 4J8XB 3AZMC 4HGAC 3W96C 2F8NA 1F66B 5CPJC 5AY8B 1JFIA 4J8UB 5AVCA 1R4VA 3LZ1D 5CP6D 3LZ0B 2PYOC 4J8XC 3AZJB 4UUZB 1F66C 4H9OB 3REJA 4J8UC 3AZFC 2HIOB 1ZLAA 5CHLB 5B2IB 3C1CA 3AZED 4CSRB 1S32D 3WKJB 2HIOC 4QLCD 2AROA 2NZDC 3UTBA 1JFIB 1EQZD 5AVCB 3MGSD 3TU4A 4J8VA 3LELA 3REJB 5F99D 3VH6A 5DNNA 5AVBA 1ZLAB 3X1TD 1Q9CA 3X1UA 2BYKA 3C1CB 3REIC 3REJC 1P3FA 3KUYA 1HTAA 3AZMD 1P3OC 3W96D 2AROB 4H9SA 5AV5A 5CPJD 1ZLAC 5B40A 3R45A 3UTBB 3C1CC 3WTPE 3AZHD 4J8XD 4XUJA 5B1MA 3TU4B 4NE5A 4XZQA 4J8VB 3UTBC 3LELB 3AZFD 1P3MC 5B0YB 5B33C 2HUEB 5DNMC 3AZID 5DNNB 4J8VC 5AVBB 3LELC 3W98A 5C3IB 3X1UB 2BYKB 5BS7C 1P3FB 2HIOD 3KUYB 2NZDD 4WNNA 5AV8A 5BO0B 5AVBC 5B40B 3X1UC 3R45B 5C3IC 5GSUC 5GT3D 4XUJB 3AZGD 5B1MB 2F8ND 4H9SC 5AV5C 1HQ3A 1M18C 4XUJC 5B1MC 4XZQC 5B2JA 3REID 3UT9B 4AWLB 3W98B 1P3OD 3V9RA 4WNNB 5AV8B 3LZ1A 3C1CD 3W98C 5CPIC 1WWSA 2NQBD 5AV8C 3UTBD 1P3MD 4M6BA 1HQ3B 5BNXA 5B33D 5CPKA 5DNMD 5FUGA 3MVDD 3W99D 5B31A 3LELD 2CWEA 3WA9A 5B2JB 2F8NH 4QLCA 3KXBC 1HQ3C 3V9RB 2F8NG 5AVBD 3LZ1B 5B2JC 5GSUD 5GT0D 5AV5D 5F99A 4J8WC 1M18D 4XUJD 5BNXB 1A7WA 5CPKB 5B1MD 5FUGB 4XZQD 4E44A 5B31B 3AZEB 3WA9B 3W96A 4QLCB 4Z2MG 5CPKC 5JRGD 5B31C 2YFWA 3AZHA 1EQZB 3WA9C 5KDMA 3MGSB 1KX5D 3VH5T 5CPID 5AV8D 3AZFA 1KX4C 5JA4A 1P3PC 5F99B 5B32C 2LY8A 3AZIA 3X1TB 3O62C 3KXBD 1HQ3D 5F99C 4HGAB 2NZDA 3W96B 3UTAA
chains in the Genus database with same CATH superfamily
1TAFB 3AV1A 2YFWB 5GT3A 3AZHB 4H9NA 3AZGA 5KDMB 1TZYC 3AZFB 4J8WD 5JA4B 3AZHC 1KU5A 3AZIB 4DRAA 3REIA 1P3OA 1P3GC 5CPKD 2NZDB 3AZIC 5B31D 3AV1B 5AV6D 5B24D 3WA9D 5GT3B 3REHC 3RELC 4H9NB 3MGQA 3AZGB 2UWXA 1P3MA 5BT1C 3UTAC 1ULYA 1KX4D 2F8NB 2NQBA 3AV1C 1P3PD 5B33A 5DNMA 5GT3C 5B32D 3MVDA 2ZM5A 3W99A 3AZGC 4WU9D 2Y2OA 5BS7A 3REIB 2RVQD 3O62D 1P3OB 4WJ3C 4WU8D 5B1LA 5GSUA 4CAYA 5GT0A 1TZYD 2CV5C 3MGQB 2NQBB 1P3MB 3H0LC 3KSYA 3AZND 1M18A 5B33B 3VH5A 1P3AA 5DNMB 3MVDB 3W99B 3MGQC 3X1SC 2NQBC 5B31G 1BH8A 1P3GD 3W97A 5JRGA 3MVDC 3W99C 3AYWD 5GSUB 4CAYB 1KX5A 5GT0B 1AOIC 3REHD 3RELD 4WV4B 5CPIA 5BT1D 3REKA 3UTAD 5B1LC 5AV5B 3AV1D 5GT0C 4X23C 1M18B 1P3AB 3AFAC 4G92B 4XZQB 3AN2C 3KXBA 4H9PA 1KX3D 1BH8B 1P3AC 4ZBJC 4KGCC 4G92C 5JRGB 3B6FC 3B0CW 3MGPA 3AZKC 1F1EA 3AZLC 1KX5B 2CV5D 5CPIB 4E45A 3W97C 4J8WA 5JRGC 3REKB 3WTPC 1KX5C 3B6GA 3X1SD 3MGQD 3REKC 2BG1A 3KXBB 4YS3A 5AV6A 2XD5A 1M1AA 5B24A 3LJAD 1AOID 2RIQA 2FJ7C 1KX4A 2BYMA 4EO5B 1P3KC 5B1LD 1P3PA 4Z66C 4J8WB 5B32A 4X23D 3MGPC 4LD9A 4WU9A 3AFAD 4EO5C 3AN2D 3B6GB 3O62A 4WU8A 2F2AC 1P3AD 4KGCD 4YS3B 1N1JA 3B6GC 3B6FD 2F8NK 5AV6B 1M1AB 3AL0C 5B24B 3AZKD 1TZYA 3AZLD 4DRBA 4YS3C 3W97D 4NE3A 3AZNA 2BYMB 1KX4B 3WTPD 1P3PB 5AV6C 1M1AC 5B24C 4YM6A 5B32B 3WAAC 4LD9B 2Y2HA 4WU9B 3REKD 3O62B 3NQJA 4NFTA 3MGRD 1P3GA 4KUDD 4WU8B 3AYWA 4LD9C 4WU9C 3VH6T 2RVQC 1ID3A 3REHA 3RELA 2FJ7D 1TZYB 4WU8C 2ZY2A 1P3KD 4Z66D 3AZNB 3AV2C 1B67A 2Y2IA 3MGPD 4YM6B 3NQUA 2G5IC 3VH6W 5GXQD 3KWQA 4G91B 3AZNC 5BNVA 1M19A 1KX3A 3NQJB 1P3GB 5E5AD 4YM6C 3B6GD 5B0ZC 1P3BA 3AYWB 4G91C 4JJNC 2CV5A 4NE6A 3REHB 3RELB 1P3IC 4YS3D 3UTAB 1P34A 3AYWC 1BFMA 1M1AD 5B2IA 1ID3C 3WAAD 3X1SA 3MNNC 3B0DB 3NQUB 3KWQB 4DQYB 5BNVB 1M19B 1KX3B 3KFUG 4LD9D 2Y2PA 3B0DC 4Z5TA 3LJAA 1P3BB 1AOIA 3KWQC 1M19C 5AY8C 1KX3C 2CV5B 2Y2LA 3LZ0C 3AV2D 1P34B 1P3BC 3AZJC 4X23A 3AFAA 3AN2A 3X1SB 1P34C 5B2IC 4KGCA 4YM6D 1B6WA 3B6FA 1H3OA 5B0ZD 2ZY4A 3WKJC 4Z5TB 3AZKA 4JJND 3LJAB 3AZLA 1AOIB 1T3UA 4UPKA 3FDDA 1P3ID 1P3LA 5B0YA 3WTPA 5AVCC 5B1LB 4R8PA 4Z5TC 3LJAC 4H9QA 4X23B 1ID3D 2DQNC 5B32G 3MNND 2IO5B 3AFAB 3AN2B 3B0CT 3MGRA 5BO0A 4KHAA 4KUDA 4ZBJB 4KGCB 2IO5C 2ZY3A 2PYOD 3B6FB 1H3OB 2FJ7A 3KWQD 3AZKB 2AROC 1M19D 1F66D 5AY8D 3AZLB 4J8UD 1P3KA 3LZ0D 1P3LB 3W97B 4Z66A 3WTPB 1P3BD 3AZJD 4R8PB 3TU4C 4ZUXA 3UT9A 4H9QB 1P3LC 5B0YC 5GXQA 1P34D 2HUEC 3A6NA 4R8PC 5B2ID 3MGRB 5E5AA 4KHAB 5DNNC 3C1BA 1U35A 4KUDB 3X1VA 5G49A 3WKJD 1P3FC 3EG5B 1PZRA 3KUYC 5AV9A 2FJ7B 3MGRC 2Y2KA 4H9PB 4KUDC 5B40C 5AVCD 1P3KB 4Z66B 4Z5TD 3WAAA 4ZUXB 3MGPB 3REJD 5GXQB 3A6NB 1ZLAD 4ZUXC 5CP6A 5E5AB 3C1BB 1U35B 3UT9C 4AWLC 2Y2JA 3X1VB 5G49B 5GXQC 2AROD 2JE5A 3A6NC 5AV9B 5E5AC 3C1BC 4H9RA 1U35C 3AV2A 3X1VC 3TU4D 4J8VD 5AV9C 3AZEA 3WAAB 2JSSA 1S32A 2G5HC 1P3LD 5B0YD 4R8PD 4WZSB 5DNND 1EQZA 5B0ZA 3X1UD 5CP6B 3MGSA 1P3FD 4JJNA 3KUYD 1P3IA 5B40D 3H0MC 5CP6C 3LZ1C 4H9RB 1N1JB 3AV2B 2YFVA 3X1TA 3MNNA 3A1KA 1BH9A 4Z2MH 3AZMA 3EPJA 1S32B 5CPJA 1TAFA 4ZUXD 3UT9D 3AZEC 2PYOA 4J8XA 5B0ZB 3W98D 1S32C 2J8PA 3A1IA 4QLCC 1WWIA 1F66A 4JJNB 5AY8A 3A6ND 4J8UA 3LZ0A 3C1BD 1U35D 1P3IB 1EQZC 3EPKA 3X1VD 2W8SA 3AZJA 3MGSC 4UUZA 4H9OA 2YFVB 5AV9D 1ID3B 3MNNB 3B0BA 1BH9B 2HIOA 3AZMB 3VH5W 5CPJB 3X1TC 4CSRA 5B2JD 3WKJA 2L5AA 2PYOB 4J8XB 3AZMC 4HGAC 3W96C 2F8NA 1F66B 5CPJC 5AY8B 1JFIA 4J8UB 5AVCA 1R4VA 3LZ1D 5CP6D 3LZ0B 2PYOC 4J8XC 3AZJB 4UUZB 1F66C 4H9OB 3REJA 4J8UC 3AZFC 2HIOB 1ZLAA 5CHLB 5B2IB 3C1CA 3AZED 4CSRB 1S32D 3WKJB 2HIOC 4QLCD 2AROA 2NZDC 3UTBA 1JFIB 1EQZD 2VQRA 5AVCB 3MGSD 3TU4A 4J8VA 3LELA 3REJB 2Y2QA 5F99D 3VH6A 5DNNA 5AVBA 1ZLAB 3X1TD 1Q9CA 3X1UA 2BYKA 3C1CB 3REIC 3REJC 1P3FA 3KUYA 1HTAA 3AZMD 1P3OC 3W96D 2AROB 4H9SA 5AV5A 5CPJD 1ZLAC 5B40A 3R45A 3UTBB 3C1CC 3WTPE 3AZHD 4J8XD 4XUJA 5B1MA 3TU4B 4NE5A 4XZQA 4J8VB 2Y2GA 3UTBC 3LELB 3AZFD 1P3MC 5B0YB 5B33C 2HUEB 5DNMC 3AZID 5DNNB 4J8VC 5AVBB 3LELC 3W98A 5C3IB 3X1UB 2BYKB 5BS7C 1P3FB 2HIOD 3KUYB 2NZDD 4WNNA 5AV8A 5BO0B 5AVBC 5B40B 3R45B 5C3IC 3X1UC 5GSUC 2FFFB 1W2EA 5GT3D 4XUJB 3AZGD 5B1MB 2F8ND 4H9SC 5AV5C 3H0RC 1HQ3A 1Z2CB 2Y2NA 1M18C 4XUJC 5B1MC 3EPLA 4XZQC 5B2JA 3REID 3UT9B 4AWLB 3W98B 1P3OD 3V9RA 4WNNB 5AV8B 3LZ1A 3C1CD 3W98C 5CPIC 1WWSA 2NQBD 5AV8C 2JCHA 3UTBD 1P3MD 4M6BA 1HQ3B 5BNXA 5B33D 5CPKA 5DNMD 5FUGA 3MVDD 3W99D 5B31A 3LELD 3IP4C 2CWEA 3WA9A 5B2JB 2F8NH 4QLCA 3KXBC 1HQ3C 3V9RB 2F8NG 5AVBD 2Y2MA 3LZ1B 5B2JC 5GSUD 3F6TA 5GT0D 2ZY5A 5AV5D 5F99A 3P5JB 4J8WC 1M18D 2DF4C 4XUJD 5BNXB 1A7WA 5CPKB 5B1MD 5FUGB 4XZQD 4E44A 5B31B 3AZEB 3WA9B 3W96A 4QLCB 4Z2MG 5CPKC 5JRGD 5B31C 2YFWA 3AZHA 1EQZB 3WA9C 5KDMA 3MGSB 1KX5D 3VH5T 5CPID 2XD1A 5AV8D 3AZFA 1KX4C 5JA4A 1P3PC 5F99B 5B32C 2LY8A 3AZIA 3X1TB 3EPHA 3O62C 3KXBD 1HQ3D 5F99C 4HGAB 2NZDA 3W96B 3UTAA
chains in the Genus database with same CATH topology
1TAFB 3AV1A 2YFWB 5GT3A 3AZHB 4H9NA 3AZGA 5KDMB 1TZYC 3AZFB 4J8WD 5JA4B 3AZHC 1KU5A 3AZIB 4DRAA 3REIA 1P3OA 1P3GC 5CPKD 2NZDB 3AZIC 5B31D 3AV1B 5AV6D 5B24D 3WA9D 5GT3B 3REHC 3RELC 4H9NB 3MGQA 3AZGB 2UWXA 1P3MA 5BT1C 3UTAC 1ULYA 1KX4D 2F8NB 2NQBA 3AV1C 1P3PD 5B33A 5DNMA 5GT3C 5B32D 3MVDA 2ZM5A 3W99A 3AZGC 4WU9D 2Y2OA 5BS7A 3REIB 2RVQD 3O62D 1P3OB 4WJ3C 4WU8D 5B1LA 5GSUA 4CAYA 5GT0A 1TZYD 2CV5C 3MGQB 2NQBB 1P3MB 3H0LC 3KSYA 3AZND 1M18A 5B33B 3VH5A 1P3AA 5DNMB 3MVDB 3W99B 3MGQC 3X1SC 2NQBC 5B31G 1BH8A 1P3GD 3W97A 5JRGA 3MVDC 3W99C 3AYWD 5GSUB 4CAYB 1KX5A 5GT0B 1AOIC 3REHD 3RELD 4WV4B 5CPIA 5BT1D 3REKA 3UTAD 5B1LC 5AV5B 3AV1D 5GT0C 4X23C 1M18B 1P3AB 3AFAC 4G92B 4XZQB 3AN2C 3KXBA 4H9PA 1KX3D 1BH8B 1P3AC 4ZBJC 4KGCC 4G92C 5JRGB 3B6FC 3B0CW 3MGPA 3AZKC 1F1EA 3AZLC 1KX5B 2CV5D 5CPIB 4E45A 3W97C 4J8WA 5JRGC 3REKB 3WTPC 1KX5C 3B6GA 3X1SD 3MGQD 3REKC 2BG1A 3KXBB 4YS3A 5AV6A 2XD5A 1M1AA 5B24A 3LJAD 1AOID 2RIQA 2FJ7C 1KX4A 2BYMA 4EO5B 1P3KC 5B1LD 1P3PA 4Z66C 4J8WB 5B32A 4X23D 3MGPC 4LD9A 4WU9A 3AFAD 4EO5C 3AN2D 3B6GB 3O62A 4WU8A 2F2AC 1P3AD 4KGCD 4YS3B 1N1JA 3B6GC 3B6FD 2F8NK 5AV6B 1M1AB 3AL0C 5B24B 3AZKD 1TZYA 3AZLD 4DRBA 4YS3C 3W97D 4NE3A 3AZNA 2BYMB 1KX4B 3WTPD 1P3PB 5AV6C 1M1AC 5B24C 4YM6A 5B32B 3WAAC 4LD9B 2Y2HA 4WU9B 3REKD 3O62B 3NQJA 4NFTA 3MGRD 1P3GA 4KUDD 4WU8B 3AYWA 4LD9C 4WU9C 3VH6T 2RVQC 1ID3A 3REHA 3RELA 2FJ7D 1TZYB 4WU8C 2ZY2A 1P3KD 4Z66D 3AZNB 3AV2C 1B67A 2Y2IA 3MGPD 4YM6B 3NQUA 2G5IC 3VH6W 5GXQD 3KWQA 4G91B 3AZNC 5BNVA 1M19A 1KX3A 3NQJB 1P3GB 5E5AD 4YM6C 3B6GD 5B0ZC 1P3BA 3AYWB 4G91C 4JJNC 2CV5A 4NE6A 3REHB 3RELB 1P3IC 4YS3D 3UTAB 1P34A 3AYWC 1BFMA 1M1AD 5B2IA 1ID3C 3WAAD 3X1SA 3MNNC 3B0DB 3NQUB 3KWQB 4DQYB 5BNVB 1M19B 1KX3B 3KFUG 4LD9D 2Y2PA 3B0DC 4Z5TA 3LJAA 1P3BB 1AOIA 3KWQC 1M19C 5AY8C 1KX3C 2CV5B 2Y2LA 3LZ0C 3AV2D 1P34B 1P3BC 3AZJC 4X23A 3AFAA 3AN2A 3X1SB 1P34C 5B2IC 4KGCA 4YM6D 1B6WA 3B6FA 1H3OA 5B0ZD 2ZY4A 3WKJC 4Z5TB 3AZKA 4JJND 3LJAB 3AZLA 1AOIB 1T3UA 4UPKA 3FDDA 1P3ID 1P3LA 5B0YA 3WTPA 5AVCC 5B1LB 4R8PA 4Z5TC 3LJAC 4H9QA 4X23B 1ID3D 2DQNC 5B32G 3MNND 2IO5B 3AFAB 3AN2B 3B0CT 3MGRA 5BO0A 4KHAA 4KUDA 4ZBJB 4KGCB 2IO5C 2ZY3A 2PYOD 3B6FB 1H3OB 2FJ7A 3KWQD 3AZKB 2AROC 1M19D 1F66D 5AY8D 3AZLB 4J8UD 1P3KA 3LZ0D 1P3LB 3W97B 4Z66A 3WTPB 1P3BD 3AZJD 4R8PB 3TU4C 4ZUXA 3UT9A 4H9QB 1P3LC 5B0YC 5GXQA 1P34D 2HUEC 3A6NA 4R8PC 5B2ID 3MGRB 5E5AA 4KHAB 5DNNC 3C1BA 1U35A 4KUDB 3X1VA 5G49A 3WKJD 1P3FC 3EG5B 1PZRA 3KUYC 5AV9A 2FJ7B 3MGRC 2Y2KA 4H9PB 4KUDC 5B40C 5AVCD 1P3KB 4Z66B 4Z5TD 3WAAA 4ZUXB 3MGPB 3REJD 5GXQB 3A6NB 1ZLAD 4ZUXC 5CP6A 5E5AB 3C1BB 1U35B 3UT9C 4AWLC 2Y2JA 3X1VB 5G49B 5GXQC 2AROD 2JE5A 3A6NC 5AV9B 5E5AC 3C1BC 4H9RA 1U35C 3AV2A 3X1VC 3TU4D 4J8VD 5AV9C 3AZEA 3WAAB 2JSSA 1S32A 2G5HC 1P3LD 5B0YD 4R8PD 4WZSB 5DNND 1EQZA 5B0ZA 3X1UD 5CP6B 3MGSA 1P3FD 4JJNA 3KUYD 1P3IA 5B40D 3H0MC 5CP6C 3LZ1C 4H9RB 1N1JB 3AV2B 2YFVA 3X1TA 3MNNA 3A1KA 1BH9A 4Z2MH 3AZMA 3EPJA 1S32B 5CPJA 1TAFA 4ZUXD 3UT9D 3AZEC 2PYOA 4J8XA 5B0ZB 3W98D 1S32C 2J8PA 3A1IA 4QLCC 1WWIA 1F66A 4JJNB 5AY8A 3A6ND 4J8UA 3LZ0A 3C1BD 1U35D 1P3IB 1EQZC 3EPKA 3X1VD 2W8SA 3AZJA 3MGSC 4UUZA 4H9OA 2YFVB 5AV9D 1ID3B 3MNNB 3B0BA 1BH9B 2HIOA 3AZMB 3VH5W 5CPJB 3X1TC 4CSRA 5B2JD 3WKJA 2L5AA 2PYOB 4J8XB 3AZMC 4HGAC 3W96C 2F8NA 1F66B 5CPJC 5AY8B 1JFIA 4J8UB 5AVCA 1R4VA 3LZ1D 5CP6D 3LZ0B 2PYOC 4J8XC 3AZJB 4UUZB 1F66C 4H9OB 3REJA 4J8UC 3AZFC 2HIOB 1ZLAA 5CHLB 5B2IB 3C1CA 3AZED 4CSRB 1S32D 3WKJB 2HIOC 4QLCD 2AROA 2NZDC 3UTBA 1JFIB 1EQZD 2VQRA 5AVCB 3MGSD 3TU4A 4J8VA 3LELA 3REJB 2Y2QA 5F99D 3VH6A 5DNNA 5AVBA 1ZLAB 3X1TD 1Q9CA 3X1UA 2BYKA 3C1CB 3REIC 3REJC 1P3FA 3KUYA 1HTAA 3AZMD 1P3OC 3W96D 2AROB 4H9SA 5AV5A 5CPJD 1ZLAC 5B40A 3R45A 3UTBB 3C1CC 3WTPE 3AZHD 4J8XD 4XUJA 5B1MA 3TU4B 4NE5A 4XZQA 4J8VB 2Y2GA 3UTBC 3LELB 3AZFD 1P3MC 5B0YB 5B33C 2HUEB 5DNMC 3AZID 5DNNB 4J8VC 5AVBB 3LELC 3W98A 5C3IB 3X1UB 2BYKB 5BS7C 1P3FB 2HIOD 3KUYB 2NZDD 4WNNA 5AV8A 5BO0B 5AVBC 5B40B 3R45B 5C3IC 3X1UC 5GSUC 2FFFB 1W2EA 5GT3D 4XUJB 3AZGD 5B1MB 2F8ND 4H9SC 5AV5C 3H0RC 1HQ3A 1Z2CB 2Y2NA 1M18C 4XUJC 5B1MC 3EPLA 4XZQC 5B2JA 3REID 3UT9B 4AWLB 3W98B 1P3OD 3V9RA 4WNNB 5AV8B 3LZ1A 3C1CD 3W98C 5CPIC 1WWSA 2NQBD 5AV8C 2JCHA 3UTBD 1P3MD 4M6BA 1HQ3B 5BNXA 5B33D 5CPKA 5DNMD 5FUGA 3MVDD 3W99D 5B31A 3LELD 3IP4C 2CWEA 3WA9A 5B2JB 2F8NH 4QLCA 3KXBC 1HQ3C 3V9RB 2F8NG 5AVBD 2Y2MA 3LZ1B 5B2JC 5GSUD 3F6TA 5GT0D 2ZY5A 5AV5D 5F99A 3P5JB 4J8WC 1M18D 2DF4C 4XUJD 5BNXB 1A7WA 5CPKB 5B1MD 5FUGB 4XZQD 4E44A 5B31B 3AZEB 3WA9B 3W96A 4QLCB 4Z2MG 5CPKC 5JRGD 5B31C 2YFWA 3AZHA 1EQZB 3WA9C 5KDMA 3MGSB 1KX5D 3VH5T 5CPID 2XD1A 5AV8D 3AZFA 1KX4C 5JA4A 1P3PC 5F99B 5B32C 2LY8A 3AZIA 3X1TB 3EPHA 3O62C 3KXBD 1HQ3D 5F99C 4HGAB 2NZDA 3W96B 3UTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAF B;  3AV1 A;  2YFW B;  5GT3 A;  3AZH B;  4H9N A;  3AZG A;  5KDM B;  1TZY C;  3AZF B;  4J8W D;  5JA4 B;  3AZH C;  1KU5 A;  3AZI B;  4DRA A;  3REI A;  1P3O A;  1P3G C;  5CPK D;  2NZD B;  3AZI C;  5B31 D;  3AV1 B;  5AV6 D;  5B24 D;  3WA9 D;  5GT3 B;  3REH C;  3REL C;  4H9N B;  3MGQ A;  3AZG B;  2NQB A;  1P3M A;  5BT1 C;  3UTA C;  1ULY A;  1KX4 D;  2F8N B;  3AV1 C;  1P3P D;  5B33 A;  5DNM A;  5GT3 C;  5B32 D;  3MVD A;  3W99 A;  3AZG C;  4WU9 D;  5BS7 A;  3REI B;  2RVQ D;  3O62 D;  1P3O B;  4WU8 D;  5B1L A;  5GSU A;  4CAY A;  5GT0 A;  1TZY D;  2CV5 C;  3MGQ B;  2NQB B;  1P3M B;  3KSY A;  3AZN D;  1M18 A;  5B33 B;  3VH5 A;  1P3A A;  5DNM B;  3MVD B;  3W99 B;  3MGQ C;  3X1S C;  2NQB C;  5B31 G;  1BH8 A;  1P3G D;  3W97 A;  5JRG A;  3MVD C;  3W99 C;  3AYW D;  5GSU B;  4CAY B;  1KX5 A;  5GT0 B;  1AOI C;  3REH D;  3REL D;  4WV4 B;  5CPI A;  5BT1 D;  3REK A;  3UTA D;  5B1L C;  5AV5 B;  3AV1 D;  5GT0 C;  4X23 C;  1M18 B;  1P3A B;  3AFA C;  4G92 B;  4XZQ B;  3AN2 C;  3KXB A;  4H9P A;  1KX3 D;  1BH8 B;  1P3A C;  4ZBJ C;  4KGC C;  4G92 C;  5JRG B;  3B6F C;  3B0C W;  3MGP A;  3AZK C;  1F1E A;  3AZL C;  1KX5 B;  2CV5 D;  5CPI B;  4E45 A;  3W97 C;  4J8W A;  5JRG C;  3REK B;  3WTP C;  1KX5 C;  3B6G A;  3X1S D;  3MGQ D;  3REK C;  3KXB B;  4YS3 A;  5AV6 A;  1M1A A;  5B24 A;  3LJA D;  1AOI D;  2FJ7 C;  1KX4 A;  2BYM A;  4EO5 B;  1P3K C;  5B1L D;  1P3P A;  4Z66 C;  4J8W B;  5B32 A;  4X23 D;  3MGP C;  4LD9 A;  4WU9 A;  3AFA D;  4EO5 C;  3AN2 D;  3B6G B;  3O62 A;  4WU8 A;  1P3A D;  4KGC D;  4YS3 B;  1N1J A;  3B6G C;  3B6F D;  2F8N K;  5AV6 B;  1M1A B;  5B24 B;  3AZK D;  1TZY A;  3AZL D;  4DRB A;  4YS3 C;  3W97 D;  4NE3 A;  3AZN A;  2BYM B;  1KX4 B;  3WTP D;  1P3P B;  5AV6 C;  1M1A C;  5B24 C;  4YM6 A;  5B32 B;  3WAA C;  4LD9 B;  4WU9 B;  3REK D;  3O62 B;  3NQJ A;  4NFT A;  3MGR D;  1P3G A;  4KUD D;  4WU8 B;  3AYW A;  4LD9 C;  4WU9 C;  3VH6 T;  2RVQ C;  1ID3 A;  3REH A;  3REL A;  2FJ7 D;  1TZY B;  4WU8 C;  1P3K D;  4Z66 D;  3AZN B;  3AV2 C;  1B67 A;  3MGP D;  4YM6 B;  3NQU A;  3VH6 W;  5GXQ D;  3KWQ A;  4G91 B;  3AZN C;  5BNV A;  1M19 A;  1KX3 A;  3NQJ B;  1P3G B;  5E5A D;  4YM6 C;  3B6G D;  5B0Z C;  1P3B A;  3AYW B;  4G91 C;  4JJN C;  2CV5 A;  4NE6 A;  3REH B;  3REL B;  1P3I C;  4YS3 D;  3UTA B;  1P34 A;  3AYW C;  1BFM A;  1M1A D;  5B2I A;  1ID3 C;  3WAA D;  3X1S A;  3MNN C;  3B0D B;  3NQU B;  3KWQ B;  5BNV B;  1M19 B;  1KX3 B;  4LD9 D;  3B0D C;  4Z5T A;  3LJA A;  1P3B B;  1AOI A;  3KWQ C;  1M19 C;  5AY8 C;  1KX3 C;  2CV5 B;  3LZ0 C;  3AV2 D;  1P34 B;  1P3B C;  3AZJ C;  4X23 A;  3AFA A;  3AN2 A;  3X1S B;  1P34 C;  5B2I C;  4KGC A;  4YM6 D;  1B6W A;  3B6F A;  1H3O A;  5B0Z D;  3WKJ C;  4Z5T B;  3AZK A;  4JJN D;  3LJA B;  3AZL A;  1AOI B;  1P3I D;  1P3L A;  5B0Y A;  3WTP A;  5AVC C;  5B1L B;  4R8P A;  4Z5T C;  3LJA C;  4H9Q A;  4X23 B;  1ID3 D;  5B32 G;  3MNN D;  2IO5 B;  3AFA B;  3AN2 B;  3B0C T;  3MGR A;  5BO0 A;  4KHA A;  4KUD A;  4ZBJ B;  4KGC B;  2IO5 C;  2PYO D;  3B6F B;  1H3O B;  2FJ7 A;  3KWQ D;  3AZK B;  2ARO C;  1M19 D;  1F66 D;  5AY8 D;  3AZL B;  4J8U D;  1P3K A;  3LZ0 D;  1P3L B;  3W97 B;  4Z66 A;  3WTP B;  1P3B D;  3AZJ D;  4R8P B;  3TU4 C;  4ZUX A;  3UT9 A;  4H9Q B;  1P3L C;  5B0Y C;  5GXQ A;  1P34 D;  2HUE C;  3A6N A;  4R8P C;  5B2I D;  3MGR B;  5E5A A;  4KHA B;  5DNN C;  3C1B A;  1U35 A;  4KUD B;  3X1V A;  5G49 A;  3WKJ D;  1P3F C;  3KUY C;  5AV9 A;  2FJ7 B;  3MGR C;  4H9P B;  4KUD C;  5B40 C;  5AVC D;  1P3K B;  4Z66 B;  4Z5T D;  3WAA A;  4ZUX B;  3MGP B;  3REJ D;  5GXQ B;  3A6N B;  1ZLA D;  4ZUX C;  5CP6 A;  5E5A B;  3C1B B;  1U35 B;  3UT9 C;  4AWL C;  3X1V B;  5G49 B;  5GXQ C;  2ARO D;  3A6N C;  5AV9 B;  5E5A C;  3C1B C;  4H9R A;  1U35 C;  3AV2 A;  3X1V C;  3TU4 D;  4J8V D;  5AV9 C;  3AZE A;  3WAA B;  2JSS A;  1S32 A;  1P3L D;  5B0Y D;  4R8P D;  4WZS B;  5DNN D;  1EQZ A;  5B0Z A;  3X1U D;  5CP6 B;  3MGS A;  1P3F D;  4JJN A;  3KUY D;  1P3I A;  5B40 D;  3LZ1 C;  5CP6 C;  4H9R B;  1N1J B;  3AV2 B;  2YFV A;  3X1T A;  3MNN A;  4Z2M H;  1BH9 A;  3AZM A;  1S32 B;  5CPJ A;  1TAF A;  4ZUX D;  3UT9 D;  3AZE C;  2PYO A;  4J8X A;  5B0Z B;  3W98 D;  1S32 C;  4QLC C;  1WWI A;  1F66 A;  4JJN B;  5AY8 A;  3A6N D;  4J8U A;  3LZ0 A;  3C1B D;  1U35 D;  1P3I B;  1EQZ C;  3X1V D;  3AZJ A;  3MGS C;  4UUZ A;  4H9O A;  2YFV B;  5AV9 D;  1ID3 B;  3MNN B;  3B0B A;  1BH9 B;  2HIO A;  3AZM B;  3VH5 W;  5CPJ B;  3X1T C;  4CSR A;  5B2J D;  3WKJ A;  2L5A A;  2PYO B;  4J8X B;  3AZM C;  4HGA C;  3W96 C;  2F8N A;  1F66 B;  5CPJ C;  5AY8 B;  1JFI A;  4J8U B;  5AVC A;  1R4V A;  3LZ1 D;  5CP6 D;  3LZ0 B;  2PYO C;  4J8X C;  3AZJ B;  4UUZ B;  1F66 C;  4H9O B;  3REJ A;  4J8U C;  3AZF C;  2HIO B;  1ZLA A;  5CHL B;  5B2I B;  3C1C A;  3AZE D;  4CSR B;  1S32 D;  3WKJ B;  2HIO C;  4QLC D;  2ARO A;  2NZD C;  3UTB A;  1JFI B;  1EQZ D;  5AVC B;  3MGS D;  3TU4 A;  4J8V A;  3LEL A;  3REJ B;  5F99 D;  3VH6 A;  5DNN A;  5AVB A;  1ZLA B;  3X1T D;  1Q9C A;  3X1U A;  2BYK A;  3C1C B;  3REI C;  3REJ C;  1P3F A;  3KUY A;  1HTA A;  3AZM D;  1P3O C;  3W96 D;  2ARO B;  4H9S A;  5AV5 A;  5CPJ D;  1ZLA C;  5B40 A;  3R45 A;  3UTB B;  3C1C C;  3WTP E;  3AZH D;  4J8X D;  4XUJ A;  5B1M A;  3TU4 B;  4NE5 A;  4XZQ A;  4J8V B;  3UTB C;  3LEL B;  3AZF D;  1P3M C;  5B0Y B;  5B33 C;  2HUE B;  5DNM C;  3AZI D;  5DNN B;  4J8V C;  5AVB B;  3LEL C;  3W98 A;  5C3I B;  3X1U B;  2BYK B;  5BS7 C;  1P3F B;  2HIO D;  3KUY B;  2NZD D;  4WNN A;  5AV8 A;  5BO0 B;  5AVB C;  5B40 B;  3X1U C;  3R45 B;  5C3I C;  5GSU C;  5GT3 D;  4XUJ B;  3AZG D;  5B1M B;  2F8N D;  4H9S C;  5AV5 C;  1HQ3 A;  1M18 C;  4XUJ C;  5B1M C;  4XZQ C;  5B2J A;  3REI D;  3UT9 B;  4AWL B;  3W98 B;  1P3O D;  3V9R A;  4WNN B;  5AV8 B;  3LZ1 A;  3C1C D;  3W98 C;  5CPI C;  1WWS A;  2NQB D;  5AV8 C;  3UTB D;  1P3M D;  4M6B A;  1HQ3 B;  5BNX A;  5B33 D;  5CPK A;  5DNM D;  5FUG A;  3MVD D;  3W99 D;  5B31 A;  3LEL D;  2CWE A;  3WA9 A;  5B2J B;  2F8N H;  4QLC A;  3KXB C;  1HQ3 C;  3V9R B;  2F8N G;  5AVB D;  3LZ1 B;  5B2J C;  5GSU D;  5GT0 D;  5AV5 D;  5F99 A;  4J8W C;  1M18 D;  4XUJ D;  5BNX B;  1A7W A;  5CPK B;  5B1M D;  5FUG B;  4XZQ D;  4E44 A;  5B31 B;  3AZE B;  3WA9 B;  3W96 A;  4QLC B;  4Z2M G;  5CPK C;  5JRG D;  5B31 C;  2YFW A;  3AZH A;  1EQZ B;  3WA9 C;  5KDM A;  3MGS B;  1KX5 D;  3VH5 T;  5CPI D;  5AV8 D;  3AZF A;  1KX4 C;  5JA4 A;  1P3P C;  5F99 B;  5B32 C;  2LY8 A;  3AZI A;  3X1T B;  3O62 C;  3KXB D;  1HQ3 D;  5F99 C;  4HGA B;  2NZD A;  3W96 B;  3UTA A; 
#chains in the Genus database with same CATH topology
 1TAF B;  3AV1 A;  2YFW B;  5GT3 A;  3AZH B;  4H9N A;  3AZG A;  5KDM B;  1TZY C;  3AZF B;  4J8W D;  5JA4 B;  3AZH C;  1KU5 A;  3AZI B;  4DRA A;  3REI A;  1P3O A;  1P3G C;  5CPK D;  2NZD B;  3AZI C;  5B31 D;  3AV1 B;  5AV6 D;  5B24 D;  3WA9 D;  5GT3 B;  3REH C;  3REL C;  4H9N B;  3MGQ A;  3AZG B;  2UWX A;  1P3M A;  5BT1 C;  3UTA C;  1ULY A;  1KX4 D;  2F8N B;  2NQB A;  3AV1 C;  1P3P D;  5B33 A;  5DNM A;  5GT3 C;  5B32 D;  3MVD A;  2ZM5 A;  3W99 A;  3AZG C;  4WU9 D;  2Y2O A;  5BS7 A;  3REI B;  2RVQ D;  3O62 D;  1P3O B;  4WJ3 C;  4WU8 D;  5B1L A;  5GSU A;  4CAY A;  5GT0 A;  1TZY D;  2CV5 C;  3MGQ B;  2NQB B;  1P3M B;  3H0L C;  3KSY A;  3AZN D;  1M18 A;  5B33 B;  3VH5 A;  1P3A A;  5DNM B;  3MVD B;  3W99 B;  3MGQ C;  3X1S C;  2NQB C;  5B31 G;  1BH8 A;  1P3G D;  3W97 A;  5JRG A;  3MVD C;  3W99 C;  3AYW D;  5GSU B;  4CAY B;  1KX5 A;  5GT0 B;  1AOI C;  3REH D;  3REL D;  4WV4 B;  5CPI A;  5BT1 D;  3REK A;  3UTA D;  5B1L C;  5AV5 B;  3AV1 D;  5GT0 C;  4X23 C;  1M18 B;  1P3A B;  3AFA C;  4G92 B;  4XZQ B;  3AN2 C;  3KXB A;  4H9P A;  1KX3 D;  1BH8 B;  1P3A C;  4ZBJ C;  4KGC C;  4G92 C;  5JRG B;  3B6F C;  3B0C W;  3MGP A;  3AZK C;  1F1E A;  3AZL C;  1KX5 B;  2CV5 D;  5CPI B;  4E45 A;  3W97 C;  4J8W A;  5JRG C;  3REK B;  3WTP C;  1KX5 C;  3B6G A;  3X1S D;  3MGQ D;  3REK C;  2BG1 A;  3KXB B;  4YS3 A;  5AV6 A;  2XD5 A;  1M1A A;  5B24 A;  3LJA D;  1AOI D;  2RIQ A;  2FJ7 C;  1KX4 A;  2BYM A;  4EO5 B;  1P3K C;  5B1L D;  1P3P A;  4Z66 C;  4J8W B;  5B32 A;  4X23 D;  3MGP C;  4LD9 A;  4WU9 A;  3AFA D;  4EO5 C;  3AN2 D;  3B6G B;  3O62 A;  4WU8 A;  2F2A C;  1P3A D;  4KGC D;  4YS3 B;  1N1J A;  3B6G C;  3B6F D;  2F8N K;  5AV6 B;  1M1A B;  3AL0 C;  5B24 B;  3AZK D;  1TZY A;  3AZL D;  4DRB A;  4YS3 C;  3W97 D;  4NE3 A;  3AZN A;  2BYM B;  1KX4 B;  3WTP D;  1P3P B;  5AV6 C;  1M1A C;  5B24 C;  4YM6 A;  5B32 B;  3WAA C;  4LD9 B;  2Y2H A;  4WU9 B;  3REK D;  3O62 B;  3NQJ A;  4NFT A;  3MGR D;  1P3G A;  4KUD D;  4WU8 B;  3AYW A;  4LD9 C;  4WU9 C;  3VH6 T;  2RVQ C;  1ID3 A;  3REH A;  3REL A;  2FJ7 D;  1TZY B;  4WU8 C;  2ZY2 A;  1P3K D;  4Z66 D;  3AZN B;  3AV2 C;  1B67 A;  2Y2I A;  3MGP D;  4YM6 B;  3NQU A;  2G5I C;  3VH6 W;  5GXQ D;  3KWQ A;  4G91 B;  3AZN C;  5BNV A;  1M19 A;  1KX3 A;  3NQJ B;  1P3G B;  5E5A D;  4YM6 C;  3B6G D;  5B0Z C;  1P3B A;  3AYW B;  4G91 C;  4JJN C;  2CV5 A;  4NE6 A;  3REH B;  3REL B;  1P3I C;  4YS3 D;  3UTA B;  1P34 A;  3AYW C;  1BFM A;  1M1A D;  5B2I A;  1ID3 C;  3WAA D;  3X1S A;  3MNN C;  3B0D B;  3NQU B;  3KWQ B;  4DQY B;  5BNV B;  1M19 B;  1KX3 B;  3KFU G;  4LD9 D;  2Y2P A;  3B0D C;  4Z5T A;  3LJA A;  1P3B B;  1AOI A;  3KWQ C;  1M19 C;  5AY8 C;  1KX3 C;  2CV5 B;  2Y2L A;  3LZ0 C;  3AV2 D;  1P34 B;  1P3B C;  3AZJ C;  4X23 A;  3AFA A;  3AN2 A;  3X1S B;  1P34 C;  5B2I C;  4KGC A;  4YM6 D;  1B6W A;  3B6F A;  1H3O A;  5B0Z D;  2ZY4 A;  3WKJ C;  4Z5T B;  3AZK A;  4JJN D;  3LJA B;  3AZL A;  1AOI B;  1T3U A;  4UPK A;  3FDD A;  1P3I D;  1P3L A;  5B0Y A;  3WTP A;  5AVC C;  5B1L B;  4R8P A;  4Z5T C;  3LJA C;  4H9Q A;  4X23 B;  1ID3 D;  2DQN C;  5B32 G;  3MNN D;  2IO5 B;  3AFA B;  3AN2 B;  3B0C T;  3MGR A;  5BO0 A;  4KHA A;  4KUD A;  4ZBJ B;  4KGC B;  2IO5 C;  2ZY3 A;  2PYO D;  3B6F B;  1H3O B;  2FJ7 A;  3KWQ D;  3AZK B;  2ARO C;  1M19 D;  1F66 D;  5AY8 D;  3AZL B;  4J8U D;  1P3K A;  3LZ0 D;  1P3L B;  3W97 B;  4Z66 A;  3WTP B;  1P3B D;  3AZJ D;  4R8P B;  3TU4 C;  4ZUX A;  3UT9 A;  4H9Q B;  1P3L C;  5B0Y C;  5GXQ A;  1P34 D;  2HUE C;  3A6N A;  4R8P C;  5B2I D;  3MGR B;  5E5A A;  4KHA B;  5DNN C;  3C1B A;  1U35 A;  4KUD B;  3X1V A;  5G49 A;  3WKJ D;  1P3F C;  3EG5 B;  1PZR A;  3KUY C;  5AV9 A;  2FJ7 B;  3MGR C;  2Y2K A;  4H9P B;  4KUD C;  5B40 C;  5AVC D;  1P3K B;  4Z66 B;  4Z5T D;  3WAA A;  4ZUX B;  3MGP B;  3REJ D;  5GXQ B;  3A6N B;  1ZLA D;  4ZUX C;  5CP6 A;  5E5A B;  3C1B B;  1U35 B;  3UT9 C;  4AWL C;  2Y2J A;  3X1V B;  5G49 B;  5GXQ C;  2ARO D;  2JE5 A;  3A6N C;  5AV9 B;  5E5A C;  3C1B C;  4H9R A;  1U35 C;  3AV2 A;  3X1V C;  3TU4 D;  4J8V D;  5AV9 C;  3AZE A;  3WAA B;  2JSS A;  1S32 A;  2G5H C;  1P3L D;  5B0Y D;  4R8P D;  4WZS B;  5DNN D;  1EQZ A;  5B0Z A;  3X1U D;  5CP6 B;  3MGS A;  1P3F D;  4JJN A;  3KUY D;  1P3I A;  5B40 D;  3H0M C;  5CP6 C;  3LZ1 C;  4H9R B;  1N1J B;  3AV2 B;  2YFV A;  3X1T A;  3MNN A;  3A1K A;  1BH9 A;  4Z2M H;  3AZM A;  3EPJ A;  1S32 B;  5CPJ A;  1TAF A;  4ZUX D;  3UT9 D;  3AZE C;  2PYO A;  4J8X A;  5B0Z B;  3W98 D;  1S32 C;  2J8P A;  3A1I A;  4QLC C;  1WWI A;  1F66 A;  4JJN B;  5AY8 A;  3A6N D;  4J8U A;  3LZ0 A;  3C1B D;  1U35 D;  1P3I B;  1EQZ C;  3EPK A;  3X1V D;  2W8S A;  3AZJ A;  3MGS C;  4UUZ A;  4H9O A;  2YFV B;  5AV9 D;  1ID3 B;  3MNN B;  3B0B A;  1BH9 B;  2HIO A;  3AZM B;  3VH5 W;  5CPJ B;  3X1T C;  4CSR A;  5B2J D;  3WKJ A;  2L5A A;  2PYO B;  4J8X B;  3AZM C;  4HGA C;  3W96 C;  2F8N A;  1F66 B;  5CPJ C;  5AY8 B;  1JFI A;  4J8U B;  5AVC A;  1R4V A;  3LZ1 D;  5CP6 D;  3LZ0 B;  2PYO C;  4J8X C;  3AZJ B;  4UUZ B;  1F66 C;  4H9O B;  3REJ A;  4J8U C;  3AZF C;  2HIO B;  1ZLA A;  5CHL B;  5B2I B;  3C1C A;  3AZE D;  4CSR B;  1S32 D;  3WKJ B;  2HIO C;  4QLC D;  2ARO A;  2NZD C;  3UTB A;  1JFI B;  1EQZ D;  2VQR A;  5AVC B;  3MGS D;  3TU4 A;  4J8V A;  3LEL A;  3REJ B;  2Y2Q A;  5F99 D;  3VH6 A;  5DNN A;  5AVB A;  1ZLA B;  3X1T D;  1Q9C A;  3X1U A;  2BYK A;  3C1C B;  3REI C;  3REJ C;  1P3F A;  3KUY A;  1HTA A;  3AZM D;  1P3O C;  3W96 D;  2ARO B;  4H9S A;  5AV5 A;  5CPJ D;  1ZLA C;  5B40 A;  3R45 A;  3UTB B;  3C1C C;  3WTP E;  3AZH D;  4J8X D;  4XUJ A;  5B1M A;  3TU4 B;  4NE5 A;  4XZQ A;  4J8V B;  2Y2G A;  3UTB C;  3LEL B;  3AZF D;  1P3M C;  5B0Y B;  5B33 C;  2HUE B;  5DNM C;  3AZI D;  5DNN B;  4J8V C;  5AVB B;  3LEL C;  3W98 A;  5C3I B;  3X1U B;  2BYK B;  5BS7 C;  1P3F B;  2HIO D;  3KUY B;  2NZD D;  4WNN A;  5AV8 A;  5BO0 B;  5AVB C;  5B40 B;  3R45 B;  5C3I C;  3X1U C;  5GSU C;  2FFF B;  1W2E A;  5GT3 D;  4XUJ B;  3AZG D;  5B1M B;  2F8N D;  4H9S C;  5AV5 C;  3H0R C;  1HQ3 A;  1Z2C B;  2Y2N A;  1M18 C;  4XUJ C;  5B1M C;  3EPL A;  4XZQ C;  5B2J A;  3REI D;  3UT9 B;  4AWL B;  3W98 B;  1P3O D;  3V9R A;  4WNN B;  5AV8 B;  3LZ1 A;  3C1C D;  3W98 C;  5CPI C;  1WWS A;  2NQB D;  5AV8 C;  2JCH A;  3UTB D;  1P3M D;  4M6B A;  1HQ3 B;  5BNX A;  5B33 D;  5CPK A;  5DNM D;  5FUG A;  3MVD D;  3W99 D;  5B31 A;  3LEL D;  3IP4 C;  2CWE A;  3WA9 A;  5B2J B;  2F8N H;  4QLC A;  3KXB C;  1HQ3 C;  3V9R B;  2F8N G;  5AVB D;  2Y2M A;  3LZ1 B;  5B2J C;  5GSU D;  3F6T A;  5GT0 D;  2ZY5 A;  5AV5 D;  5F99 A;  3P5J B;  4J8W C;  1M18 D;  2DF4 C;  4XUJ D;  5BNX B;  1A7W A;  5CPK B;  5B1M D;  5FUG B;  4XZQ D;  4E44 A;  5B31 B;  3AZE B;  3WA9 B;  3W96 A;  4QLC B;  4Z2M G;  5CPK C;  5JRG D;  5B31 C;  2YFW A;  3AZH A;  1EQZ B;  3WA9 C;  5KDM A;  3MGS B;  1KX5 D;  3VH5 T;  5CPI D;  2XD1 A;  5AV8 D;  3AZF A;  1KX4 C;  5JA4 A;  1P3P C;  5F99 B;  5B32 C;  2LY8 A;  3AZI A;  3X1T B;  3EPH A;  3O62 C;  3KXB D;  1HQ3 D;  5F99 C;  4HGA B;  2NZD A;  3W96 B;  3UTA A; 
#chains in the Genus database with same CATH homology
 1TAF B;  3AV1 A;  2YFW B;  5GT3 A;  3AZH B;  4H9N A;  3AZG A;  5KDM B;  1TZY C;  3AZF B;  4J8W D;  5JA4 B;  3AZH C;  1KU5 A;  3AZI B;  4DRA A;  3REI A;  1P3O A;  1P3G C;  5CPK D;  2NZD B;  3AZI C;  5B31 D;  3AV1 B;  5AV6 D;  5B24 D;  3WA9 D;  5GT3 B;  3REH C;  3REL C;  4H9N B;  3MGQ A;  3AZG B;  2UWX A;  1P3M A;  5BT1 C;  3UTA C;  1ULY A;  1KX4 D;  2F8N B;  2NQB A;  3AV1 C;  1P3P D;  5B33 A;  5DNM A;  5GT3 C;  5B32 D;  3MVD A;  2ZM5 A;  3W99 A;  3AZG C;  4WU9 D;  2Y2O A;  5BS7 A;  3REI B;  2RVQ D;  3O62 D;  1P3O B;  4WJ3 C;  4WU8 D;  5B1L A;  5GSU A;  4CAY A;  5GT0 A;  1TZY D;  2CV5 C;  3MGQ B;  2NQB B;  1P3M B;  3H0L C;  3KSY A;  3AZN D;  1M18 A;  5B33 B;  3VH5 A;  1P3A A;  5DNM B;  3MVD B;  3W99 B;  3MGQ C;  3X1S C;  2NQB C;  5B31 G;  1BH8 A;  1P3G D;  3W97 A;  5JRG A;  3MVD C;  3W99 C;  3AYW D;  5GSU B;  4CAY B;  1KX5 A;  5GT0 B;  1AOI C;  3REH D;  3REL D;  4WV4 B;  5CPI A;  5BT1 D;  3REK A;  3UTA D;  5B1L C;  5AV5 B;  3AV1 D;  5GT0 C;  4X23 C;  1M18 B;  1P3A B;  3AFA C;  4G92 B;  4XZQ B;  3AN2 C;  3KXB A;  4H9P A;  1KX3 D;  1BH8 B;  1P3A C;  4ZBJ C;  4KGC C;  4G92 C;  5JRG B;  3B6F C;  3B0C W;  3MGP A;  3AZK C;  1F1E A;  3AZL C;  1KX5 B;  2CV5 D;  5CPI B;  4E45 A;  3W97 C;  4J8W A;  5JRG C;  3REK B;  3WTP C;  1KX5 C;  3B6G A;  3X1S D;  3MGQ D;  3REK C;  2BG1 A;  3KXB B;  4YS3 A;  5AV6 A;  2XD5 A;  1M1A A;  5B24 A;  3LJA D;  1AOI D;  2RIQ A;  2FJ7 C;  1KX4 A;  2BYM A;  4EO5 B;  1P3K C;  5B1L D;  1P3P A;  4Z66 C;  4J8W B;  5B32 A;  4X23 D;  3MGP C;  4LD9 A;  4WU9 A;  3AFA D;  4EO5 C;  3AN2 D;  3B6G B;  3O62 A;  4WU8 A;  2F2A C;  1P3A D;  4KGC D;  4YS3 B;  1N1J A;  3B6G C;  3B6F D;  2F8N K;  5AV6 B;  1M1A B;  3AL0 C;  5B24 B;  3AZK D;  1TZY A;  3AZL D;  4DRB A;  4YS3 C;  3W97 D;  4NE3 A;  3AZN A;  2BYM B;  1KX4 B;  3WTP D;  1P3P B;  5AV6 C;  1M1A C;  5B24 C;  4YM6 A;  5B32 B;  3WAA C;  4LD9 B;  2Y2H A;  4WU9 B;  3REK D;  3O62 B;  3NQJ A;  4NFT A;  3MGR D;  1P3G A;  4KUD D;  4WU8 B;  3AYW A;  4LD9 C;  4WU9 C;  3VH6 T;  2RVQ C;  1ID3 A;  3REH A;  3REL A;  2FJ7 D;  1TZY B;  4WU8 C;  2ZY2 A;  1P3K D;  4Z66 D;  3AZN B;  3AV2 C;  1B67 A;  2Y2I A;  3MGP D;  4YM6 B;  3NQU A;  2G5I C;  3VH6 W;  5GXQ D;  3KWQ A;  4G91 B;  3AZN C;  5BNV A;  1M19 A;  1KX3 A;  3NQJ B;  1P3G B;  5E5A D;  4YM6 C;  3B6G D;  5B0Z C;  1P3B A;  3AYW B;  4G91 C;  4JJN C;  2CV5 A;  4NE6 A;  3REH B;  3REL B;  1P3I C;  4YS3 D;  3UTA B;  1P34 A;  3AYW C;  1BFM A;  1M1A D;  5B2I A;  1ID3 C;  3WAA D;  3X1S A;  3MNN C;  3B0D B;  3NQU B;  3KWQ B;  4DQY B;  5BNV B;  1M19 B;  1KX3 B;  3KFU G;  4LD9 D;  2Y2P A;  3B0D C;  4Z5T A;  3LJA A;  1P3B B;  1AOI A;  3KWQ C;  1M19 C;  5AY8 C;  1KX3 C;  2CV5 B;  2Y2L A;  3LZ0 C;  3AV2 D;  1P34 B;  1P3B C;  3AZJ C;  4X23 A;  3AFA A;  3AN2 A;  3X1S B;  1P34 C;  5B2I C;  4KGC A;  4YM6 D;  1B6W A;  3B6F A;  1H3O A;  5B0Z D;  2ZY4 A;  3WKJ C;  4Z5T B;  3AZK A;  4JJN D;  3LJA B;  3AZL A;  1AOI B;  1T3U A;  4UPK A;  3FDD A;  1P3I D;  1P3L A;  5B0Y A;  3WTP A;  5AVC C;  5B1L B;  4R8P A;  4Z5T C;  3LJA C;  4H9Q A;  4X23 B;  1ID3 D;  2DQN C;  5B32 G;  3MNN D;  2IO5 B;  3AFA B;  3AN2 B;  3B0C T;  3MGR A;  5BO0 A;  4KHA A;  4KUD A;  4ZBJ B;  4KGC B;  2IO5 C;  2ZY3 A;  2PYO D;  3B6F B;  1H3O B;  2FJ7 A;  3KWQ D;  3AZK B;  2ARO C;  1M19 D;  1F66 D;  5AY8 D;  3AZL B;  4J8U D;  1P3K A;  3LZ0 D;  1P3L B;  3W97 B;  4Z66 A;  3WTP B;  1P3B D;  3AZJ D;  4R8P B;  3TU4 C;  4ZUX A;  3UT9 A;  4H9Q B;  1P3L C;  5B0Y C;  5GXQ A;  1P34 D;  2HUE C;  3A6N A;  4R8P C;  5B2I D;  3MGR B;  5E5A A;  4KHA B;  5DNN C;  3C1B A;  1U35 A;  4KUD B;  3X1V A;  5G49 A;  3WKJ D;  1P3F C;  3EG5 B;  1PZR A;  3KUY C;  5AV9 A;  2FJ7 B;  3MGR C;  2Y2K A;  4H9P B;  4KUD C;  5B40 C;  5AVC D;  1P3K B;  4Z66 B;  4Z5T D;  3WAA A;  4ZUX B;  3MGP B;  3REJ D;  5GXQ B;  3A6N B;  1ZLA D;  4ZUX C;  5CP6 A;  5E5A B;  3C1B B;  1U35 B;  3UT9 C;  4AWL C;  2Y2J A;  3X1V B;  5G49 B;  5GXQ C;  2ARO D;  2JE5 A;  3A6N C;  5AV9 B;  5E5A C;  3C1B C;  4H9R A;  1U35 C;  3AV2 A;  3X1V C;  3TU4 D;  4J8V D;  5AV9 C;  3AZE A;  3WAA B;  2JSS A;  1S32 A;  2G5H C;  1P3L D;  5B0Y D;  4R8P D;  4WZS B;  5DNN D;  1EQZ A;  5B0Z A;  3X1U D;  5CP6 B;  3MGS A;  1P3F D;  4JJN A;  3KUY D;  1P3I A;  5B40 D;  3H0M C;  5CP6 C;  3LZ1 C;  4H9R B;  1N1J B;  3AV2 B;  2YFV A;  3X1T A;  3MNN A;  3A1K A;  1BH9 A;  4Z2M H;  3AZM A;  3EPJ A;  1S32 B;  5CPJ A;  1TAF A;  4ZUX D;  3UT9 D;  3AZE C;  2PYO A;  4J8X A;  5B0Z B;  3W98 D;  1S32 C;  2J8P A;  3A1I A;  4QLC C;  1WWI A;  1F66 A;  4JJN B;  5AY8 A;  3A6N D;  4J8U A;  3LZ0 A;  3C1B D;  1U35 D;  1P3I B;  1EQZ C;  3EPK A;  3X1V D;  2W8S A;  3AZJ A;  3MGS C;  4UUZ A;  4H9O A;  2YFV B;  5AV9 D;  1ID3 B;  3MNN B;  3B0B A;  1BH9 B;  2HIO A;  3AZM B;  3VH5 W;  5CPJ B;  3X1T C;  4CSR A;  5B2J D;  3WKJ A;  2L5A A;  2PYO B;  4J8X B;  3AZM C;  4HGA C;  3W96 C;  2F8N A;  1F66 B;  5CPJ C;  5AY8 B;  1JFI A;  4J8U B;  5AVC A;  1R4V A;  3LZ1 D;  5CP6 D;  3LZ0 B;  2PYO C;  4J8X C;  3AZJ B;  4UUZ B;  1F66 C;  4H9O B;  3REJ A;  4J8U C;  3AZF C;  2HIO B;  1ZLA A;  5CHL B;  5B2I B;  3C1C A;  3AZE D;  4CSR B;  1S32 D;  3WKJ B;  2HIO C;  4QLC D;  2ARO A;  2NZD C;  3UTB A;  1JFI B;  1EQZ D;  2VQR A;  5AVC B;  3MGS D;  3TU4 A;  4J8V A;  3LEL A;  3REJ B;  2Y2Q A;  5F99 D;  3VH6 A;  5DNN A;  5AVB A;  1ZLA B;  3X1T D;  1Q9C A;  3X1U A;  2BYK A;  3C1C B;  3REI C;  3REJ C;  1P3F A;  3KUY A;  1HTA A;  3AZM D;  1P3O C;  3W96 D;  2ARO B;  4H9S A;  5AV5 A;  5CPJ D;  1ZLA C;  5B40 A;  3R45 A;  3UTB B;  3C1C C;  3WTP E;  3AZH D;  4J8X D;  4XUJ A;  5B1M A;  3TU4 B;  4NE5 A;  4XZQ A;  4J8V B;  2Y2G A;  3UTB C;  3LEL B;  3AZF D;  1P3M C;  5B0Y B;  5B33 C;  2HUE B;  5DNM C;  3AZI D;  5DNN B;  4J8V C;  5AVB B;  3LEL C;  3W98 A;  5C3I B;  3X1U B;  2BYK B;  5BS7 C;  1P3F B;  2HIO D;  3KUY B;  2NZD D;  4WNN A;  5AV8 A;  5BO0 B;  5AVB C;  5B40 B;  3R45 B;  5C3I C;  3X1U C;  5GSU C;  2FFF B;  1W2E A;  5GT3 D;  4XUJ B;  3AZG D;  5B1M B;  2F8N D;  4H9S C;  5AV5 C;  3H0R C;  1HQ3 A;  1Z2C B;  2Y2N A;  1M18 C;  4XUJ C;  5B1M C;  3EPL A;  4XZQ C;  5B2J A;  3REI D;  3UT9 B;  4AWL B;  3W98 B;  1P3O D;  3V9R A;  4WNN B;  5AV8 B;  3LZ1 A;  3C1C D;  3W98 C;  5CPI C;  1WWS A;  2NQB D;  5AV8 C;  2JCH A;  3UTB D;  1P3M D;  4M6B A;  1HQ3 B;  5BNX A;  5B33 D;  5CPK A;  5DNM D;  5FUG A;  3MVD D;  3W99 D;  5B31 A;  3LEL D;  3IP4 C;  2CWE A;  3WA9 A;  5B2J B;  2F8N H;  4QLC A;  3KXB C;  1HQ3 C;  3V9R B;  2F8N G;  5AVB D;  2Y2M A;  3LZ1 B;  5B2J C;  5GSU D;  3F6T A;  5GT0 D;  2ZY5 A;  5AV5 D;  5F99 A;  3P5J B;  4J8W C;  1M18 D;  2DF4 C;  4XUJ D;  5BNX B;  1A7W A;  5CPK B;  5B1M D;  5FUG B;  4XZQ D;  4E44 A;  5B31 B;  3AZE B;  3WA9 B;  3W96 A;  4QLC B;  4Z2M G;  5CPK C;  5JRG D;  5B31 C;  2YFW A;  3AZH A;  1EQZ B;  3WA9 C;  5KDM A;  3MGS B;  1KX5 D;  3VH5 T;  5CPI D;  2XD1 A;  5AV8 D;  3AZF A;  1KX4 C;  5JA4 A;  1P3P C;  5F99 B;  5B32 C;  2LY8 A;  3AZI A;  3X1T B;  3EPH A;  3O62 C;  3KXB D;  1HQ3 D;  5F99 C;  4HGA B;  2NZD A;  3W96 B;  3UTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...