5JA4B

Crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
KGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Histone H3.3
publication title H4K20me0 marks post-replicative chromatin and recruits the TONSL-MMS22L DNA repair complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2016-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ja4B00
2BYMA 4WU8C 4J8WA 3UTBD 5AVCD 2FJ7A 5CPKB 2NQBC 3AZKB 5AY8C 4YS3D 4X23B 3B0CT 1S32D 3VH5A 3UT9A 1P3GD 1P3LA 4NE5A 4UUZB 3WKJD 2YFWB 4UUZA 3AZNB 2YFWA 2CWEA 3AZNA 5B1LC 3AN2D 1M18B 2NQBB 5CPJB 4E45A 3WA9C 1M18A 5CPJA 1N1JB 5DNMA 3O62D 3TU4D 5F99D 3MVDD 1EQZC 1P3KA 3A6NC 5CPIA 1P3PD 3AZLA 3AZHB 3AZHA 3LJAA 5GT0B 3WTPC 5B40C 5GT0A 1TAFA 5B0ZC 3AYWC 4WU9B 1P3MD 3KUYA 3WA9B 3W96D 4WU9A 1M1AC 1KX3D 2HIOD 3C1CB 1EQZB 3B6GB 3C1CA 3A6NB 4H9PB 3W98D 3B6GA 3W97D 2JSSA 5GT3A 3AZGD 4H9NA 1WWIA 1P34A 3VH6A 4NE6A 5B2ID 3WTPB 3W99A 5GXQD 5B0ZB 4J8UD 3AYWB 4NE3A 2CV5B 5B0YD 2CV5A 5B31G 1P3AC 4J8VA 3MGPD 3REHD 5CP6C 5GSUA 4XUJC 3UTAC 5BS7A 5AV9C 3AZED 1WWSA 4Z5TA 1TZYD 3MNND 5AV8D 4CSRA 5JRGD 3X1SD 1P3BD 3LZ1D 2BYKB 4ZUXD 5B2JB 1KX4D 1F66C 5BNXB 1P3AB 3B6FC 5B2JA 5CP6B 1ZLAC 4XUJB 2F8NA 5AV9B 4R8PB 5B31C 3UTBA 4Z66C 4YM6A 4R8PA 3LZ0A 1AOID 5B24D 4WNNB 4YS3A 3AZMC 5AV5C 1F66B 3MGRB 3AZJA 1P3GA 1ZLAB 3X1VA 2AROB 5B31B 3WKJA 3AZKD 2AROA 2PYOD 1P3OC 4WU8D 1U35C 5AV5B 1P3IC 3B0CW 3X1TC 3B0DC 1BH8A 2NQBD 3MGQC 3AV2C 5AY8D 1P3FA 4CAYB 1M19C 4JJNA 4G92C 1P3MA 1P3OB 4DRAA 1KX3A 4EO5C 2HIOA 4H9OB 1U35B 1P3IB 3RELD 3W98A 5BNVB 5AV6B 3V9RA 5E5AA 3X1TB 4WV4B 4J8WC 3AZFD 4H9QB 5B1LD 3B0DB 5CHLB 2FJ7C 5B2IA 3WA9D 5GXQA 4J8UA 4G92B 1KX5A 1EQZD 3A6ND 4EO5B 3UT9C 3MGPA 1P3LC 4J8WB 3WTPD 5B40D 3AV1A 5B0ZD 3R45B 3AYWD 3MNNA 2FJ7B 1HQ3A 5AV8A 3R45A 5JRGA 3AZNC 3KSYA 1M1AD 1ULYA 1M18C 5CPJC 3VH5T 4QLCB 3MGSA 3UT9B 4QLCA 1P3KC 4G91C 5CPIC 3AZLC 1P3LB 2NZDB 5FUGA 2NZDA 3AFAB 3AZHC 2L5AA 2RVQD 3AFAA 3LJAC 5GT0C 4ZBJC 3KUYC 3KWQD 4WU9C 4XZQD 5DNMB 4KGCB 5CP6D 3UTAD 4KGCA 1P3KB 3C1CC 3B6GC 4G91B 5CPIB 3AZLB 5GT3C 5DNNB 1P34C 5DNNA 4KUDA 3LJAB 4LD9B 2PYOA 3W99C 1TAFB 4LD9A 4ZBJB 5C3IC 3B6FD 3KUYB 3LELA 3NQUB 5AVBD 2CV5C 2F8NG 3NQUA 4AWLC 4J8VC 3C1BB 5GSUC 3B0BA 4Z66D 5BS7C 3C1BA 5GT3B 4J8XB 3REIA 3VH6T 4H9NB 4J8XA 1P34B 5B32B 1H3OA 4Z5TC 3AZMD 1KU5A 5B32A 3W99B 5AV5D 4Z2MG 5C3IB 5B2JC 4AWLB 4J8VB 3RELA 3X1UB 3KXBD 1JFIA 5GSUB 3X1UA 3NQJA 3REJD 3UTBC 3AZFA 4YM6C 4R8PC 3LZ0C 4Z5TB 5B33A 4CSRB 5JA4B 1U35D 5B1MD 4KHAA 4YS3C 5JA4A 1BFMA 3AZJC 1P3GC 3MGRC 3WAAD 1A7WA 3X1VC 3MGQD 3AV2D 3REKD 2F8NB 3UTBB 3WKJC 1M19D 2AROC 4YM6B 3LZ0B 3AZID 5AVCA 4YS3B 1ID3D 4H9SA 5G49A 1S32B 3AZJB 1S32A 1P3GB 4J8WD 2YFVA 2FJ7D 3X1VB 1R4VA 4H9RA 3WKJB 5CPKD 1P3FC 5BO0A 4X23D 4JJNC 3AN2A 1P3MC 3KWQA 4XZQA 3O62B 3UTAA 2HIOC 5F99B 3TU4B 3O62A 3MVDB 3TU4A 5F99A 3W98C 3MVDA 1P3PB 5E5AC 5AV6C 1P3PA 3AZND 1BH8B 5B2IC 1P3FB 1M18D 5CPJD 5GXQC 4JJNB 4J8UC 1P3MB 1KX5C 5AVBA 3W96A 1KX3B 2HIOB 5CPID 3AZLD 3MGPC 3W98B 3AZHD 3W97B 3V9RB 5E5AB 3W97A 1Q9CA 5GT0D 3AZGA 3AV1C 5B2IB 3MNNC 3KUYD 1HQ3C 5AV8C 5JRGC 4WU9D 5GXQB 4J8UB 1KX5B 3C1CD 3B6GD 5BT1C 3MGSC 5B0YA 5GT3D 4QLCC 3KXBA 3MGPB 3REHA 3REJA 2NZDC 2IO5C 3AFAC 3AV1B 3AZEA 1TZYB 3MNNB 1HQ3B 5AV8B 5JRGB 1TZYA 2CV5D 5B1MA 3X1SA 3LZ1B 5KDMB 4ZUXB 4J8VD 1P3BA 3LZ1A 1KX4B 5KDMA 4ZUXA 3MGSB 5DNMC 1KX4A 4KGCC 3WAAA 5B32G 5FUGB 3REKA 4Z5TD 3AZIA 5DNNC 4KUDC 2LY8A 1BH9A 2IO5B 2PYOC 4LD9C 1AOIA 5B24A 1ID3A 5B2JD 3LELC 1P3AD 2F8ND 4XUJD 5AV9D 4YM6D 4R8PD 3LZ0D 3C1BC 3REIC 4J8XC 5CPKA 4KUDB 3AZKA 2PYOB 4X23A 5B32C 3WTPE 3AZJD 4WU8B 3LELB 1F66D 3MGRD 4WU8A 3RELC 3X1VD 1ZLAD 3X1UC 2AROD 5B31D 3REIB 3AZFC 5AY8B 2NQBA 1H3OB 5B33C 5AY8A 1N1JA 2BYMB 3RELB 1JFIB 4WZSB 3NQJB 1P3FD 3AZFB 5B1LB 4JJND 1HTAA 5B1LA 5AVCC 5B33B 3WA9A 1P3OD 4KHAB 4H9SC 4M6BA 1P3ID 4E44A 1EQZA 5E5AD 3A6NA 4H9PA 1S32C 5AV6D 3X1TD 2F8NK 5B40B 2RVQC 3WTPA 5B40A 5AVCB 1KX5D 5B0ZA 3AYWA 1B6WA 1M1AB 2F8NH 3AN2C 1M1AA 3KWQC 5G49B 4XZQC 3O62C 3TU4C 5F99C 3MVDC 2YFVB 3AV1D 1P3PC 4H9RB 1HQ3D 4Z2MH 5BO0B 2BYKA 2HUEC 3AN2B 5BT1D 3MGSD 5BNXA 5AVBC 3W96C 4XZQB 4QLCD 3KWQB 1P3AA 3UTAB 3UT9D 1KX3C 5CP6A 4XUJA 1P3LD 2NZDD 5AV9A 3AFAD 3VH5W 3W97C 3AZGC 1B67A 4WNNA 2HUEB 3B6FB 4KGCD 5DNMD 1F66A 3MGRA 5AVBB 3B6FA 3W96B 1P3KD 4HGAC 5B0YC 1ZLAA 3KXBC 4Z66B 5B31A 3REHC 5DNND 3REJC 4KUDD 4Z66A 3LJAD 3AZGB 4LD9D 3AZEC 3AZMB 3LELD 1TZYC 3AZMA 5B1MC 3X1SC 5AV5A 1P3BC 3LZ1C 4ZUXC 3C1BD 1KX4C 4HGAB 5B0YB 3REID 3WAAC 3KXBB 4J8XD 3REHB 3REJB 4NFTA 3REKC 1P34D 5B32D 3AZIC 4CAYA 3AZEB 3W99D 1P3OA 5B1MB 5B24C 3VH6W 3X1SB 1ID3C 1AOIC 1U35A 4H9OA 1P3BB 1P3IA 3X1UD 5BNVA 5AV6A 5GSUD 3X1TA 3WAAB 4H9QA 3MGQB 4DRBA 3AV2B 3REKB 1F1EA 5B33D 3MGQA 3AV2A 1M19B 3AZIB 5CPKC 1BH9B 3AZKC 1M19A 4X23C 1AOIB 5B24B 1ID3B
chains in the Genus database with same CATH superfamily
2BYMA 4WU8C 4J8WA 3UTBD 2G5HC 5AVCD 2FJ7A 5CPKB 2NQBC 3AZKB 5AY8C 2JCHA 4YS3D 4X23B 3B0CT 1S32D 3VH5A 3UT9A 1P3GD 1P3LA 4NE5A 4UUZB 3WKJD 2YFWB 4UUZA 3AZNB 2YFWA 3EG5B 2CWEA 3AZNA 5B1LC 3AN2D 1M18B 2NQBB 5CPJB 4E45A 3WA9C 1M18A 5CPJA 1N1JB 5DNMA 3O62D 3TU4D 5F99D 3MVDD 1EQZC 3AL0C 1P3KA 3A6NC 5CPIA 1P3PD 3AZLA 3AZHB 2ZY4A 3AZHA 2Y2KA 3LJAA 5GT0B 3WTPC 5B40C 5GT0A 1TAFA 5B0ZC 3AYWC 4WU9B 1P3MD 3KUYA 3WA9B 3W96D 4WU9A 1M1AC 1KX3D 2HIOD 3C1CB 1EQZB 3B6GB 3C1CA 3A6NB 4H9PB 2RIQA 3B6GA 3W97D 3W98D 2JSSA 5GT3A 3AZGD 4H9NA 1WWIA 1T3UA 1P34A 3VH6A 4NE6A 5B2ID 3WTPB 3W99A 5GXQD 5B0ZB 4J8UD 3AYWB 4NE3A 2CV5B 5B0YD 2CV5A 5B31G 1P3AC 4J8VA 3MGPD 3REHD 5CP6C 5GSUA 4XUJC 3UTAC 5BS7A 5AV9C 3AZED 1WWSA 4Z5TA 1TZYD 3MNND 5AV8D 4CSRA 5JRGD 3X1SD 2Y2IA 1P3BD 3LZ1D 2BYKB 4ZUXD 2ZY2A 5B2JB 1KX4D 1F66C 5BNXB 1P3AB 3B6FC 5B2JA 5CP6B 1ZLAC 4XUJB 2F8NA 5AV9B 5B31C 4R8PB 3UTBA 4Z66C 4YM6A 4R8PA 3LZ0A 4WJ3C 1AOID 5B24D 4WNNB 2XD1A 3IP4C 4YS3A 3AZMC 5AV5C 1F66B 3MGRB 3AZJA 4DQYB 1P3GA 1ZLAB 3X1VA 2AROB 5B31B 3WKJA 3AZKD 2AROA 2PYOD 1P3OC 4WU8D 1U35C 5AV5B 1P3IC 3F6TA 3B0CW 3X1TC 2DQNC 2Y2LA 3B0DC 1BH8A 2NQBD 3MGQC 3AV2C 5AY8D 1P3FA 4CAYB 1M19C 4JJNA 4G92C 1P3MA 1P3OB 4DRAA 1KX3A 4EO5C 2HIOA 4H9OB 1U35B 1P3IB 2JE5A 3RELD 3W98A 5BNVB 5AV6B 3V9RA 5E5AA 3X1TB 4WV4B 4J8WC 3AZFD 4H9QB 5B1LD 3B0DB 5CHLB 2FJ7C 5B2IA 3WA9D 5GXQA 4J8UA 4G92B 1KX5A 1EQZD 3A6ND 4EO5B 3UT9C 3MGPA 1P3LC 4J8WB 3WTPD 5B40D 3AV1A 5B0ZD 3R45B 3AYWD 3MNNA 2FJ7B 1HQ3A 5AV8A 3R45A 5JRGA 3AZNC 3KSYA 1M1AD 3A1KA 1ULYA 1M18C 5CPJC 2G5IC 3VH5T 4QLCB 3MGSA 3EPLA 3UT9B 4QLCA 1P3KC 4G91C 5CPIC 3AZLC 1P3LB 2NZDB 5FUGA 2NZDA 3AFAB 3AZHC 2L5AA 2RVQD 3AFAA 3LJAC 5GT0C 4ZBJC 3KUYC 3KWQD 4WU9C 4XZQD 5DNMB 4KGCB 5CP6D 3UTAD 4KGCA 1P3KB 3C1CC 3B6GC 4G91B 5CPIB 3AZLB 5GT3C 5DNNB 1P34C 5DNNA 4KUDA 3LJAB 3FDDA 4LD9B 2PYOA 3W99C 1TAFB 4LD9A 4ZBJB 5C3IC 3H0MC 3KUYB 3LELA 3B6FD 3NQUB 5AVBD 2CV5C 2F8NG 3NQUA 2J8PA 4AWLC 4J8VC 3C1BB 5GSUC 3B0BA 4Z66D 2ZY5A 5BS7C 3C1BA 5GT3B 4J8XB 3REIA 3VH6T 4H9NB 4J8XA 1P34B 5B32B 1H3OA 4Z5TC 3AZMD 1KU5A 5B32A 3W99B 5AV5D 4Z2MG 5C3IB 2ZM5A 5B2JC 4AWLB 4J8VB 3RELA 3X1UB 2DF4C 3KXBD 1JFIA 2Y2MA 5GSUB 3X1UA 3NQJA 3REJD 3UTBC 3AZFA 4YM6C 4R8PC 3LZ0C 4Z5TB 5B33A 4CSRB 5JA4B 1U35D 5B1MD 4KHAA 4YS3C 5JA4A 1BFMA 3AZJC 1P3GC 3MGRC 3WAAD 1A7WA 3X1VC 3MGQD 3AV2D 3REKD 2F8NB 3UTBB 3WKJC 1M19D 2AROC 4YM6B 3LZ0B 3AZID 5AVCA 4YS3B 1ID3D 4H9SA 2UWXA 5G49A 1S32B 3AZJB 1S32A 2Y2GA 1P3GB 4J8WD 2YFVA 2FJ7D 3X1VB 1R4VA 4H9RA 3WKJB 5CPKD 1P3FC 5BO0A 4X23D 4JJNC 3AN2A 1P3MC 3KWQA 4XZQA 3O62B 3UTAA 2HIOC 5F99B 3TU4B 3O62A 3MVDB 3TU4A 5F99A 3W98C 3MVDA 1P3PB 5E5AC 5AV6C 1P3PA 3AZND 1BH8B 5B2IC 1P3FB 1M18D 5CPJD 5GXQC 4JJNB 4J8UC 1P3MB 1KX5C 5AVBA 3W96A 1KX3B 2HIOB 5CPID 3AZLD 3MGPC 3W98B 3AZHD 3W97B 3V9RB 5E5AB 3W97A 1Q9CA 2VQRA 5GT0D 3AZGA 3AV1C 2BG1A 5B2IB 3MNNC 3KUYD 1HQ3C 5AV8C 5JRGC 4WU9D 5GXQB 4J8UB 2Y2QA 1KX5B 3C1CD 3B6GD 5BT1C 3MGSC 5B0YA 5GT3D 4QLCC 3KXBA 3MGPB 1PZRA 3REHA 3REJA 2NZDC 2IO5C 3AFAC 3AV1B 3AZEA 1TZYB 3MNNB 1HQ3B 5AV8B 5JRGB 1TZYA 2CV5D 5B1MA 3X1SA 3LZ1B 5KDMB 4ZUXB 4J8VD 2Y2PA 1P3BA 3LZ1A 1KX4B 2FFFB 5KDMA 4ZUXA 1W2EA 3MGSB 5DNMC 1KX4A 4KGCC 3WAAA 5B32G 5FUGB 3REKA 4Z5TD 3AZIA 5DNNC 4KUDC 2LY8A 1BH9A 2IO5B 3A1IA 2PYOC 4LD9C 1AOIA 5B24A 1ID3A 5B2JD 3LELC 1P3AD 2F8ND 4XUJD 5AV9D 4YM6D 4R8PD 3LZ0D 3C1BC 3REIC 3KFUG 4J8XC 2Y2OA 5CPKA 4KUDB 3AZKA 2PYOB 4X23A 5B32C 3EPJA 3WTPE 3AZJD 4WU8B 3LELB 1F66D 3MGRD 4WU8A 3RELC 3X1VD 1ZLAD 3X1UC 2AROD 5B31D 3REIB 3AZFC 5AY8B 2NQBA 1H3OB 2XD5A 5B33C 5AY8A 1N1JA 3RELB 1JFIB 4WZSB 3NQJB 1P3FD 3AZFB 5B1LB 4JJND 3P5JB 1HTAA 5B1LA 5AVCC 5B33B 3WA9A 1P3OD 4KHAB 4H9SC 3H0LC 2Y2JA 4M6BA 1P3ID 4E44A 1EQZA 5E5AD 3A6NA 4H9PA 1S32C 5AV6D 3X1TD 2F8NK 5B40B 2RVQC 3WTPA 5B40A 5AVCB 1KX5D 5B0ZA 2Y2NA 1B6WA 3AYWA 1M1AB 2F8NH 3AN2C 1M1AA 3KWQC 5G49B 4XZQC 3O62C 3TU4C 5F99C 3MVDC 2YFVB 3AV1D 1P3PC 4H9RB 1HQ3D 4Z2MH 5BO0B 3EPHA 2BYKA 2HUEC 3AN2B 5BT1D 3MGSD 5BNXA 5AVBC 3W96C 4XZQB 4QLCD 3KWQB 1P3AA 4UPKA 3UT9D 3UTAB 1KX3C 5CP6A 4XUJA 1P3LD 3EPKA 5AV9A 2NZDD 3AFAD 3VH5W 3W97C 3AZGC 1B67A 4WNNA 2HUEB 3B6FB 4KGCD 5DNMD 2Y2HA 1F66A 3MGRA 5AVBB 3B6FA 3W96B 1P3KD 4HGAC 5B0YC 1ZLAA 3KXBC 1Z2CB 4Z66B 5B31A 3REHC 5DNND 3REJC 4KUDD 4Z66A 2W8SA 3LJAD 3AZGB 4LD9D 3AZEC 3AZMB 3LELD 1TZYC 3AZMA 5B1MC 3X1SC 5AV5A 1P3BC 3LZ1C 4ZUXC 3C1BD 1KX4C 4HGAB 5B0YB 3REID 3WAAC 3KXBB 4J8XD 3REHB 3REJB 4NFTA 3REKC 1P34D 5B32D 5B24B 3AZIC 4CAYA 3AZEB 3W99D 1P3OA 5B1MB 5B24C 2ZY3A 3VH6W 3X1SB 1ID3C 1U35A 4H9OA 1AOIC 1P3BB 1P3IA 3H0RC 3X1UD 5BNVA 5AV6A 5GSUD 3X1TA 3WAAB 4H9QA 3MGQB 4DRBA 3AV2B 3REKB 2F2AC 1F1EA 5B33D 3MGQA 3AV2A 1M19B 3AZIB 5CPKC 1BH9B 3AZKC 1M19A 4X23C 1AOIB 2BYMB 1ID3B
chains in the Genus database with same CATH topology
2BYMA 4WU8C 4J8WA 3UTBD 2G5HC 5AVCD 2FJ7A 5CPKB 2NQBC 3AZKB 5AY8C 2JCHA 4YS3D 4X23B 3B0CT 1S32D 3VH5A 3UT9A 1P3GD 1P3LA 4NE5A 4UUZB 3WKJD 2YFWB 4UUZA 3AZNB 2YFWA 3EG5B 2CWEA 3AZNA 5B1LC 3AN2D 1M18B 2NQBB 5CPJB 4E45A 3WA9C 1M18A 5CPJA 1N1JB 5DNMA 3O62D 3TU4D 5F99D 3MVDD 1EQZC 3AL0C 1P3KA 3A6NC 5CPIA 1P3PD 3AZLA 3AZHB 2ZY4A 3AZHA 2Y2KA 3LJAA 5GT0B 3WTPC 5B40C 5GT0A 1TAFA 5B0ZC 3AYWC 4WU9B 1P3MD 3KUYA 3WA9B 3W96D 4WU9A 1M1AC 1KX3D 2HIOD 3C1CB 1EQZB 3B6GB 3C1CA 3A6NB 4H9PB 2RIQA 3B6GA 3W97D 3W98D 2JSSA 5GT3A 3AZGD 4H9NA 1WWIA 1T3UA 1P34A 3VH6A 4NE6A 5B2ID 3WTPB 3W99A 5GXQD 5B0ZB 4J8UD 3AYWB 4NE3A 2CV5B 5B0YD 2CV5A 5B31G 1P3AC 4J8VA 3MGPD 3REHD 5CP6C 5GSUA 4XUJC 3UTAC 5BS7A 5AV9C 3AZED 1WWSA 4Z5TA 1TZYD 3MNND 5AV8D 4CSRA 5JRGD 3X1SD 2Y2IA 1P3BD 3LZ1D 2BYKB 4ZUXD 2ZY2A 5B2JB 1KX4D 1F66C 5BNXB 1P3AB 3B6FC 5B2JA 5CP6B 1ZLAC 4XUJB 2F8NA 5AV9B 5B31C 4R8PB 3UTBA 4Z66C 4YM6A 4R8PA 3LZ0A 4WJ3C 1AOID 5B24D 4WNNB 2XD1A 3IP4C 4YS3A 3AZMC 5AV5C 1F66B 3MGRB 3AZJA 4DQYB 1P3GA 1ZLAB 3X1VA 2AROB 5B31B 3WKJA 3AZKD 2AROA 2PYOD 1P3OC 4WU8D 1U35C 5AV5B 1P3IC 3F6TA 3B0CW 3X1TC 2DQNC 2Y2LA 3B0DC 1BH8A 2NQBD 3MGQC 3AV2C 5AY8D 1P3FA 4CAYB 1M19C 4JJNA 4G92C 1P3MA 1P3OB 4DRAA 1KX3A 4EO5C 2HIOA 4H9OB 1U35B 1P3IB 2JE5A 3RELD 3W98A 5BNVB 5AV6B 3V9RA 5E5AA 3X1TB 4WV4B 4J8WC 3AZFD 4H9QB 5B1LD 3B0DB 5CHLB 2FJ7C 5B2IA 3WA9D 5GXQA 4J8UA 4G92B 1KX5A 1EQZD 3A6ND 4EO5B 3UT9C 3MGPA 1P3LC 4J8WB 3WTPD 5B40D 3AV1A 5B0ZD 3R45B 3AYWD 3MNNA 2FJ7B 1HQ3A 5AV8A 3R45A 5JRGA 3AZNC 3KSYA 1M1AD 3A1KA 1ULYA 1M18C 5CPJC 2G5IC 3VH5T 4QLCB 3MGSA 3EPLA 3UT9B 4QLCA 1P3KC 4G91C 5CPIC 3AZLC 1P3LB 2NZDB 5FUGA 2NZDA 3AFAB 3AZHC 2L5AA 2RVQD 3AFAA 3LJAC 5GT0C 4ZBJC 3KUYC 3KWQD 4WU9C 4XZQD 5DNMB 4KGCB 5CP6D 3UTAD 4KGCA 1P3KB 3C1CC 3B6GC 4G91B 5CPIB 3AZLB 5GT3C 5DNNB 1P34C 5DNNA 4KUDA 3LJAB 3FDDA 4LD9B 2PYOA 3W99C 1TAFB 4LD9A 4ZBJB 5C3IC 3H0MC 3KUYB 3LELA 3B6FD 3NQUB 5AVBD 2CV5C 2F8NG 3NQUA 2J8PA 4AWLC 4J8VC 3C1BB 5GSUC 3B0BA 4Z66D 2ZY5A 5BS7C 3C1BA 5GT3B 4J8XB 3REIA 3VH6T 4H9NB 4J8XA 1P34B 5B32B 1H3OA 4Z5TC 3AZMD 1KU5A 5B32A 3W99B 5AV5D 4Z2MG 5C3IB 2ZM5A 5B2JC 4AWLB 4J8VB 3RELA 3X1UB 2DF4C 3KXBD 1JFIA 2Y2MA 5GSUB 3X1UA 3NQJA 3REJD 3UTBC 3AZFA 4YM6C 4R8PC 3LZ0C 4Z5TB 5B33A 4CSRB 5JA4B 1U35D 5B1MD 4KHAA 4YS3C 5JA4A 1BFMA 3AZJC 1P3GC 3MGRC 3WAAD 1A7WA 3X1VC 3MGQD 3AV2D 3REKD 2F8NB 3UTBB 3WKJC 1M19D 2AROC 4YM6B 3LZ0B 3AZID 5AVCA 4YS3B 1ID3D 4H9SA 2UWXA 5G49A 1S32B 3AZJB 1S32A 2Y2GA 1P3GB 4J8WD 2YFVA 2FJ7D 3X1VB 1R4VA 4H9RA 3WKJB 5CPKD 1P3FC 5BO0A 4X23D 4JJNC 3AN2A 1P3MC 3KWQA 4XZQA 3O62B 3UTAA 2HIOC 5F99B 3TU4B 3O62A 3MVDB 3TU4A 5F99A 3W98C 3MVDA 1P3PB 5E5AC 5AV6C 1P3PA 3AZND 1BH8B 5B2IC 1P3FB 1M18D 5CPJD 5GXQC 4JJNB 4J8UC 1P3MB 1KX5C 5AVBA 3W96A 1KX3B 2HIOB 5CPID 3AZLD 3MGPC 3W98B 3AZHD 3W97B 3V9RB 5E5AB 3W97A 1Q9CA 2VQRA 5GT0D 3AZGA 3AV1C 2BG1A 5B2IB 3MNNC 3KUYD 1HQ3C 5AV8C 5JRGC 4WU9D 5GXQB 4J8UB 2Y2QA 1KX5B 3C1CD 3B6GD 5BT1C 3MGSC 5B0YA 5GT3D 4QLCC 3KXBA 3MGPB 1PZRA 3REHA 3REJA 2NZDC 2IO5C 3AFAC 3AV1B 3AZEA 1TZYB 3MNNB 1HQ3B 5AV8B 5JRGB 1TZYA 2CV5D 5B1MA 3X1SA 3LZ1B 5KDMB 4ZUXB 4J8VD 2Y2PA 1P3BA 3LZ1A 1KX4B 2FFFB 5KDMA 4ZUXA 1W2EA 3MGSB 5DNMC 1KX4A 4KGCC 3WAAA 5B32G 5FUGB 3REKA 4Z5TD 3AZIA 5DNNC 4KUDC 2LY8A 1BH9A 2IO5B 3A1IA 2PYOC 4LD9C 1AOIA 5B24A 1ID3A 5B2JD 3LELC 1P3AD 2F8ND 4XUJD 5AV9D 4YM6D 4R8PD 3LZ0D 3C1BC 3REIC 3KFUG 4J8XC 2Y2OA 5CPKA 4KUDB 3AZKA 2PYOB 4X23A 5B32C 3EPJA 3WTPE 3AZJD 4WU8B 3LELB 1F66D 3MGRD 4WU8A 3RELC 3X1VD 1ZLAD 3X1UC 2AROD 5B31D 3REIB 3AZFC 5AY8B 2NQBA 1H3OB 2XD5A 5B33C 5AY8A 1N1JA 3RELB 1JFIB 4WZSB 3NQJB 1P3FD 3AZFB 5B1LB 4JJND 3P5JB 1HTAA 5B1LA 5AVCC 5B33B 3WA9A 1P3OD 4KHAB 4H9SC 3H0LC 2Y2JA 4M6BA 1P3ID 4E44A 1EQZA 5E5AD 3A6NA 4H9PA 1S32C 5AV6D 3X1TD 2F8NK 5B40B 2RVQC 3WTPA 5B40A 5AVCB 1KX5D 5B0ZA 2Y2NA 1B6WA 3AYWA 1M1AB 2F8NH 3AN2C 1M1AA 3KWQC 5G49B 4XZQC 3O62C 3TU4C 5F99C 3MVDC 2YFVB 3AV1D 1P3PC 4H9RB 1HQ3D 4Z2MH 5BO0B 3EPHA 2BYKA 2HUEC 3AN2B 5BT1D 3MGSD 5BNXA 5AVBC 3W96C 4XZQB 4QLCD 3KWQB 1P3AA 4UPKA 3UT9D 3UTAB 1KX3C 5CP6A 4XUJA 1P3LD 3EPKA 5AV9A 2NZDD 3AFAD 3VH5W 3W97C 3AZGC 1B67A 4WNNA 2HUEB 3B6FB 4KGCD 5DNMD 2Y2HA 1F66A 3MGRA 5AVBB 3B6FA 3W96B 1P3KD 4HGAC 5B0YC 1ZLAA 3KXBC 1Z2CB 4Z66B 5B31A 3REHC 5DNND 3REJC 4KUDD 4Z66A 2W8SA 3LJAD 3AZGB 4LD9D 3AZEC 3AZMB 3LELD 1TZYC 3AZMA 5B1MC 3X1SC 5AV5A 1P3BC 3LZ1C 4ZUXC 3C1BD 1KX4C 4HGAB 5B0YB 3REID 3WAAC 3KXBB 4J8XD 3REHB 3REJB 4NFTA 3REKC 1P34D 5B32D 5B24B 3AZIC 4CAYA 3AZEB 3W99D 1P3OA 5B1MB 5B24C 2ZY3A 3VH6W 3X1SB 1ID3C 1U35A 4H9OA 1AOIC 1P3BB 1P3IA 3H0RC 3X1UD 5BNVA 5AV6A 5GSUD 3X1TA 3WAAB 4H9QA 3MGQB 4DRBA 3AV2B 3REKB 2F2AC 1F1EA 5B33D 3MGQA 3AV2A 1M19B 3AZIB 5CPKC 1BH9B 3AZKC 1M19A 4X23C 1AOIB 2BYMB 1ID3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYM A;  4WU8 C;  4J8W A;  3UTB D;  5AVC D;  2FJ7 A;  5CPK B;  2NQB C;  3AZK B;  5AY8 C;  4YS3 D;  4X23 B;  3B0C T;  1S32 D;  3VH5 A;  3UT9 A;  1P3G D;  1P3L A;  4NE5 A;  4UUZ B;  3WKJ D;  2YFW B;  4UUZ A;  3AZN B;  2YFW A;  2CWE A;  3AZN A;  5B1L C;  3AN2 D;  1M18 B;  2NQB B;  5CPJ B;  4E45 A;  3WA9 C;  1M18 A;  5CPJ A;  1N1J B;  5DNM A;  3O62 D;  3TU4 D;  5F99 D;  3MVD D;  1EQZ C;  1P3K A;  3A6N C;  5CPI A;  1P3P D;  3AZL A;  3AZH B;  3AZH A;  3LJA A;  5GT0 B;  3WTP C;  5B40 C;  5GT0 A;  1TAF A;  5B0Z C;  3AYW C;  4WU9 B;  1P3M D;  3KUY A;  3WA9 B;  3W96 D;  4WU9 A;  1M1A C;  1KX3 D;  2HIO D;  3C1C B;  1EQZ B;  3B6G B;  3C1C A;  3A6N B;  4H9P B;  3W98 D;  3B6G A;  3W97 D;  2JSS A;  5GT3 A;  3AZG D;  4H9N A;  1WWI A;  1P34 A;  3VH6 A;  4NE6 A;  5B2I D;  3WTP B;  3W99 A;  5GXQ D;  5B0Z B;  4J8U D;  3AYW B;  4NE3 A;  2CV5 B;  5B0Y D;  2CV5 A;  5B31 G;  1P3A C;  4J8V A;  3MGP D;  3REH D;  5CP6 C;  5GSU A;  4XUJ C;  3UTA C;  5BS7 A;  5AV9 C;  3AZE D;  1WWS A;  4Z5T A;  1TZY D;  3MNN D;  5AV8 D;  4CSR A;  5JRG D;  3X1S D;  1P3B D;  3LZ1 D;  2BYK B;  4ZUX D;  5B2J B;  1KX4 D;  1F66 C;  5BNX B;  1P3A B;  3B6F C;  5B2J A;  5CP6 B;  1ZLA C;  4XUJ B;  2F8N A;  5AV9 B;  4R8P B;  5B31 C;  3UTB A;  4Z66 C;  4YM6 A;  4R8P A;  3LZ0 A;  1AOI D;  5B24 D;  4WNN B;  4YS3 A;  3AZM C;  5AV5 C;  1F66 B;  3MGR B;  3AZJ A;  1P3G A;  1ZLA B;  3X1V A;  2ARO B;  5B31 B;  3WKJ A;  3AZK D;  2ARO A;  2PYO D;  1P3O C;  4WU8 D;  1U35 C;  5AV5 B;  1P3I C;  3B0C W;  3X1T C;  3B0D C;  1BH8 A;  2NQB D;  3MGQ C;  3AV2 C;  5AY8 D;  1P3F A;  4CAY B;  1M19 C;  4JJN A;  4G92 C;  1P3M A;  1P3O B;  4DRA A;  1KX3 A;  4EO5 C;  2HIO A;  4H9O B;  1U35 B;  1P3I B;  3REL D;  3W98 A;  5BNV B;  5AV6 B;  3V9R A;  5E5A A;  3X1T B;  4WV4 B;  4J8W C;  3AZF D;  4H9Q B;  5B1L D;  3B0D B;  5CHL B;  2FJ7 C;  5B2I A;  3WA9 D;  5GXQ A;  4J8U A;  4G92 B;  1KX5 A;  1EQZ D;  3A6N D;  4EO5 B;  3UT9 C;  3MGP A;  1P3L C;  4J8W B;  3WTP D;  5B40 D;  3AV1 A;  5B0Z D;  3R45 B;  3AYW D;  3MNN A;  2FJ7 B;  1HQ3 A;  5AV8 A;  3R45 A;  5JRG A;  3AZN C;  3KSY A;  1M1A D;  1ULY A;  1M18 C;  5CPJ C;  3VH5 T;  4QLC B;  3MGS A;  3UT9 B;  4QLC A;  1P3K C;  4G91 C;  5CPI C;  3AZL C;  1P3L B;  2NZD B;  5FUG A;  2NZD A;  3AFA B;  3AZH C;  2L5A A;  2RVQ D;  3AFA A;  3LJA C;  5GT0 C;  4ZBJ C;  3KUY C;  3KWQ D;  4WU9 C;  4XZQ D;  5DNM B;  4KGC B;  5CP6 D;  3UTA D;  4KGC A;  1P3K B;  3C1C C;  3B6G C;  4G91 B;  5CPI B;  3AZL B;  5GT3 C;  5DNN B;  1P34 C;  5DNN A;  4KUD A;  3LJA B;  4LD9 B;  2PYO A;  3W99 C;  1TAF B;  4LD9 A;  4ZBJ B;  5C3I C;  3B6F D;  3KUY B;  3LEL A;  3NQU B;  5AVB D;  2CV5 C;  2F8N G;  3NQU A;  4AWL C;  4J8V C;  3C1B B;  5GSU C;  3B0B A;  4Z66 D;  5BS7 C;  3C1B A;  5GT3 B;  4J8X B;  3REI A;  3VH6 T;  4H9N B;  4J8X A;  1P34 B;  5B32 B;  1H3O A;  4Z5T C;  3AZM D;  1KU5 A;  5B32 A;  3W99 B;  5AV5 D;  4Z2M G;  5C3I B;  5B2J C;  4AWL B;  4J8V B;  3REL A;  3X1U B;  3KXB D;  1JFI A;  5GSU B;  3X1U A;  3NQJ A;  3REJ D;  3UTB C;  3AZF A;  4YM6 C;  4R8P C;  3LZ0 C;  4Z5T B;  5B33 A;  4CSR B;  5JA4 B;  1U35 D;  5B1M D;  4KHA A;  4YS3 C;  5JA4 A;  1BFM A;  3AZJ C;  1P3G C;  3MGR C;  3WAA D;  1A7W A;  3X1V C;  3MGQ D;  3AV2 D;  3REK D;  2F8N B;  3UTB B;  3WKJ C;  1M19 D;  2ARO C;  4YM6 B;  3LZ0 B;  3AZI D;  5AVC A;  4YS3 B;  1ID3 D;  4H9S A;  5G49 A;  1S32 B;  3AZJ B;  1S32 A;  1P3G B;  4J8W D;  2YFV A;  2FJ7 D;  3X1V B;  1R4V A;  4H9R A;  3WKJ B;  5CPK D;  1P3F C;  5BO0 A;  4X23 D;  4JJN C;  3AN2 A;  1P3M C;  3KWQ A;  4XZQ A;  3O62 B;  3UTA A;  2HIO C;  5F99 B;  3TU4 B;  3O62 A;  3MVD B;  3TU4 A;  5F99 A;  3W98 C;  3MVD A;  1P3P B;  5E5A C;  5AV6 C;  1P3P A;  3AZN D;  1BH8 B;  5B2I C;  1P3F B;  1M18 D;  5CPJ D;  5GXQ C;  4JJN B;  4J8U C;  1P3M B;  1KX5 C;  5AVB A;  3W96 A;  1KX3 B;  2HIO B;  5CPI D;  3AZL D;  3MGP C;  3W98 B;  3AZH D;  3W97 B;  3V9R B;  5E5A B;  3W97 A;  1Q9C A;  5GT0 D;  3AZG A;  3AV1 C;  5B2I B;  3MNN C;  3KUY D;  1HQ3 C;  5AV8 C;  5JRG C;  4WU9 D;  5GXQ B;  4J8U B;  1KX5 B;  3C1C D;  3B6G D;  5BT1 C;  3MGS C;  5B0Y A;  5GT3 D;  4QLC C;  3KXB A;  3MGP B;  3REH A;  3REJ A;  2NZD C;  2IO5 C;  3AFA C;  3AV1 B;  3AZE A;  1TZY B;  3MNN B;  1HQ3 B;  5AV8 B;  5JRG B;  1TZY A;  2CV5 D;  5B1M A;  3X1S A;  3LZ1 B;  5KDM B;  4ZUX B;  4J8V D;  1P3B A;  3LZ1 A;  1KX4 B;  5KDM A;  4ZUX A;  3MGS B;  5DNM C;  1KX4 A;  4KGC C;  3WAA A;  5B32 G;  5FUG B;  3REK A;  4Z5T D;  3AZI A;  5DNN C;  4KUD C;  2LY8 A;  1BH9 A;  2IO5 B;  2PYO C;  4LD9 C;  1AOI A;  5B24 A;  1ID3 A;  5B2J D;  3LEL C;  1P3A D;  2F8N D;  4XUJ D;  5AV9 D;  4YM6 D;  4R8P D;  3LZ0 D;  3C1B C;  3REI C;  4J8X C;  5CPK A;  4KUD B;  3AZK A;  2PYO B;  4X23 A;  5B32 C;  3WTP E;  3AZJ D;  4WU8 B;  3LEL B;  1F66 D;  3MGR D;  4WU8 A;  3REL C;  3X1V D;  1ZLA D;  3X1U C;  2ARO D;  5B31 D;  3REI B;  3AZF C;  5AY8 B;  2NQB A;  1H3O B;  5B33 C;  5AY8 A;  1N1J A;  2BYM B;  3REL B;  1JFI B;  4WZS B;  3NQJ B;  1P3F D;  3AZF B;  5B1L B;  4JJN D;  1HTA A;  5B1L A;  5AVC C;  5B33 B;  3WA9 A;  1P3O D;  4KHA B;  4H9S C;  4M6B A;  1P3I D;  4E44 A;  1EQZ A;  5E5A D;  3A6N A;  4H9P A;  1S32 C;  5AV6 D;  3X1T D;  2F8N K;  5B40 B;  2RVQ C;  3WTP A;  5B40 A;  5AVC B;  1KX5 D;  5B0Z A;  3AYW A;  1B6W A;  1M1A B;  2F8N H;  3AN2 C;  1M1A A;  3KWQ C;  5G49 B;  4XZQ C;  3O62 C;  3TU4 C;  5F99 C;  3MVD C;  2YFV B;  3AV1 D;  1P3P C;  4H9R B;  1HQ3 D;  4Z2M H;  5BO0 B;  2BYK A;  2HUE C;  3AN2 B;  5BT1 D;  3MGS D;  5BNX A;  5AVB C;  3W96 C;  4XZQ B;  4QLC D;  3KWQ B;  1P3A A;  3UTA B;  3UT9 D;  1KX3 C;  5CP6 A;  4XUJ A;  1P3L D;  2NZD D;  5AV9 A;  3AFA D;  3VH5 W;  3W97 C;  3AZG C;  1B67 A;  4WNN A;  2HUE B;  3B6F B;  4KGC D;  5DNM D;  1F66 A;  3MGR A;  5AVB B;  3B6F A;  3W96 B;  1P3K D;  4HGA C;  5B0Y C;  1ZLA A;  3KXB C;  4Z66 B;  5B31 A;  3REH C;  5DNN D;  3REJ C;  4KUD D;  4Z66 A;  3LJA D;  3AZG B;  4LD9 D;  3AZE C;  3AZM B;  3LEL D;  1TZY C;  3AZM A;  5B1M C;  3X1S C;  5AV5 A;  1P3B C;  3LZ1 C;  4ZUX C;  3C1B D;  1KX4 C;  4HGA B;  5B0Y B;  3REI D;  3WAA C;  3KXB B;  4J8X D;  3REH B;  3REJ B;  4NFT A;  3REK C;  1P34 D;  5B32 D;  3AZI C;  4CAY A;  3AZE B;  3W99 D;  1P3O A;  5B1M B;  5B24 C;  3VH6 W;  3X1S B;  1ID3 C;  1AOI C;  1U35 A;  4H9O A;  1P3B B;  1P3I A;  3X1U D;  5BNV A;  5AV6 A;  5GSU D;  3X1T A;  3WAA B;  4H9Q A;  3MGQ B;  4DRB A;  3AV2 B;  3REK B;  1F1E A;  5B33 D;  3MGQ A;  3AV2 A;  1M19 B;  3AZI B;  5CPK C;  1BH9 B;  3AZK C;  1M19 A;  4X23 C;  1AOI B;  5B24 B;  1ID3 B; 
#chains in the Genus database with same CATH topology
 2BYM A;  4WU8 C;  4J8W A;  3UTB D;  2G5H C;  5AVC D;  2FJ7 A;  5CPK B;  2NQB C;  3AZK B;  5AY8 C;  2JCH A;  4YS3 D;  4X23 B;  3B0C T;  1S32 D;  3VH5 A;  3UT9 A;  1P3G D;  1P3L A;  4NE5 A;  4UUZ B;  3WKJ D;  2YFW B;  4UUZ A;  3AZN B;  2YFW A;  3EG5 B;  2CWE A;  3AZN A;  5B1L C;  3AN2 D;  1M18 B;  2NQB B;  5CPJ B;  4E45 A;  3WA9 C;  1M18 A;  5CPJ A;  1N1J B;  5DNM A;  3O62 D;  3TU4 D;  5F99 D;  3MVD D;  1EQZ C;  3AL0 C;  1P3K A;  3A6N C;  5CPI A;  1P3P D;  3AZL A;  3AZH B;  2ZY4 A;  3AZH A;  2Y2K A;  3LJA A;  5GT0 B;  3WTP C;  5B40 C;  5GT0 A;  1TAF A;  5B0Z C;  3AYW C;  4WU9 B;  1P3M D;  3KUY A;  3WA9 B;  3W96 D;  4WU9 A;  1M1A C;  1KX3 D;  2HIO D;  3C1C B;  1EQZ B;  3B6G B;  3C1C A;  3A6N B;  4H9P B;  2RIQ A;  3B6G A;  3W97 D;  3W98 D;  2JSS A;  5GT3 A;  3AZG D;  4H9N A;  1WWI A;  1T3U A;  1P34 A;  3VH6 A;  4NE6 A;  5B2I D;  3WTP B;  3W99 A;  5GXQ D;  5B0Z B;  4J8U D;  3AYW B;  4NE3 A;  2CV5 B;  5B0Y D;  2CV5 A;  5B31 G;  1P3A C;  4J8V A;  3MGP D;  3REH D;  5CP6 C;  5GSU A;  4XUJ C;  3UTA C;  5BS7 A;  5AV9 C;  3AZE D;  1WWS A;  4Z5T A;  1TZY D;  3MNN D;  5AV8 D;  4CSR A;  5JRG D;  3X1S D;  2Y2I A;  1P3B D;  3LZ1 D;  2BYK B;  4ZUX D;  2ZY2 A;  5B2J B;  1KX4 D;  1F66 C;  5BNX B;  1P3A B;  3B6F C;  5B2J A;  5CP6 B;  1ZLA C;  4XUJ B;  2F8N A;  5AV9 B;  5B31 C;  4R8P B;  3UTB A;  4Z66 C;  4YM6 A;  4R8P A;  3LZ0 A;  4WJ3 C;  1AOI D;  5B24 D;  4WNN B;  2XD1 A;  3IP4 C;  4YS3 A;  3AZM C;  5AV5 C;  1F66 B;  3MGR B;  3AZJ A;  4DQY B;  1P3G A;  1ZLA B;  3X1V A;  2ARO B;  5B31 B;  3WKJ A;  3AZK D;  2ARO A;  2PYO D;  1P3O C;  4WU8 D;  1U35 C;  5AV5 B;  1P3I C;  3F6T A;  3B0C W;  3X1T C;  2DQN C;  2Y2L A;  3B0D C;  1BH8 A;  2NQB D;  3MGQ C;  3AV2 C;  5AY8 D;  1P3F A;  4CAY B;  1M19 C;  4JJN A;  4G92 C;  1P3M A;  1P3O B;  4DRA A;  1KX3 A;  4EO5 C;  2HIO A;  4H9O B;  1U35 B;  1P3I B;  2JE5 A;  3REL D;  3W98 A;  5BNV B;  5AV6 B;  3V9R A;  5E5A A;  3X1T B;  4WV4 B;  4J8W C;  3AZF D;  4H9Q B;  5B1L D;  3B0D B;  5CHL B;  2FJ7 C;  5B2I A;  3WA9 D;  5GXQ A;  4J8U A;  4G92 B;  1KX5 A;  1EQZ D;  3A6N D;  4EO5 B;  3UT9 C;  3MGP A;  1P3L C;  4J8W B;  3WTP D;  5B40 D;  3AV1 A;  5B0Z D;  3R45 B;  3AYW D;  3MNN A;  2FJ7 B;  1HQ3 A;  5AV8 A;  3R45 A;  5JRG A;  3AZN C;  3KSY A;  1M1A D;  3A1K A;  1ULY A;  1M18 C;  5CPJ C;  2G5I C;  3VH5 T;  4QLC B;  3MGS A;  3EPL A;  3UT9 B;  4QLC A;  1P3K C;  4G91 C;  5CPI C;  3AZL C;  1P3L B;  2NZD B;  5FUG A;  2NZD A;  3AFA B;  3AZH C;  2L5A A;  2RVQ D;  3AFA A;  3LJA C;  5GT0 C;  4ZBJ C;  3KUY C;  3KWQ D;  4WU9 C;  4XZQ D;  5DNM B;  4KGC B;  5CP6 D;  3UTA D;  4KGC A;  1P3K B;  3C1C C;  3B6G C;  4G91 B;  5CPI B;  3AZL B;  5GT3 C;  5DNN B;  1P34 C;  5DNN A;  4KUD A;  3LJA B;  3FDD A;  4LD9 B;  2PYO A;  3W99 C;  1TAF B;  4LD9 A;  4ZBJ B;  5C3I C;  3H0M C;  3KUY B;  3LEL A;  3B6F D;  3NQU B;  5AVB D;  2CV5 C;  2F8N G;  3NQU A;  2J8P A;  4AWL C;  4J8V C;  3C1B B;  5GSU C;  3B0B A;  4Z66 D;  2ZY5 A;  5BS7 C;  3C1B A;  5GT3 B;  4J8X B;  3REI A;  3VH6 T;  4H9N B;  4J8X A;  1P34 B;  5B32 B;  1H3O A;  4Z5T C;  3AZM D;  1KU5 A;  5B32 A;  3W99 B;  5AV5 D;  4Z2M G;  5C3I B;  2ZM5 A;  5B2J C;  4AWL B;  4J8V B;  3REL A;  3X1U B;  2DF4 C;  3KXB D;  1JFI A;  2Y2M A;  5GSU B;  3X1U A;  3NQJ A;  3REJ D;  3UTB C;  3AZF A;  4YM6 C;  4R8P C;  3LZ0 C;  4Z5T B;  5B33 A;  4CSR B;  5JA4 B;  1U35 D;  5B1M D;  4KHA A;  4YS3 C;  5JA4 A;  1BFM A;  3AZJ C;  1P3G C;  3MGR C;  3WAA D;  1A7W A;  3X1V C;  3MGQ D;  3AV2 D;  3REK D;  2F8N B;  3UTB B;  3WKJ C;  1M19 D;  2ARO C;  4YM6 B;  3LZ0 B;  3AZI D;  5AVC A;  4YS3 B;  1ID3 D;  4H9S A;  2UWX A;  5G49 A;  1S32 B;  3AZJ B;  1S32 A;  2Y2G A;  1P3G B;  4J8W D;  2YFV A;  2FJ7 D;  3X1V B;  1R4V A;  4H9R A;  3WKJ B;  5CPK D;  1P3F C;  5BO0 A;  4X23 D;  4JJN C;  3AN2 A;  1P3M C;  3KWQ A;  4XZQ A;  3O62 B;  3UTA A;  2HIO C;  5F99 B;  3TU4 B;  3O62 A;  3MVD B;  3TU4 A;  5F99 A;  3W98 C;  3MVD A;  1P3P B;  5E5A C;  5AV6 C;  1P3P A;  3AZN D;  1BH8 B;  5B2I C;  1P3F B;  1M18 D;  5CPJ D;  5GXQ C;  4JJN B;  4J8U C;  1P3M B;  1KX5 C;  5AVB A;  3W96 A;  1KX3 B;  2HIO B;  5CPI D;  3AZL D;  3MGP C;  3W98 B;  3AZH D;  3W97 B;  3V9R B;  5E5A B;  3W97 A;  1Q9C A;  2VQR A;  5GT0 D;  3AZG A;  3AV1 C;  2BG1 A;  5B2I B;  3MNN C;  3KUY D;  1HQ3 C;  5AV8 C;  5JRG C;  4WU9 D;  5GXQ B;  4J8U B;  2Y2Q A;  1KX5 B;  3C1C D;  3B6G D;  5BT1 C;  3MGS C;  5B0Y A;  5GT3 D;  4QLC C;  3KXB A;  3MGP B;  1PZR A;  3REH A;  3REJ A;  2NZD C;  2IO5 C;  3AFA C;  3AV1 B;  3AZE A;  1TZY B;  3MNN B;  1HQ3 B;  5AV8 B;  5JRG B;  1TZY A;  2CV5 D;  5B1M A;  3X1S A;  3LZ1 B;  5KDM B;  4ZUX B;  4J8V D;  2Y2P A;  1P3B A;  3LZ1 A;  1KX4 B;  2FFF B;  5KDM A;  4ZUX A;  1W2E A;  3MGS B;  5DNM C;  1KX4 A;  4KGC C;  3WAA A;  5B32 G;  5FUG B;  3REK A;  4Z5T D;  3AZI A;  5DNN C;  4KUD C;  2LY8 A;  1BH9 A;  2IO5 B;  3A1I A;  2PYO C;  4LD9 C;  1AOI A;  5B24 A;  1ID3 A;  5B2J D;  3LEL C;  1P3A D;  2F8N D;  4XUJ D;  5AV9 D;  4YM6 D;  4R8P D;  3LZ0 D;  3C1B C;  3REI C;  3KFU G;  4J8X C;  2Y2O A;  5CPK A;  4KUD B;  3AZK A;  2PYO B;  4X23 A;  5B32 C;  3EPJ A;  3WTP E;  3AZJ D;  4WU8 B;  3LEL B;  1F66 D;  3MGR D;  4WU8 A;  3REL C;  3X1V D;  1ZLA D;  3X1U C;  2ARO D;  5B31 D;  3REI B;  3AZF C;  5AY8 B;  2NQB A;  1H3O B;  2XD5 A;  5B33 C;  5AY8 A;  1N1J A;  3REL B;  1JFI B;  4WZS B;  3NQJ B;  1P3F D;  3AZF B;  5B1L B;  4JJN D;  3P5J B;  1HTA A;  5B1L A;  5AVC C;  5B33 B;  3WA9 A;  1P3O D;  4KHA B;  4H9S C;  3H0L C;  2Y2J A;  4M6B A;  1P3I D;  4E44 A;  1EQZ A;  5E5A D;  3A6N A;  4H9P A;  1S32 C;  5AV6 D;  3X1T D;  2F8N K;  5B40 B;  2RVQ C;  3WTP A;  5B40 A;  5AVC B;  1KX5 D;  5B0Z A;  2Y2N A;  1B6W A;  3AYW A;  1M1A B;  2F8N H;  3AN2 C;  1M1A A;  3KWQ C;  5G49 B;  4XZQ C;  3O62 C;  3TU4 C;  5F99 C;  3MVD C;  2YFV B;  3AV1 D;  1P3P C;  4H9R B;  1HQ3 D;  4Z2M H;  5BO0 B;  3EPH A;  2BYK A;  2HUE C;  3AN2 B;  5BT1 D;  3MGS D;  5BNX A;  5AVB C;  3W96 C;  4XZQ B;  4QLC D;  3KWQ B;  1P3A A;  4UPK A;  3UT9 D;  3UTA B;  1KX3 C;  5CP6 A;  4XUJ A;  1P3L D;  3EPK A;  5AV9 A;  2NZD D;  3AFA D;  3VH5 W;  3W97 C;  3AZG C;  1B67 A;  4WNN A;  2HUE B;  3B6F B;  4KGC D;  5DNM D;  2Y2H A;  1F66 A;  3MGR A;  5AVB B;  3B6F A;  3W96 B;  1P3K D;  4HGA C;  5B0Y C;  1ZLA A;  3KXB C;  1Z2C B;  4Z66 B;  5B31 A;  3REH C;  5DNN D;  3REJ C;  4KUD D;  4Z66 A;  2W8S A;  3LJA D;  3AZG B;  4LD9 D;  3AZE C;  3AZM B;  3LEL D;  1TZY C;  3AZM A;  5B1M C;  3X1S C;  5AV5 A;  1P3B C;  3LZ1 C;  4ZUX C;  3C1B D;  1KX4 C;  4HGA B;  5B0Y B;  3REI D;  3WAA C;  3KXB B;  4J8X D;  3REH B;  3REJ B;  4NFT A;  3REK C;  1P34 D;  5B32 D;  5B24 B;  3AZI C;  4CAY A;  3AZE B;  3W99 D;  1P3O A;  5B1M B;  5B24 C;  2ZY3 A;  3VH6 W;  3X1S B;  1ID3 C;  1U35 A;  4H9O A;  1AOI C;  1P3B B;  1P3I A;  3H0R C;  3X1U D;  5BNV A;  5AV6 A;  5GSU D;  3X1T A;  3WAA B;  4H9Q A;  3MGQ B;  4DRB A;  3AV2 B;  3REK B;  2F2A C;  1F1E A;  5B33 D;  3MGQ A;  3AV2 A;  1M19 B;  3AZI B;  5CPK C;  1BH9 B;  3AZK C;  1M19 A;  4X23 C;  1AOI B;  2BYM B;  1ID3 B; 
#chains in the Genus database with same CATH homology
 2BYM A;  4WU8 C;  4J8W A;  3UTB D;  2G5H C;  5AVC D;  2FJ7 A;  5CPK B;  2NQB C;  3AZK B;  5AY8 C;  2JCH A;  4YS3 D;  4X23 B;  3B0C T;  1S32 D;  3VH5 A;  3UT9 A;  1P3G D;  1P3L A;  4NE5 A;  4UUZ B;  3WKJ D;  2YFW B;  4UUZ A;  3AZN B;  2YFW A;  3EG5 B;  2CWE A;  3AZN A;  5B1L C;  3AN2 D;  1M18 B;  2NQB B;  5CPJ B;  4E45 A;  3WA9 C;  1M18 A;  5CPJ A;  1N1J B;  5DNM A;  3O62 D;  3TU4 D;  5F99 D;  3MVD D;  1EQZ C;  3AL0 C;  1P3K A;  3A6N C;  5CPI A;  1P3P D;  3AZL A;  3AZH B;  2ZY4 A;  3AZH A;  2Y2K A;  3LJA A;  5GT0 B;  3WTP C;  5B40 C;  5GT0 A;  1TAF A;  5B0Z C;  3AYW C;  4WU9 B;  1P3M D;  3KUY A;  3WA9 B;  3W96 D;  4WU9 A;  1M1A C;  1KX3 D;  2HIO D;  3C1C B;  1EQZ B;  3B6G B;  3C1C A;  3A6N B;  4H9P B;  2RIQ A;  3B6G A;  3W97 D;  3W98 D;  2JSS A;  5GT3 A;  3AZG D;  4H9N A;  1WWI A;  1T3U A;  1P34 A;  3VH6 A;  4NE6 A;  5B2I D;  3WTP B;  3W99 A;  5GXQ D;  5B0Z B;  4J8U D;  3AYW B;  4NE3 A;  2CV5 B;  5B0Y D;  2CV5 A;  5B31 G;  1P3A C;  4J8V A;  3MGP D;  3REH D;  5CP6 C;  5GSU A;  4XUJ C;  3UTA C;  5BS7 A;  5AV9 C;  3AZE D;  1WWS A;  4Z5T A;  1TZY D;  3MNN D;  5AV8 D;  4CSR A;  5JRG D;  3X1S D;  2Y2I A;  1P3B D;  3LZ1 D;  2BYK B;  4ZUX D;  2ZY2 A;  5B2J B;  1KX4 D;  1F66 C;  5BNX B;  1P3A B;  3B6F C;  5B2J A;  5CP6 B;  1ZLA C;  4XUJ B;  2F8N A;  5AV9 B;  5B31 C;  4R8P B;  3UTB A;  4Z66 C;  4YM6 A;  4R8P A;  3LZ0 A;  4WJ3 C;  1AOI D;  5B24 D;  4WNN B;  2XD1 A;  3IP4 C;  4YS3 A;  3AZM C;  5AV5 C;  1F66 B;  3MGR B;  3AZJ A;  4DQY B;  1P3G A;  1ZLA B;  3X1V A;  2ARO B;  5B31 B;  3WKJ A;  3AZK D;  2ARO A;  2PYO D;  1P3O C;  4WU8 D;  1U35 C;  5AV5 B;  1P3I C;  3F6T A;  3B0C W;  3X1T C;  2DQN C;  2Y2L A;  3B0D C;  1BH8 A;  2NQB D;  3MGQ C;  3AV2 C;  5AY8 D;  1P3F A;  4CAY B;  1M19 C;  4JJN A;  4G92 C;  1P3M A;  1P3O B;  4DRA A;  1KX3 A;  4EO5 C;  2HIO A;  4H9O B;  1U35 B;  1P3I B;  2JE5 A;  3REL D;  3W98 A;  5BNV B;  5AV6 B;  3V9R A;  5E5A A;  3X1T B;  4WV4 B;  4J8W C;  3AZF D;  4H9Q B;  5B1L D;  3B0D B;  5CHL B;  2FJ7 C;  5B2I A;  3WA9 D;  5GXQ A;  4J8U A;  4G92 B;  1KX5 A;  1EQZ D;  3A6N D;  4EO5 B;  3UT9 C;  3MGP A;  1P3L C;  4J8W B;  3WTP D;  5B40 D;  3AV1 A;  5B0Z D;  3R45 B;  3AYW D;  3MNN A;  2FJ7 B;  1HQ3 A;  5AV8 A;  3R45 A;  5JRG A;  3AZN C;  3KSY A;  1M1A D;  3A1K A;  1ULY A;  1M18 C;  5CPJ C;  2G5I C;  3VH5 T;  4QLC B;  3MGS A;  3EPL A;  3UT9 B;  4QLC A;  1P3K C;  4G91 C;  5CPI C;  3AZL C;  1P3L B;  2NZD B;  5FUG A;  2NZD A;  3AFA B;  3AZH C;  2L5A A;  2RVQ D;  3AFA A;  3LJA C;  5GT0 C;  4ZBJ C;  3KUY C;  3KWQ D;  4WU9 C;  4XZQ D;  5DNM B;  4KGC B;  5CP6 D;  3UTA D;  4KGC A;  1P3K B;  3C1C C;  3B6G C;  4G91 B;  5CPI B;  3AZL B;  5GT3 C;  5DNN B;  1P34 C;  5DNN A;  4KUD A;  3LJA B;  3FDD A;  4LD9 B;  2PYO A;  3W99 C;  1TAF B;  4LD9 A;  4ZBJ B;  5C3I C;  3H0M C;  3KUY B;  3LEL A;  3B6F D;  3NQU B;  5AVB D;  2CV5 C;  2F8N G;  3NQU A;  2J8P A;  4AWL C;  4J8V C;  3C1B B;  5GSU C;  3B0B A;  4Z66 D;  2ZY5 A;  5BS7 C;  3C1B A;  5GT3 B;  4J8X B;  3REI A;  3VH6 T;  4H9N B;  4J8X A;  1P34 B;  5B32 B;  1H3O A;  4Z5T C;  3AZM D;  1KU5 A;  5B32 A;  3W99 B;  5AV5 D;  4Z2M G;  5C3I B;  2ZM5 A;  5B2J C;  4AWL B;  4J8V B;  3REL A;  3X1U B;  2DF4 C;  3KXB D;  1JFI A;  2Y2M A;  5GSU B;  3X1U A;  3NQJ A;  3REJ D;  3UTB C;  3AZF A;  4YM6 C;  4R8P C;  3LZ0 C;  4Z5T B;  5B33 A;  4CSR B;  5JA4 B;  1U35 D;  5B1M D;  4KHA A;  4YS3 C;  5JA4 A;  1BFM A;  3AZJ C;  1P3G C;  3MGR C;  3WAA D;  1A7W A;  3X1V C;  3MGQ D;  3AV2 D;  3REK D;  2F8N B;  3UTB B;  3WKJ C;  1M19 D;  2ARO C;  4YM6 B;  3LZ0 B;  3AZI D;  5AVC A;  4YS3 B;  1ID3 D;  4H9S A;  2UWX A;  5G49 A;  1S32 B;  3AZJ B;  1S32 A;  2Y2G A;  1P3G B;  4J8W D;  2YFV A;  2FJ7 D;  3X1V B;  1R4V A;  4H9R A;  3WKJ B;  5CPK D;  1P3F C;  5BO0 A;  4X23 D;  4JJN C;  3AN2 A;  1P3M C;  3KWQ A;  4XZQ A;  3O62 B;  3UTA A;  2HIO C;  5F99 B;  3TU4 B;  3O62 A;  3MVD B;  3TU4 A;  5F99 A;  3W98 C;  3MVD A;  1P3P B;  5E5A C;  5AV6 C;  1P3P A;  3AZN D;  1BH8 B;  5B2I C;  1P3F B;  1M18 D;  5CPJ D;  5GXQ C;  4JJN B;  4J8U C;  1P3M B;  1KX5 C;  5AVB A;  3W96 A;  1KX3 B;  2HIO B;  5CPI D;  3AZL D;  3MGP C;  3W98 B;  3AZH D;  3W97 B;  3V9R B;  5E5A B;  3W97 A;  1Q9C A;  2VQR A;  5GT0 D;  3AZG A;  3AV1 C;  2BG1 A;  5B2I B;  3MNN C;  3KUY D;  1HQ3 C;  5AV8 C;  5JRG C;  4WU9 D;  5GXQ B;  4J8U B;  2Y2Q A;  1KX5 B;  3C1C D;  3B6G D;  5BT1 C;  3MGS C;  5B0Y A;  5GT3 D;  4QLC C;  3KXB A;  3MGP B;  1PZR A;  3REH A;  3REJ A;  2NZD C;  2IO5 C;  3AFA C;  3AV1 B;  3AZE A;  1TZY B;  3MNN B;  1HQ3 B;  5AV8 B;  5JRG B;  1TZY A;  2CV5 D;  5B1M A;  3X1S A;  3LZ1 B;  5KDM B;  4ZUX B;  4J8V D;  2Y2P A;  1P3B A;  3LZ1 A;  1KX4 B;  2FFF B;  5KDM A;  4ZUX A;  1W2E A;  3MGS B;  5DNM C;  1KX4 A;  4KGC C;  3WAA A;  5B32 G;  5FUG B;  3REK A;  4Z5T D;  3AZI A;  5DNN C;  4KUD C;  2LY8 A;  1BH9 A;  2IO5 B;  3A1I A;  2PYO C;  4LD9 C;  1AOI A;  5B24 A;  1ID3 A;  5B2J D;  3LEL C;  1P3A D;  2F8N D;  4XUJ D;  5AV9 D;  4YM6 D;  4R8P D;  3LZ0 D;  3C1B C;  3REI C;  3KFU G;  4J8X C;  2Y2O A;  5CPK A;  4KUD B;  3AZK A;  2PYO B;  4X23 A;  5B32 C;  3EPJ A;  3WTP E;  3AZJ D;  4WU8 B;  3LEL B;  1F66 D;  3MGR D;  4WU8 A;  3REL C;  3X1V D;  1ZLA D;  3X1U C;  2ARO D;  5B31 D;  3REI B;  3AZF C;  5AY8 B;  2NQB A;  1H3O B;  2XD5 A;  5B33 C;  5AY8 A;  1N1J A;  3REL B;  1JFI B;  4WZS B;  3NQJ B;  1P3F D;  3AZF B;  5B1L B;  4JJN D;  3P5J B;  1HTA A;  5B1L A;  5AVC C;  5B33 B;  3WA9 A;  1P3O D;  4KHA B;  4H9S C;  3H0L C;  2Y2J A;  4M6B A;  1P3I D;  4E44 A;  1EQZ A;  5E5A D;  3A6N A;  4H9P A;  1S32 C;  5AV6 D;  3X1T D;  2F8N K;  5B40 B;  2RVQ C;  3WTP A;  5B40 A;  5AVC B;  1KX5 D;  5B0Z A;  2Y2N A;  1B6W A;  3AYW A;  1M1A B;  2F8N H;  3AN2 C;  1M1A A;  3KWQ C;  5G49 B;  4XZQ C;  3O62 C;  3TU4 C;  5F99 C;  3MVD C;  2YFV B;  3AV1 D;  1P3P C;  4H9R B;  1HQ3 D;  4Z2M H;  5BO0 B;  3EPH A;  2BYK A;  2HUE C;  3AN2 B;  5BT1 D;  3MGS D;  5BNX A;  5AVB C;  3W96 C;  4XZQ B;  4QLC D;  3KWQ B;  1P3A A;  4UPK A;  3UT9 D;  3UTA B;  1KX3 C;  5CP6 A;  4XUJ A;  1P3L D;  3EPK A;  5AV9 A;  2NZD D;  3AFA D;  3VH5 W;  3W97 C;  3AZG C;  1B67 A;  4WNN A;  2HUE B;  3B6F B;  4KGC D;  5DNM D;  2Y2H A;  1F66 A;  3MGR A;  5AVB B;  3B6F A;  3W96 B;  1P3K D;  4HGA C;  5B0Y C;  1ZLA A;  3KXB C;  1Z2C B;  4Z66 B;  5B31 A;  3REH C;  5DNN D;  3REJ C;  4KUD D;  4Z66 A;  2W8S A;  3LJA D;  3AZG B;  4LD9 D;  3AZE C;  3AZM B;  3LEL D;  1TZY C;  3AZM A;  5B1M C;  3X1S C;  5AV5 A;  1P3B C;  3LZ1 C;  4ZUX C;  3C1B D;  1KX4 C;  4HGA B;  5B0Y B;  3REI D;  3WAA C;  3KXB B;  4J8X D;  3REH B;  3REJ B;  4NFT A;  3REK C;  1P34 D;  5B32 D;  5B24 B;  3AZI C;  4CAY A;  3AZE B;  3W99 D;  1P3O A;  5B1M B;  5B24 C;  2ZY3 A;  3VH6 W;  3X1S B;  1ID3 C;  1U35 A;  4H9O A;  1AOI C;  1P3B B;  1P3I A;  3H0R C;  3X1U D;  5BNV A;  5AV6 A;  5GSU D;  3X1T A;  3WAA B;  4H9Q A;  3MGQ B;  4DRB A;  3AV2 B;  3REK B;  2F2A C;  1F1E A;  5B33 D;  3MGQ A;  3AV2 A;  1M19 B;  3AZI B;  5CPK C;  1BH9 B;  3AZK C;  1M19 A;  4X23 C;  1AOI B;  2BYM B;  1ID3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...