5CPJB

Nucleosome containing methylated sat2r dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags "structural protein/dna
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjB00
2HIOC 4Z5TD 5AV9B 5E5AA 5BT1C 5E5AB 3W97D 1P3BD 4M6BA 4J8WD 2BYKB 1H3OB 4H9SA 1ULYA 2L5AA 5B1MD 1P3FC 2HUEB 3LZ0D 3AZIC 2IO5C 1P3BA 1P3LA 1KX3C 3REID 4J8WA 3LELA 1P3LB 1P3BB 4CSRA 4YS3C 4J8WB 5JRGC 3LELB 5B1MA 4KGCC 4CSRB 4R8PD 3RELD 3LZ0A 4JJNA 4HGAC 3WA9C 3WTPC 3AN2D 3B6GC 4Z2MH 2RVQC 3LZ0B 5AY8D 4JJNB 4WU9D 3AZND 5B32C 4Z66A 1P3KC 2NQBD 3WAAD 3X1VC 4R8PA 2F8NB 4WV4B 4Z66B 5B31G 3MGRD 1BFMA 2PYOC 5AY8A 3KUYC 4WU9A 3AV1B 4H9OA 1P3AA 5GT3C 5AY8B 3AZNA 4H9QA 4WU9B 4H9OB 3MNND 1P3AB 3AZNB 4H9QB 3AZHC 1P3IB 3W97C 3TU4D 5DNND 3AZLA 4J8XC 1P3GA 3O62C 5CP6D 3AZLB 1P3GB 3AFAB 3C1CC 4ZUXC 3KWQD 4AWLB 3AYWB 2FJ7A 4XZQC 1HQ3D 3AZKD 3MNNA 1U35A 2FJ7B 3TU4A 1KX5B 1U35B 2F8NH 5DNNA 3REIC 1P3MD 3UTAD 2NZDC 3KWQA 5C3IC 4XUJD 3NQJA 3VH6W 5B31D 3AZKA 2HIOD 5GT0C 1KX4C 3KWQB 3RELC 3W98C 3NQJB 3AZKB 4CAYA 1P34A 5DNMC 3AN2C 4WU8C 1TZYB 1R4VA 5B32G 4CAYB 5JA4A 3UTAA 1P34B 3REJC 1P3MA 5B0ZD 3MGQC 4J8UA 4XUJA 5JA4B 1F66A 3UTAB 5B31A 2HIOA 3WAAC 1EQZD 3VH5T 4J8UB 4XUJB 1F66B 5B31B 2HIOB 4YM6D 1P3FD 4EO5C 3MGRC 3AV2C 3AZID 1KX3D 3LZ1C 3REHA 4G91B 4LD9B 3REHB 4YS3D 3MGPD 5BNXA 1P3FA 3KXBB 4KGCD 5BNXB 3AZMD 1P3FB 3WTPD 3AZIA 5CP6C 1KX3A 5B40A 2RVQD 1Q9CA 4E45A 3AZGC 2IO5B 1HQ3C 5CPKD 1KX3B 5B40B 4YS3A 1P3OB 5B32D 5JRGA 1P3KD 5AV5D 3WKJD 3X1VD 4KGCA 4YS3B 5JRGB 1WWSA 4DRAA 3UTBB 3WTPA 3WA9A 4WNNA 3B6GA 4ZBJC 4KGCB 4H9RA 3AZFC 2PYOD 4HGAB 3WA9B 3WTPB 5AVCC 4WNNB 3KUYD 2CV5C 3B6GB 4H9RB 5GT3D 5AV8C 1ID3D 5B32A 1P3KA 3X1VA 3A6NC 3MGSB 3AZHD 3X1VB 2PYOA 5B0ZC 4J8XD 3LJAC 3O62D 3KUYA 3REKD 1EQZC 5GT3A 2PYOB 4Z5TA 5F99D 4QLCC 3C1CD 4G92C 4ZUXD 3KUYB 4XZQD 4YM6C 5GT3B 4Z5TB 5B2IC 3AZHA 3W97A 1M18C 1M19D 4J8XA 3O62A 1B67A 5GXQC 1M1AD 5CPJC 3W97B 2NZDD 3C1CA 3MGPC 4XZQA 5GT0D 3C1CB 1KX4D 3W98D 4KUDC 4XZQB 5B1MB 3AZMC 5DNMD 5GSUD 4WU8D 4X23C 3REIA 3REJD 3UT9D 5CPKC 1WWIA 3MGQD 5B0YC 4J8VC 2NZDA 3REIB 3W99D 5CPIC 5B2JC 5GT0A 5AV5C 3WKJC 2NZDB 1KX4A 3W98A 5C3IB 3RELA 1JFIA 1F66C 5GT0B 5DNMA 3AN2A 4WU8A 4H9NA 3X1SD 1KX4B 4R8PB 3RELB 3AV2D 1JFIB 3B0CT 3KSYA 5DNMB 3AN2B 3LZ1D 1ID3C 2NQBA 3WAAA 5B24C 2NQBB 3WAAB 3MGRA 3AV2A 3B0DB 3MGRB 3REKC 3AV2B 3LZ1A 5F99C 3AZGD 3LZ1B 3MNNB 1M19C 1BH9A 2YFVA 1M1AC 3TU4B 5CP6A 5DNNB 3AZFD 3AZGA 1BH9B 2YFVB 4UUZA 5AVCD 2CV5D 1HQ3A 5CP6B 2CWEA 5AV8D 1P3PC 3AZGB 1HQ3B 5GSUC 3VH6A 3A6ND 3W96C 2JSSA 3AZFA 3VH6T 3UT9C 5BS7C 3LJAD 2CV5A 5AVCA 4ZBJB 3W99C 1P3MB 4QLCD 1BH8A 2CV5B 5AVCB 4E44A 1AOIC 4NE6A 1BH8B 3X1SC 3A6NA 5B2ID 3X1UC 5AV6C 1M18D 5B0ZA 3A6NB 3LJAA 5GXQD 5CPJD 1EQZA 3VH5W 4QLCA 5B0ZB 4WZSB 3AV1C 4YM6A 1EQZB 4Z2MG 4G92B 1S32D 5B2IA 4KUDD 1N1JA 4YM6B 1M18A 4X23D 1KU5A 1P3IC 5B2IB 2F8NK 1N1JB 5AVBD 5GXQA 5CPJA 3AZIB 5B0YD 4J8VD 3MGPA 5CPJB 5CPID 5B2JD 1P3GC 3AFAC 3AYWC 4KUDA 3MGPB 3AZMA 4H9PA 3AZEC 2FJ7C 1KX5C 1B6WA 3AZMB 4H9PB 5KDMA 5CPKA 3B6FC 5B1LD 5B33D 5B2JA 5AV5A 5BNVA 5KDMB 5CPIA 5CPKB 3WKJA 5B24D 5B32B 1P3KB 5CPIB 5AV5B 5AV9D 3WKJB 2AROC 3WTPE 3C1BC 1TZYC 1ZLAC 1ID3A 5FUGA 2F8NG 1ID3B 2YFWA 4J8UC 5FUGB 2YFWB 3AZHB 3REKA 5F99A 4J8XB 3O62B 4ZUXA 3REKB 3MVDC 5F99B 1P3PD 4ZUXB 1S32C 4G91C 1P3LD 2BYKA 1H3OA 4LD9C 3REHC 3LELD 1M19A 3KXBC 4NE3A 3W96D 5AVBC 3X1TC 1M1AA 4NFTA 1M19B 1HTAA 1M1AB 4JJND 1P3PA 1TAFA 5B40C 1AOID 1P3OC 5GSUA 1P3PB 3W98B 3X1UD 3W96A 1TAFB 5AV6D 5GSUB 4WU8B 4Z66D 4H9NB 3REJA 3UT9A 3UTBC 5BS7A 3MGQA 2F8ND 3W96B 5B1LC 3W99A 3REJB 5B33C 3UT9B 3MGQB 3MGSC 3AV1D 3AZJC 3W99B 1AOIA 5AV9C 3X1SA 3X1UA 1P3AD 3B0CW 1AOIB 5AV6A 2F8NA 4EO5B 3X1SB 1P3ID 5E5AC 3X1UB 3V9RA 5AV6B 3AV1A 3V9RB 3AZLD 1P3GD 3AFAD 3AYWD 3B0BA 4Z5TC 3AZED 4H9SC 2FJ7D 2HUEC 1P3IA 1KX5D 1U35D 4DRBA 3B6FD 2LY8A 1A7WA 4UUZB 1P3BC 1P3LC 3AFAA 3AYWA 4J8WC 3LELC 3AZEA 5CHLB 1F1EA 5B1MC 1KX5A 2AROD 3AZEB 3C1BD 1TZYD 3B6FA 3LZ0C 3AZFB 5AV8A 4JJNC 1P34D 1ZLAD 4KHAA 3B6FB 5AV8B 4KHAB 3NQUA 4J8UD 1F66D 4Z66C 2AROA 3NQUB 3C1BA 1TZYA 4R8PC 1ZLAA 2AROB 5BT1D 3LJAB 3C1BB 2BYMA 3MVDD 5AY8C 1ZLAB 4QLCB 4WU9C 1P3AC 3VH5A 4LD9D 2BYMB 3REHD 3AZNC 2NQBC 3KXBD 3X1TD 1M18B 3B0DC 5GXQB 3AZLC 3MVDA 4AWLC 1S32A 5B40D 5BO0A 3MVDB 4LD9A 1P3OD 4X23A 3KXBA 1S32B 4KUDB 3MNNC 1U35C 5BO0B 5AVBA 3X1TA 5JRGD 5G49A 4X23B 4NE5A 3UTBD 5B0YA 4J8VA 3TU4C 5AVBB 5DNNC 3X1TB 5G49B 3WA9D 3R45A 5B0YB 4J8VB 3MGSD 3B6GD 3AZJD 5B2JB 5BNVB 1P3OA 3R45B 3KWQC 3AZKC 3UTBA 5E5AD 1P34C 5B1LA 5B33A 5B24A 3MGSA 5B1LB 3UTAC 3AZJA 1P3MC 5B33B 5AV9A 4XUJC 5B24B 3AZJB 5B31C
chains in the Genus database with same CATH superfamily
2HIOC 4Z5TD 5AV9B 5E5AA 4DQYB 5BT1C 5E5AB 3W97D 1W2EA 2Y2MA 1P3BD 4M6BA 4J8WD 2BYKB 1H3OB 4H9SA 1ULYA 2L5AA 5B1MD 1P3FC 2Y2GA 2HUEB 3LZ0D 3AZIC 2IO5C 1P3BA 1P3LA 1KX3C 2FFFB 3REID 4J8WA 3LELA 1P3LB 1P3BB 4CSRA 4YS3C 4J8WB 5JRGC 3LELB 5B1MA 4KGCC 4CSRB 4R8PD 3RELD 3LZ0A 4JJNA 4HGAC 3WA9C 3WTPC 3AN2D 3B6GC 4Z2MH 2RVQC 3LZ0B 5AY8D 4JJNB 4WU9D 3AZND 5B32C 4Z66A 1P3KC 2NQBD 3WAAD 3X1VC 4R8PA 2F8NB 4WV4B 4Z66B 5B31G 3MGRD 4UPKA 1BFMA 2ZY5A 2PYOC 5AY8A 3KUYC 4WU9A 3H0RC 3AV1B 4H9OA 1P3AA 5GT3C 5AY8B 3AZNA 4H9QA 4WU9B 4H9OB 3MNND 1P3AB 3AZNB 4H9QB 3AZHC 1P3IB 2Y2KA 3W97C 3TU4D 5DNND 2RIQA 3AZLA 4J8XC 1P3GA 3O62C 5CP6D 3AZLB 1P3GB 3AFAB 3C1CC 4ZUXC 3KWQD 4AWLB 3AYWB 2FJ7A 4XZQC 1HQ3D 3AZKD 3MNNA 1U35A 2G5HC 2FJ7B 3EPLA 3TU4A 1KX5B 1U35B 2F8NH 5DNNA 4WJ3C 3REIC 2UWXA 1P3MD 3UTAD 2NZDC 3KWQA 5C3IC 4XUJD 3NQJA 3VH6W 5B31D 3AZKA 2HIOD 5GT0C 3F6TA 1KX4C 3KWQB 3RELC 3W98C 3NQJB 3AZKB 3EG5B 4CAYA 1P34A 5DNMC 3AN2C 4WU8C 1TZYB 1R4VA 1T3UA 5B32G 4CAYB 5JA4A 3UTAA 1P34B 3REJC 1P3MA 5B0ZD 3MGQC 4J8UA 4XUJA 5JA4B 1F66A 3UTAB 5B31A 2HIOA 3WAAC 1EQZD 3VH5T 4J8UB 4XUJB 1F66B 5B31B 2HIOB 4YM6D 1P3FD 4EO5C 3MGRC 3AV2C 3AZID 1KX3D 3LZ1C 3REHA 4G91B 4LD9B 3REHB 4YS3D 3MGPD 5BNXA 1P3FA 3KXBB 4KGCD 5BNXB 3AZMD 1P3FB 3WTPD 3AZIA 3P5JB 5CP6C 1KX3A 5B40A 2RVQD 1Q9CA 4E45A 3AZGC 2IO5B 1HQ3C 5CPKD 1KX3B 5B40B 4YS3A 1P3OB 5B32D 5JRGA 1P3KD 5AV5D 3WKJD 3X1VD 4KGCA 2DF4C 4YS3B 5JRGB 1WWSA 4DRAA 3UTBB 3WTPA 3WA9A 4WNNA 3B6GA 4ZBJC 4KGCB 4H9RA 3AZFC 2PYOD 3IP4C 4HGAB 3WA9B 3WTPB 5AVCC 4WNNB 3KUYD 2CV5C 3B6GB 4H9RB 5GT3D 5AV8C 1ID3D 5B32A 1P3KA 3X1VA 3A6NC 3MGSB 3AZHD 3X1VB 2PYOA 5B0ZC 4J8XD 3LJAC 3O62D 3KUYA 3REKD 1EQZC 5GT3A 2PYOB 4Z5TA 5F99D 4QLCC 3C1CD 4G92C 4ZUXD 3KUYB 4XZQD 4YM6C 5GT3B 4Z5TB 5B2IC 3AZHA 3W97A 1M18C 1M19D 4J8XA 3O62A 1B67A 5GXQC 1M1AD 5CPJC 3W97B 2NZDD 3C1CA 3MGPC 4XZQA 5GT0D 3C1CB 1KX4D 3W98D 4KUDC 4XZQB 5B1MB 3AZMC 5DNMD 5GSUD 4WU8D 4X23C 3REIA 3REJD 3UT9D 5CPKC 1WWIA 3MGQD 5B0YC 4J8VC 2NZDA 3REIB 3W99D 5CPIC 5B2JC 5GT0A 5AV5C 3WKJC 2NZDB 1KX4A 3W98A 5C3IB 3RELA 1JFIA 1F66C 5GT0B 5DNMA 3AN2A 4WU8A 4H9NA 3X1SD 1KX4B 4R8PB 3RELB 3AV2D 3EPJA 1JFIB 3B0CT 3KSYA 5DNMB 3AN2B 3LZ1D 1ID3C 2NQBA 3WAAA 3AL0C 5B24C 2NQBB 3WAAB 2Y2OA 3MGRA 3AV2A 2Y2QA 3B0DB 2J8PA 3MGRB 3REKC 3AV2B 3LZ1A 5F99C 3AZGD 3LZ1B 3H0LC 3MNNB 1M19C 1BH9A 2YFVA 1M1AC 3TU4B 5CP6A 5DNNB 3AZFD 3AZGA 1BH9B 2DQNC 2YFVB 4UUZA 5AVCD 2CV5D 1HQ3A 5CP6B 2CWEA 5AV8D 1P3PC 3AZGB 1HQ3B 5GSUC 3VH6A 3A6ND 3W96C 2JSSA 3AZFA 3VH6T 3UT9C 2BG1A 5BS7C 3LJAD 2CV5A 5AVCA 4ZBJB 3W99C 1P3MB 4QLCD 1BH8A 2CV5B 5AVCB 4E44A 1AOIC 4NE6A 1BH8B 3X1SC 3A6NA 5B2ID 3X1UC 5AV6C 1M18D 5B0ZA 3A6NB 3LJAA 5GXQD 5CPJD 1EQZA 3VH5W 4QLCA 5B0ZB 4WZSB 3AV1C 4YM6A 1EQZB 2Y2JA 4Z2MG 4G92B 1S32D 5B2IA 4KUDD 1N1JA 4YM6B 1M18A 4X23D 1KU5A 1P3IC 5B2IB 2F8NK 1N1JB 5AVBD 5GXQA 5CPJA 3AZIB 5B0YD 4J8VD 3MGPA 5CPJB 5CPID 5B2JD 1P3GC 3AFAC 3AYWC 4KUDA 3MGPB 3AZMA 4H9PA 3AZEC 2FJ7C 1KX5C 1B6WA 3AZMB 4H9PB 5KDMA 5CPKA 3B6FC 5B1LD 5B33D 5B2JA 5AV5A 5BNVA 5KDMB 5CPIA 5CPKB 3WKJA 5B24D 5B32B 1P3KB 2ZY4A 2JE5A 5CPIB 5AV5B 5AV9D 3WKJB 3H0MC 2AROC 3WTPE 3C1BC 1TZYC 1ZLAC 1ID3A 2ZY3A 2Y2NA 5FUGA 2F8NG 1ID3B 2YFWA 4J8UC 5FUGB 2VQRA 2YFWB 3AZHB 3REKA 3A1KA 5F99A 4J8XB 3O62B 4ZUXA 3REKB 3MVDC 5F99B 1P3PD 4ZUXB 1S32C 4G91C 1P3LD 2BYKA 1H3OA 4LD9C 3REHC 2XD5A 3LELD 1M19A 3KXBC 4NE3A 3W96D 5AVBC 3X1TC 1M1AA 4NFTA 1M19B 1HTAA 1M1AB 4JJND 1P3PA 1TAFA 5B40C 1AOID 1P3OC 5GSUA 1P3PB 3W98B 1Z2CB 3W96A 1TAFB 3X1UD 5AV6D 5GSUB 4WU8B 4Z66D 4H9NB 3REJA 3UT9A 3UTBC 5BS7A 3MGQA 2F8ND 3W96B 5B1LC 3W99A 2XD1A 3REJB 5B33C 3UT9B 3MGQB 3MGSC 3AV1D 3AZJC 3W99B 1AOIA 5AV9C 1PZRA 3X1SA 3X1UA 1P3AD 3B0CW 1AOIB 5AV6A 2F8NA 4EO5B 3X1SB 1P3ID 5E5AC 3X1UB 3V9RA 5AV6B 2Y2HA 3EPHA 3AV1A 3V9RB 2W8SA 3AZLD 1P3GD 3AFAD 2Y2IA 3FDDA 3AYWD 3B0BA 4Z5TC 3AZED 4H9SC 2Y2PA 2FJ7D 2HUEC 1P3IA 1KX5D 1U35D 4DRBA 3B6FD 2LY8A 1A7WA 4UUZB 1P3BC 1P3LC 3AFAA 3AYWA 4J8WC 3LELC 3AZEA 5CHLB 1F1EA 5B1MC 1KX5A 2AROD 3AZEB 3C1BD 2JCHA 1TZYD 3B6FA 3LZ0C 3AZFB 5AV8A 4JJNC 1P34D 1ZLAD 4KHAA 3B6FB 5AV8B 4KHAB 3NQUA 4J8UD 1F66D 4Z66C 2AROA 3NQUB 3C1BA 1TZYA 2F2AC 4R8PC 1ZLAA 2AROB 5BT1D 3LJAB 3C1BB 2BYMA 3MVDD 5AY8C 1ZLAB 2ZY2A 3KFUG 4QLCB 4WU9C 2G5IC 1P3AC 3VH5A 4LD9D 2BYMB 3REHD 3AZNC 2NQBC 3KXBD 3X1TD 1M18B 3B0DC 5GXQB 3EPKA 3AZLC 3MVDA 4AWLC 1S32A 5B40D 5BO0A 3MVDB 4LD9A 1P3OD 4X23A 3KXBA 1S32B 4KUDB 3MNNC 1U35C 5AVBA 5BO0B 3X1TA 5JRGD 5G49A 4X23B 4NE5A 3UTBD 5B0YA 4J8VA 3TU4C 3A1IA 5AVBB 5DNNC 3X1TB 5G49B 2ZM5A 3WA9D 3R45A 5B0YB 4J8VB 3MGSD 3B6GD 3AZJD 5B2JB 5BNVB 1P3OA 3R45B 3KWQC 3AZKC 3UTBA 5E5AD 1P34C 5B1LA 5B33A 2Y2LA 5B24A 3MGSA 5B1LB 3UTAC 3AZJA 1P3MC 5B33B 5AV9A 4XUJC 5B24B 3AZJB 5B31C
chains in the Genus database with same CATH topology
2HIOC 4Z5TD 5AV9B 5E5AA 4DQYB 5BT1C 5E5AB 3W97D 1W2EA 2Y2MA 1P3BD 4M6BA 4J8WD 2BYKB 1H3OB 4H9SA 1ULYA 2L5AA 5B1MD 1P3FC 2Y2GA 2HUEB 3LZ0D 3AZIC 2IO5C 1P3BA 1P3LA 1KX3C 2FFFB 3REID 4J8WA 3LELA 1P3LB 1P3BB 4CSRA 4YS3C 4J8WB 5JRGC 3LELB 5B1MA 4KGCC 4CSRB 4R8PD 3RELD 3LZ0A 4JJNA 4HGAC 3WA9C 3WTPC 3AN2D 3B6GC 4Z2MH 2RVQC 3LZ0B 5AY8D 4JJNB 4WU9D 3AZND 5B32C 4Z66A 1P3KC 2NQBD 3WAAD 3X1VC 4R8PA 2F8NB 4WV4B 4Z66B 5B31G 3MGRD 4UPKA 1BFMA 2ZY5A 2PYOC 5AY8A 3KUYC 4WU9A 3H0RC 3AV1B 4H9OA 1P3AA 5GT3C 5AY8B 3AZNA 4H9QA 4WU9B 4H9OB 3MNND 1P3AB 3AZNB 4H9QB 3AZHC 1P3IB 2Y2KA 3W97C 3TU4D 5DNND 2RIQA 3AZLA 4J8XC 1P3GA 3O62C 5CP6D 3AZLB 1P3GB 3AFAB 3C1CC 4ZUXC 3KWQD 4AWLB 3AYWB 2FJ7A 4XZQC 1HQ3D 3AZKD 3MNNA 1U35A 2G5HC 2FJ7B 3EPLA 3TU4A 1KX5B 1U35B 2F8NH 5DNNA 4WJ3C 3REIC 2UWXA 1P3MD 3UTAD 2NZDC 3KWQA 5C3IC 4XUJD 3NQJA 3VH6W 5B31D 3AZKA 2HIOD 5GT0C 3F6TA 1KX4C 3KWQB 3RELC 3W98C 3NQJB 3AZKB 3EG5B 4CAYA 1P34A 5DNMC 3AN2C 4WU8C 1TZYB 1R4VA 1T3UA 5B32G 4CAYB 5JA4A 3UTAA 1P34B 3REJC 1P3MA 5B0ZD 3MGQC 4J8UA 4XUJA 5JA4B 1F66A 3UTAB 5B31A 2HIOA 3WAAC 1EQZD 3VH5T 4J8UB 4XUJB 1F66B 5B31B 2HIOB 4YM6D 1P3FD 4EO5C 3MGRC 3AV2C 3AZID 1KX3D 3LZ1C 3REHA 4G91B 4LD9B 3REHB 4YS3D 3MGPD 5BNXA 1P3FA 3KXBB 4KGCD 5BNXB 3AZMD 1P3FB 3WTPD 3AZIA 3P5JB 5CP6C 1KX3A 5B40A 2RVQD 1Q9CA 4E45A 3AZGC 2IO5B 1HQ3C 5CPKD 1KX3B 5B40B 4YS3A 1P3OB 5B32D 5JRGA 1P3KD 5AV5D 3WKJD 3X1VD 4KGCA 2DF4C 4YS3B 5JRGB 1WWSA 4DRAA 3UTBB 3WTPA 3WA9A 4WNNA 3B6GA 4ZBJC 4KGCB 4H9RA 3AZFC 2PYOD 3IP4C 4HGAB 3WA9B 3WTPB 5AVCC 4WNNB 3KUYD 2CV5C 3B6GB 4H9RB 5GT3D 5AV8C 1ID3D 5B32A 1P3KA 3X1VA 3A6NC 3MGSB 3AZHD 3X1VB 2PYOA 5B0ZC 4J8XD 3LJAC 3O62D 3KUYA 3REKD 1EQZC 5GT3A 2PYOB 4Z5TA 5F99D 4QLCC 3C1CD 4G92C 4ZUXD 3KUYB 4XZQD 4YM6C 5GT3B 4Z5TB 5B2IC 3AZHA 3W97A 1M18C 1M19D 4J8XA 3O62A 1B67A 5GXQC 1M1AD 5CPJC 3W97B 2NZDD 3C1CA 3MGPC 4XZQA 5GT0D 3C1CB 1KX4D 3W98D 4KUDC 4XZQB 5B1MB 3AZMC 5DNMD 5GSUD 4WU8D 4X23C 3REIA 3REJD 3UT9D 5CPKC 1WWIA 3MGQD 5B0YC 4J8VC 2NZDA 3REIB 3W99D 5CPIC 5B2JC 5GT0A 5AV5C 3WKJC 2NZDB 1KX4A 3W98A 5C3IB 3RELA 1JFIA 1F66C 5GT0B 5DNMA 3AN2A 4WU8A 4H9NA 3X1SD 1KX4B 4R8PB 3RELB 3AV2D 3EPJA 1JFIB 3B0CT 3KSYA 5DNMB 3AN2B 3LZ1D 1ID3C 2NQBA 3WAAA 3AL0C 5B24C 2NQBB 3WAAB 2Y2OA 3MGRA 3AV2A 2Y2QA 3B0DB 2J8PA 3MGRB 3REKC 3AV2B 3LZ1A 5F99C 3AZGD 3LZ1B 3H0LC 3MNNB 1M19C 1BH9A 2YFVA 1M1AC 3TU4B 5CP6A 5DNNB 3AZFD 3AZGA 1BH9B 2DQNC 2YFVB 4UUZA 5AVCD 2CV5D 1HQ3A 5CP6B 2CWEA 5AV8D 1P3PC 3AZGB 1HQ3B 5GSUC 3VH6A 3A6ND 3W96C 2JSSA 3AZFA 3VH6T 3UT9C 2BG1A 5BS7C 3LJAD 2CV5A 5AVCA 4ZBJB 3W99C 1P3MB 4QLCD 1BH8A 2CV5B 5AVCB 4E44A 1AOIC 4NE6A 1BH8B 3X1SC 3A6NA 5B2ID 3X1UC 5AV6C 1M18D 5B0ZA 3A6NB 3LJAA 5GXQD 5CPJD 1EQZA 3VH5W 4QLCA 5B0ZB 4WZSB 3AV1C 4YM6A 1EQZB 2Y2JA 4Z2MG 4G92B 1S32D 5B2IA 4KUDD 1N1JA 4YM6B 1M18A 4X23D 1KU5A 1P3IC 5B2IB 2F8NK 1N1JB 5AVBD 5GXQA 5CPJA 3AZIB 5B0YD 4J8VD 3MGPA 5CPJB 5CPID 5B2JD 1P3GC 3AFAC 3AYWC 4KUDA 3MGPB 3AZMA 4H9PA 3AZEC 2FJ7C 1KX5C 1B6WA 3AZMB 4H9PB 5KDMA 5CPKA 3B6FC 5B1LD 5B33D 5B2JA 5AV5A 5BNVA 5KDMB 5CPIA 5CPKB 3WKJA 5B24D 5B32B 1P3KB 2ZY4A 2JE5A 5CPIB 5AV5B 5AV9D 3WKJB 3H0MC 2AROC 3WTPE 3C1BC 1TZYC 1ZLAC 1ID3A 2ZY3A 2Y2NA 5FUGA 2F8NG 1ID3B 2YFWA 4J8UC 5FUGB 2VQRA 2YFWB 3AZHB 3REKA 3A1KA 5F99A 4J8XB 3O62B 4ZUXA 3REKB 3MVDC 5F99B 1P3PD 4ZUXB 1S32C 4G91C 1P3LD 2BYKA 1H3OA 4LD9C 3REHC 2XD5A 3LELD 1M19A 3KXBC 4NE3A 3W96D 5AVBC 3X1TC 1M1AA 4NFTA 1M19B 1HTAA 1M1AB 4JJND 1P3PA 1TAFA 5B40C 1AOID 1P3OC 5GSUA 1P3PB 3W98B 1Z2CB 3W96A 1TAFB 3X1UD 5AV6D 5GSUB 4WU8B 4Z66D 4H9NB 3REJA 3UT9A 3UTBC 5BS7A 3MGQA 2F8ND 3W96B 5B1LC 3W99A 2XD1A 3REJB 5B33C 3UT9B 3MGQB 3MGSC 3AV1D 3AZJC 3W99B 1AOIA 5AV9C 1PZRA 3X1SA 3X1UA 1P3AD 3B0CW 1AOIB 5AV6A 2F8NA 4EO5B 3X1SB 1P3ID 5E5AC 3X1UB 3V9RA 5AV6B 2Y2HA 3EPHA 3AV1A 3V9RB 2W8SA 3AZLD 1P3GD 3AFAD 2Y2IA 3FDDA 3AYWD 3B0BA 4Z5TC 3AZED 4H9SC 2Y2PA 2FJ7D 2HUEC 1P3IA 1KX5D 1U35D 4DRBA 3B6FD 2LY8A 1A7WA 4UUZB 1P3BC 1P3LC 3AFAA 3AYWA 4J8WC 3LELC 3AZEA 5CHLB 1F1EA 5B1MC 1KX5A 2AROD 3AZEB 3C1BD 2JCHA 1TZYD 3B6FA 3LZ0C 3AZFB 5AV8A 4JJNC 1P34D 1ZLAD 4KHAA 3B6FB 5AV8B 4KHAB 3NQUA 4J8UD 1F66D 4Z66C 2AROA 3NQUB 3C1BA 1TZYA 2F2AC 4R8PC 1ZLAA 2AROB 5BT1D 3LJAB 3C1BB 2BYMA 3MVDD 5AY8C 1ZLAB 2ZY2A 3KFUG 4QLCB 4WU9C 2G5IC 1P3AC 3VH5A 4LD9D 2BYMB 3REHD 3AZNC 2NQBC 3KXBD 3X1TD 1M18B 3B0DC 5GXQB 3EPKA 3AZLC 3MVDA 4AWLC 1S32A 5B40D 5BO0A 3MVDB 4LD9A 1P3OD 4X23A 3KXBA 1S32B 4KUDB 3MNNC 1U35C 5AVBA 5BO0B 3X1TA 5JRGD 5G49A 4X23B 4NE5A 3UTBD 5B0YA 4J8VA 3TU4C 3A1IA 5AVBB 5DNNC 3X1TB 5G49B 2ZM5A 3WA9D 3R45A 5B0YB 4J8VB 3MGSD 3B6GD 3AZJD 5B2JB 5BNVB 1P3OA 3R45B 3KWQC 3AZKC 3UTBA 5E5AD 1P34C 5B1LA 5B33A 2Y2LA 5B24A 3MGSA 5B1LB 3UTAC 3AZJA 1P3MC 5B33B 5AV9A 4XUJC 5B24B 3AZJB 5B31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO C;  4Z5T D;  5AV9 B;  5E5A A;  5BT1 C;  5E5A B;  3W97 D;  1P3B D;  4M6B A;  4J8W D;  2BYK B;  1H3O B;  4H9S A;  1ULY A;  2L5A A;  5B1M D;  1P3F C;  2HUE B;  3LZ0 D;  3AZI C;  2IO5 C;  1P3B A;  1P3L A;  1KX3 C;  3REI D;  4J8W A;  3LEL A;  1P3L B;  1P3B B;  4CSR A;  4YS3 C;  4J8W B;  5JRG C;  3LEL B;  5B1M A;  4KGC C;  4CSR B;  4R8P D;  3REL D;  3LZ0 A;  4JJN A;  4HGA C;  3WA9 C;  3WTP C;  3AN2 D;  3B6G C;  4Z2M H;  2RVQ C;  3LZ0 B;  5AY8 D;  4JJN B;  4WU9 D;  3AZN D;  5B32 C;  4Z66 A;  1P3K C;  2NQB D;  3WAA D;  3X1V C;  4R8P A;  2F8N B;  4WV4 B;  4Z66 B;  5B31 G;  3MGR D;  1BFM A;  2PYO C;  5AY8 A;  3KUY C;  4WU9 A;  3AV1 B;  4H9O A;  1P3A A;  5GT3 C;  5AY8 B;  3AZN A;  4H9Q A;  4WU9 B;  4H9O B;  3MNN D;  1P3A B;  3AZN B;  4H9Q B;  3AZH C;  1P3I B;  3W97 C;  3TU4 D;  5DNN D;  3AZL A;  4J8X C;  1P3G A;  3O62 C;  5CP6 D;  3AZL B;  1P3G B;  3AFA B;  3C1C C;  4ZUX C;  3KWQ D;  4AWL B;  3AYW B;  2FJ7 A;  4XZQ C;  1HQ3 D;  3AZK D;  3MNN A;  1U35 A;  2FJ7 B;  3TU4 A;  1KX5 B;  1U35 B;  2F8N H;  5DNN A;  3REI C;  1P3M D;  3UTA D;  2NZD C;  3KWQ A;  5C3I C;  4XUJ D;  3NQJ A;  3VH6 W;  5B31 D;  3AZK A;  2HIO D;  5GT0 C;  1KX4 C;  3KWQ B;  3REL C;  3W98 C;  3NQJ B;  3AZK B;  4CAY A;  1P34 A;  5DNM C;  3AN2 C;  4WU8 C;  1TZY B;  1R4V A;  5B32 G;  4CAY B;  5JA4 A;  3UTA A;  1P34 B;  3REJ C;  1P3M A;  5B0Z D;  3MGQ C;  4J8U A;  4XUJ A;  5JA4 B;  1F66 A;  3UTA B;  5B31 A;  2HIO A;  3WAA C;  1EQZ D;  3VH5 T;  4J8U B;  4XUJ B;  1F66 B;  5B31 B;  2HIO B;  4YM6 D;  1P3F D;  4EO5 C;  3MGR C;  3AV2 C;  3AZI D;  1KX3 D;  3LZ1 C;  3REH A;  4G91 B;  4LD9 B;  3REH B;  4YS3 D;  3MGP D;  5BNX A;  1P3F A;  3KXB B;  4KGC D;  5BNX B;  3AZM D;  1P3F B;  3WTP D;  3AZI A;  5CP6 C;  1KX3 A;  5B40 A;  2RVQ D;  1Q9C A;  4E45 A;  3AZG C;  2IO5 B;  1HQ3 C;  5CPK D;  1KX3 B;  5B40 B;  4YS3 A;  1P3O B;  5B32 D;  5JRG A;  1P3K D;  5AV5 D;  3WKJ D;  3X1V D;  4KGC A;  4YS3 B;  5JRG B;  1WWS A;  4DRA A;  3UTB B;  3WTP A;  3WA9 A;  4WNN A;  3B6G A;  4ZBJ C;  4KGC B;  4H9R A;  3AZF C;  2PYO D;  4HGA B;  3WA9 B;  3WTP B;  5AVC C;  4WNN B;  3KUY D;  2CV5 C;  3B6G B;  4H9R B;  5GT3 D;  5AV8 C;  1ID3 D;  5B32 A;  1P3K A;  3X1V A;  3A6N C;  3MGS B;  3AZH D;  3X1V B;  2PYO A;  5B0Z C;  4J8X D;  3LJA C;  3O62 D;  3KUY A;  3REK D;  1EQZ C;  5GT3 A;  2PYO B;  4Z5T A;  5F99 D;  4QLC C;  3C1C D;  4G92 C;  4ZUX D;  3KUY B;  4XZQ D;  4YM6 C;  5GT3 B;  4Z5T B;  5B2I C;  3AZH A;  3W97 A;  1M18 C;  1M19 D;  4J8X A;  3O62 A;  1B67 A;  5GXQ C;  1M1A D;  5CPJ C;  3W97 B;  2NZD D;  3C1C A;  3MGP C;  4XZQ A;  5GT0 D;  3C1C B;  1KX4 D;  3W98 D;  4KUD C;  4XZQ B;  5B1M B;  3AZM C;  5DNM D;  5GSU D;  4WU8 D;  4X23 C;  3REI A;  3REJ D;  3UT9 D;  5CPK C;  1WWI A;  3MGQ D;  5B0Y C;  4J8V C;  2NZD A;  3REI B;  3W99 D;  5CPI C;  5B2J C;  5GT0 A;  5AV5 C;  3WKJ C;  2NZD B;  1KX4 A;  3W98 A;  5C3I B;  3REL A;  1JFI A;  1F66 C;  5GT0 B;  5DNM A;  3AN2 A;  4WU8 A;  4H9N A;  3X1S D;  1KX4 B;  4R8P B;  3REL B;  3AV2 D;  1JFI B;  3B0C T;  3KSY A;  5DNM B;  3AN2 B;  3LZ1 D;  1ID3 C;  2NQB A;  3WAA A;  5B24 C;  2NQB B;  3WAA B;  3MGR A;  3AV2 A;  3B0D B;  3MGR B;  3REK C;  3AV2 B;  3LZ1 A;  5F99 C;  3AZG D;  3LZ1 B;  3MNN B;  1M19 C;  1BH9 A;  2YFV A;  1M1A C;  3TU4 B;  5CP6 A;  5DNN B;  3AZF D;  3AZG A;  1BH9 B;  2YFV B;  4UUZ A;  5AVC D;  2CV5 D;  1HQ3 A;  5CP6 B;  2CWE A;  5AV8 D;  1P3P C;  3AZG B;  1HQ3 B;  5GSU C;  3VH6 A;  3A6N D;  3W96 C;  2JSS A;  3AZF A;  3VH6 T;  3UT9 C;  5BS7 C;  3LJA D;  2CV5 A;  5AVC A;  4ZBJ B;  3W99 C;  1P3M B;  4QLC D;  1BH8 A;  2CV5 B;  5AVC B;  4E44 A;  1AOI C;  4NE6 A;  1BH8 B;  3X1S C;  3A6N A;  5B2I D;  3X1U C;  5AV6 C;  1M18 D;  5B0Z A;  3A6N B;  3LJA A;  5GXQ D;  5CPJ D;  1EQZ A;  3VH5 W;  4QLC A;  5B0Z B;  4WZS B;  3AV1 C;  4YM6 A;  1EQZ B;  4Z2M G;  4G92 B;  1S32 D;  5B2I A;  4KUD D;  1N1J A;  4YM6 B;  1M18 A;  4X23 D;  1KU5 A;  1P3I C;  5B2I B;  2F8N K;  1N1J B;  5AVB D;  5GXQ A;  5CPJ A;  3AZI B;  5B0Y D;  4J8V D;  3MGP A;  5CPJ B;  5CPI D;  5B2J D;  1P3G C;  3AFA C;  3AYW C;  4KUD A;  3MGP B;  3AZM A;  4H9P A;  3AZE C;  2FJ7 C;  1KX5 C;  1B6W A;  3AZM B;  4H9P B;  5KDM A;  5CPK A;  3B6F C;  5B1L D;  5B33 D;  5B2J A;  5AV5 A;  5BNV A;  5KDM B;  5CPI A;  5CPK B;  3WKJ A;  5B24 D;  5B32 B;  1P3K B;  5CPI B;  5AV5 B;  5AV9 D;  3WKJ B;  2ARO C;  3WTP E;  3C1B C;  1TZY C;  1ZLA C;  1ID3 A;  5FUG A;  2F8N G;  1ID3 B;  2YFW A;  4J8U C;  5FUG B;  2YFW B;  3AZH B;  3REK A;  5F99 A;  4J8X B;  3O62 B;  4ZUX A;  3REK B;  3MVD C;  5F99 B;  1P3P D;  4ZUX B;  1S32 C;  4G91 C;  1P3L D;  2BYK A;  1H3O A;  4LD9 C;  3REH C;  3LEL D;  1M19 A;  3KXB C;  4NE3 A;  3W96 D;  5AVB C;  3X1T C;  1M1A A;  4NFT A;  1M19 B;  1HTA A;  1M1A B;  4JJN D;  1P3P A;  1TAF A;  5B40 C;  1AOI D;  1P3O C;  5GSU A;  1P3P B;  3W98 B;  3X1U D;  3W96 A;  1TAF B;  5AV6 D;  5GSU B;  4WU8 B;  4Z66 D;  4H9N B;  3REJ A;  3UT9 A;  3UTB C;  5BS7 A;  3MGQ A;  2F8N D;  3W96 B;  5B1L C;  3W99 A;  3REJ B;  5B33 C;  3UT9 B;  3MGQ B;  3MGS C;  3AV1 D;  3AZJ C;  3W99 B;  1AOI A;  5AV9 C;  3X1S A;  3X1U A;  1P3A D;  3B0C W;  1AOI B;  5AV6 A;  2F8N A;  4EO5 B;  3X1S B;  1P3I D;  5E5A C;  3X1U B;  3V9R A;  5AV6 B;  3AV1 A;  3V9R B;  3AZL D;  1P3G D;  3AFA D;  3AYW D;  3B0B A;  4Z5T C;  3AZE D;  4H9S C;  2FJ7 D;  2HUE C;  1P3I A;  1KX5 D;  1U35 D;  4DRB A;  3B6F D;  2LY8 A;  1A7W A;  4UUZ B;  1P3B C;  1P3L C;  3AFA A;  3AYW A;  4J8W C;  3LEL C;  3AZE A;  5CHL B;  1F1E A;  5B1M C;  1KX5 A;  2ARO D;  3AZE B;  3C1B D;  1TZY D;  3B6F A;  3LZ0 C;  3AZF B;  5AV8 A;  4JJN C;  1P34 D;  1ZLA D;  4KHA A;  3B6F B;  5AV8 B;  4KHA B;  3NQU A;  4J8U D;  1F66 D;  4Z66 C;  2ARO A;  3NQU B;  3C1B A;  1TZY A;  4R8P C;  1ZLA A;  2ARO B;  5BT1 D;  3LJA B;  3C1B B;  2BYM A;  3MVD D;  5AY8 C;  1ZLA B;  4QLC B;  4WU9 C;  1P3A C;  3VH5 A;  4LD9 D;  2BYM B;  3REH D;  3AZN C;  2NQB C;  3KXB D;  3X1T D;  1M18 B;  3B0D C;  5GXQ B;  3AZL C;  3MVD A;  4AWL C;  1S32 A;  5B40 D;  5BO0 A;  3MVD B;  4LD9 A;  1P3O D;  4X23 A;  3KXB A;  1S32 B;  4KUD B;  3MNN C;  1U35 C;  5BO0 B;  5AVB A;  3X1T A;  5JRG D;  5G49 A;  4X23 B;  4NE5 A;  3UTB D;  5B0Y A;  4J8V A;  3TU4 C;  5AVB B;  5DNN C;  3X1T B;  5G49 B;  3WA9 D;  3R45 A;  5B0Y B;  4J8V B;  3MGS D;  3B6G D;  3AZJ D;  5B2J B;  5BNV B;  1P3O A;  3R45 B;  3KWQ C;  3AZK C;  3UTB A;  5E5A D;  1P34 C;  5B1L A;  5B33 A;  5B24 A;  3MGS A;  5B1L B;  3UTA C;  3AZJ A;  1P3M C;  5B33 B;  5AV9 A;  4XUJ C;  5B24 B;  3AZJ B;  5B31 C; 
#chains in the Genus database with same CATH topology
 2HIO C;  4Z5T D;  5AV9 B;  5E5A A;  4DQY B;  5BT1 C;  5E5A B;  3W97 D;  1W2E A;  2Y2M A;  1P3B D;  4M6B A;  4J8W D;  2BYK B;  1H3O B;  4H9S A;  1ULY A;  2L5A A;  5B1M D;  1P3F C;  2Y2G A;  2HUE B;  3LZ0 D;  3AZI C;  2IO5 C;  1P3B A;  1P3L A;  1KX3 C;  2FFF B;  3REI D;  4J8W A;  3LEL A;  1P3L B;  1P3B B;  4CSR A;  4YS3 C;  4J8W B;  5JRG C;  3LEL B;  5B1M A;  4KGC C;  4CSR B;  4R8P D;  3REL D;  3LZ0 A;  4JJN A;  4HGA C;  3WA9 C;  3WTP C;  3AN2 D;  3B6G C;  4Z2M H;  2RVQ C;  3LZ0 B;  5AY8 D;  4JJN B;  4WU9 D;  3AZN D;  5B32 C;  4Z66 A;  1P3K C;  2NQB D;  3WAA D;  3X1V C;  4R8P A;  2F8N B;  4WV4 B;  4Z66 B;  5B31 G;  3MGR D;  4UPK A;  1BFM A;  2ZY5 A;  2PYO C;  5AY8 A;  3KUY C;  4WU9 A;  3H0R C;  3AV1 B;  4H9O A;  1P3A A;  5GT3 C;  5AY8 B;  3AZN A;  4H9Q A;  4WU9 B;  4H9O B;  3MNN D;  1P3A B;  3AZN B;  4H9Q B;  3AZH C;  1P3I B;  2Y2K A;  3W97 C;  3TU4 D;  5DNN D;  2RIQ A;  3AZL A;  4J8X C;  1P3G A;  3O62 C;  5CP6 D;  3AZL B;  1P3G B;  3AFA B;  3C1C C;  4ZUX C;  3KWQ D;  4AWL B;  3AYW B;  2FJ7 A;  4XZQ C;  1HQ3 D;  3AZK D;  3MNN A;  1U35 A;  2G5H C;  2FJ7 B;  3EPL A;  3TU4 A;  1KX5 B;  1U35 B;  2F8N H;  5DNN A;  4WJ3 C;  3REI C;  2UWX A;  1P3M D;  3UTA D;  2NZD C;  3KWQ A;  5C3I C;  4XUJ D;  3NQJ A;  3VH6 W;  5B31 D;  3AZK A;  2HIO D;  5GT0 C;  3F6T A;  1KX4 C;  3KWQ B;  3REL C;  3W98 C;  3NQJ B;  3AZK B;  3EG5 B;  4CAY A;  1P34 A;  5DNM C;  3AN2 C;  4WU8 C;  1TZY B;  1R4V A;  1T3U A;  5B32 G;  4CAY B;  5JA4 A;  3UTA A;  1P34 B;  3REJ C;  1P3M A;  5B0Z D;  3MGQ C;  4J8U A;  4XUJ A;  5JA4 B;  1F66 A;  3UTA B;  5B31 A;  2HIO A;  3WAA C;  1EQZ D;  3VH5 T;  4J8U B;  4XUJ B;  1F66 B;  5B31 B;  2HIO B;  4YM6 D;  1P3F D;  4EO5 C;  3MGR C;  3AV2 C;  3AZI D;  1KX3 D;  3LZ1 C;  3REH A;  4G91 B;  4LD9 B;  3REH B;  4YS3 D;  3MGP D;  5BNX A;  1P3F A;  3KXB B;  4KGC D;  5BNX B;  3AZM D;  1P3F B;  3WTP D;  3AZI A;  3P5J B;  5CP6 C;  1KX3 A;  5B40 A;  2RVQ D;  1Q9C A;  4E45 A;  3AZG C;  2IO5 B;  1HQ3 C;  5CPK D;  1KX3 B;  5B40 B;  4YS3 A;  1P3O B;  5B32 D;  5JRG A;  1P3K D;  5AV5 D;  3WKJ D;  3X1V D;  4KGC A;  2DF4 C;  4YS3 B;  5JRG B;  1WWS A;  4DRA A;  3UTB B;  3WTP A;  3WA9 A;  4WNN A;  3B6G A;  4ZBJ C;  4KGC B;  4H9R A;  3AZF C;  2PYO D;  3IP4 C;  4HGA B;  3WA9 B;  3WTP B;  5AVC C;  4WNN B;  3KUY D;  2CV5 C;  3B6G B;  4H9R B;  5GT3 D;  5AV8 C;  1ID3 D;  5B32 A;  1P3K A;  3X1V A;  3A6N C;  3MGS B;  3AZH D;  3X1V B;  2PYO A;  5B0Z C;  4J8X D;  3LJA C;  3O62 D;  3KUY A;  3REK D;  1EQZ C;  5GT3 A;  2PYO B;  4Z5T A;  5F99 D;  4QLC C;  3C1C D;  4G92 C;  4ZUX D;  3KUY B;  4XZQ D;  4YM6 C;  5GT3 B;  4Z5T B;  5B2I C;  3AZH A;  3W97 A;  1M18 C;  1M19 D;  4J8X A;  3O62 A;  1B67 A;  5GXQ C;  1M1A D;  5CPJ C;  3W97 B;  2NZD D;  3C1C A;  3MGP C;  4XZQ A;  5GT0 D;  3C1C B;  1KX4 D;  3W98 D;  4KUD C;  4XZQ B;  5B1M B;  3AZM C;  5DNM D;  5GSU D;  4WU8 D;  4X23 C;  3REI A;  3REJ D;  3UT9 D;  5CPK C;  1WWI A;  3MGQ D;  5B0Y C;  4J8V C;  2NZD A;  3REI B;  3W99 D;  5CPI C;  5B2J C;  5GT0 A;  5AV5 C;  3WKJ C;  2NZD B;  1KX4 A;  3W98 A;  5C3I B;  3REL A;  1JFI A;  1F66 C;  5GT0 B;  5DNM A;  3AN2 A;  4WU8 A;  4H9N A;  3X1S D;  1KX4 B;  4R8P B;  3REL B;  3AV2 D;  3EPJ A;  1JFI B;  3B0C T;  3KSY A;  5DNM B;  3AN2 B;  3LZ1 D;  1ID3 C;  2NQB A;  3WAA A;  3AL0 C;  5B24 C;  2NQB B;  3WAA B;  2Y2O A;  3MGR A;  3AV2 A;  2Y2Q A;  3B0D B;  2J8P A;  3MGR B;  3REK C;  3AV2 B;  3LZ1 A;  5F99 C;  3AZG D;  3LZ1 B;  3H0L C;  3MNN B;  1M19 C;  1BH9 A;  2YFV A;  1M1A C;  3TU4 B;  5CP6 A;  5DNN B;  3AZF D;  3AZG A;  1BH9 B;  2DQN C;  2YFV B;  4UUZ A;  5AVC D;  2CV5 D;  1HQ3 A;  5CP6 B;  2CWE A;  5AV8 D;  1P3P C;  3AZG B;  1HQ3 B;  5GSU C;  3VH6 A;  3A6N D;  3W96 C;  2JSS A;  3AZF A;  3VH6 T;  3UT9 C;  2BG1 A;  5BS7 C;  3LJA D;  2CV5 A;  5AVC A;  4ZBJ B;  3W99 C;  1P3M B;  4QLC D;  1BH8 A;  2CV5 B;  5AVC B;  4E44 A;  1AOI C;  4NE6 A;  1BH8 B;  3X1S C;  3A6N A;  5B2I D;  3X1U C;  5AV6 C;  1M18 D;  5B0Z A;  3A6N B;  3LJA A;  5GXQ D;  5CPJ D;  1EQZ A;  3VH5 W;  4QLC A;  5B0Z B;  4WZS B;  3AV1 C;  4YM6 A;  1EQZ B;  2Y2J A;  4Z2M G;  4G92 B;  1S32 D;  5B2I A;  4KUD D;  1N1J A;  4YM6 B;  1M18 A;  4X23 D;  1KU5 A;  1P3I C;  5B2I B;  2F8N K;  1N1J B;  5AVB D;  5GXQ A;  5CPJ A;  3AZI B;  5B0Y D;  4J8V D;  3MGP A;  5CPJ B;  5CPI D;  5B2J D;  1P3G C;  3AFA C;  3AYW C;  4KUD A;  3MGP B;  3AZM A;  4H9P A;  3AZE C;  2FJ7 C;  1KX5 C;  1B6W A;  3AZM B;  4H9P B;  5KDM A;  5CPK A;  3B6F C;  5B1L D;  5B33 D;  5B2J A;  5AV5 A;  5BNV A;  5KDM B;  5CPI A;  5CPK B;  3WKJ A;  5B24 D;  5B32 B;  1P3K B;  2ZY4 A;  2JE5 A;  5CPI B;  5AV5 B;  5AV9 D;  3WKJ B;  3H0M C;  2ARO C;  3WTP E;  3C1B C;  1TZY C;  1ZLA C;  1ID3 A;  2ZY3 A;  2Y2N A;  5FUG A;  2F8N G;  1ID3 B;  2YFW A;  4J8U C;  5FUG B;  2VQR A;  2YFW B;  3AZH B;  3REK A;  3A1K A;  5F99 A;  4J8X B;  3O62 B;  4ZUX A;  3REK B;  3MVD C;  5F99 B;  1P3P D;  4ZUX B;  1S32 C;  4G91 C;  1P3L D;  2BYK A;  1H3O A;  4LD9 C;  3REH C;  2XD5 A;  3LEL D;  1M19 A;  3KXB C;  4NE3 A;  3W96 D;  5AVB C;  3X1T C;  1M1A A;  4NFT A;  1M19 B;  1HTA A;  1M1A B;  4JJN D;  1P3P A;  1TAF A;  5B40 C;  1AOI D;  1P3O C;  5GSU A;  1P3P B;  3W98 B;  1Z2C B;  3W96 A;  1TAF B;  3X1U D;  5AV6 D;  5GSU B;  4WU8 B;  4Z66 D;  4H9N B;  3REJ A;  3UT9 A;  3UTB C;  5BS7 A;  3MGQ A;  2F8N D;  3W96 B;  5B1L C;  3W99 A;  2XD1 A;  3REJ B;  5B33 C;  3UT9 B;  3MGQ B;  3MGS C;  3AV1 D;  3AZJ C;  3W99 B;  1AOI A;  5AV9 C;  1PZR A;  3X1S A;  3X1U A;  1P3A D;  3B0C W;  1AOI B;  5AV6 A;  2F8N A;  4EO5 B;  3X1S B;  1P3I D;  5E5A C;  3X1U B;  3V9R A;  5AV6 B;  2Y2H A;  3EPH A;  3AV1 A;  3V9R B;  2W8S A;  3AZL D;  1P3G D;  3AFA D;  2Y2I A;  3FDD A;  3AYW D;  3B0B A;  4Z5T C;  3AZE D;  4H9S C;  2Y2P A;  2FJ7 D;  2HUE C;  1P3I A;  1KX5 D;  1U35 D;  4DRB A;  3B6F D;  2LY8 A;  1A7W A;  4UUZ B;  1P3B C;  1P3L C;  3AFA A;  3AYW A;  4J8W C;  3LEL C;  3AZE A;  5CHL B;  1F1E A;  5B1M C;  1KX5 A;  2ARO D;  3AZE B;  3C1B D;  2JCH A;  1TZY D;  3B6F A;  3LZ0 C;  3AZF B;  5AV8 A;  4JJN C;  1P34 D;  1ZLA D;  4KHA A;  3B6F B;  5AV8 B;  4KHA B;  3NQU A;  4J8U D;  1F66 D;  4Z66 C;  2ARO A;  3NQU B;  3C1B A;  1TZY A;  2F2A C;  4R8P C;  1ZLA A;  2ARO B;  5BT1 D;  3LJA B;  3C1B B;  2BYM A;  3MVD D;  5AY8 C;  1ZLA B;  2ZY2 A;  3KFU G;  4QLC B;  4WU9 C;  2G5I C;  1P3A C;  3VH5 A;  4LD9 D;  2BYM B;  3REH D;  3AZN C;  2NQB C;  3KXB D;  3X1T D;  1M18 B;  3B0D C;  5GXQ B;  3EPK A;  3AZL C;  3MVD A;  4AWL C;  1S32 A;  5B40 D;  5BO0 A;  3MVD B;  4LD9 A;  1P3O D;  4X23 A;  3KXB A;  1S32 B;  4KUD B;  3MNN C;  1U35 C;  5AVB A;  5BO0 B;  3X1T A;  5JRG D;  5G49 A;  4X23 B;  4NE5 A;  3UTB D;  5B0Y A;  4J8V A;  3TU4 C;  3A1I A;  5AVB B;  5DNN C;  3X1T B;  5G49 B;  2ZM5 A;  3WA9 D;  3R45 A;  5B0Y B;  4J8V B;  3MGS D;  3B6G D;  3AZJ D;  5B2J B;  5BNV B;  1P3O A;  3R45 B;  3KWQ C;  3AZK C;  3UTB A;  5E5A D;  1P34 C;  5B1L A;  5B33 A;  2Y2L A;  5B24 A;  3MGS A;  5B1L B;  3UTA C;  3AZJ A;  1P3M C;  5B33 B;  5AV9 A;  4XUJ C;  5B24 B;  3AZJ B;  5B31 C; 
#chains in the Genus database with same CATH homology
 2HIO C;  4Z5T D;  5AV9 B;  5E5A A;  4DQY B;  5BT1 C;  5E5A B;  3W97 D;  1W2E A;  2Y2M A;  1P3B D;  4M6B A;  4J8W D;  2BYK B;  1H3O B;  4H9S A;  1ULY A;  2L5A A;  5B1M D;  1P3F C;  2Y2G A;  2HUE B;  3LZ0 D;  3AZI C;  2IO5 C;  1P3B A;  1P3L A;  1KX3 C;  2FFF B;  3REI D;  4J8W A;  3LEL A;  1P3L B;  1P3B B;  4CSR A;  4YS3 C;  4J8W B;  5JRG C;  3LEL B;  5B1M A;  4KGC C;  4CSR B;  4R8P D;  3REL D;  3LZ0 A;  4JJN A;  4HGA C;  3WA9 C;  3WTP C;  3AN2 D;  3B6G C;  4Z2M H;  2RVQ C;  3LZ0 B;  5AY8 D;  4JJN B;  4WU9 D;  3AZN D;  5B32 C;  4Z66 A;  1P3K C;  2NQB D;  3WAA D;  3X1V C;  4R8P A;  2F8N B;  4WV4 B;  4Z66 B;  5B31 G;  3MGR D;  4UPK A;  1BFM A;  2ZY5 A;  2PYO C;  5AY8 A;  3KUY C;  4WU9 A;  3H0R C;  3AV1 B;  4H9O A;  1P3A A;  5GT3 C;  5AY8 B;  3AZN A;  4H9Q A;  4WU9 B;  4H9O B;  3MNN D;  1P3A B;  3AZN B;  4H9Q B;  3AZH C;  1P3I B;  2Y2K A;  3W97 C;  3TU4 D;  5DNN D;  2RIQ A;  3AZL A;  4J8X C;  1P3G A;  3O62 C;  5CP6 D;  3AZL B;  1P3G B;  3AFA B;  3C1C C;  4ZUX C;  3KWQ D;  4AWL B;  3AYW B;  2FJ7 A;  4XZQ C;  1HQ3 D;  3AZK D;  3MNN A;  1U35 A;  2G5H C;  2FJ7 B;  3EPL A;  3TU4 A;  1KX5 B;  1U35 B;  2F8N H;  5DNN A;  4WJ3 C;  3REI C;  2UWX A;  1P3M D;  3UTA D;  2NZD C;  3KWQ A;  5C3I C;  4XUJ D;  3NQJ A;  3VH6 W;  5B31 D;  3AZK A;  2HIO D;  5GT0 C;  3F6T A;  1KX4 C;  3KWQ B;  3REL C;  3W98 C;  3NQJ B;  3AZK B;  3EG5 B;  4CAY A;  1P34 A;  5DNM C;  3AN2 C;  4WU8 C;  1TZY B;  1R4V A;  1T3U A;  5B32 G;  4CAY B;  5JA4 A;  3UTA A;  1P34 B;  3REJ C;  1P3M A;  5B0Z D;  3MGQ C;  4J8U A;  4XUJ A;  5JA4 B;  1F66 A;  3UTA B;  5B31 A;  2HIO A;  3WAA C;  1EQZ D;  3VH5 T;  4J8U B;  4XUJ B;  1F66 B;  5B31 B;  2HIO B;  4YM6 D;  1P3F D;  4EO5 C;  3MGR C;  3AV2 C;  3AZI D;  1KX3 D;  3LZ1 C;  3REH A;  4G91 B;  4LD9 B;  3REH B;  4YS3 D;  3MGP D;  5BNX A;  1P3F A;  3KXB B;  4KGC D;  5BNX B;  3AZM D;  1P3F B;  3WTP D;  3AZI A;  3P5J B;  5CP6 C;  1KX3 A;  5B40 A;  2RVQ D;  1Q9C A;  4E45 A;  3AZG C;  2IO5 B;  1HQ3 C;  5CPK D;  1KX3 B;  5B40 B;  4YS3 A;  1P3O B;  5B32 D;  5JRG A;  1P3K D;  5AV5 D;  3WKJ D;  3X1V D;  4KGC A;  2DF4 C;  4YS3 B;  5JRG B;  1WWS A;  4DRA A;  3UTB B;  3WTP A;  3WA9 A;  4WNN A;  3B6G A;  4ZBJ C;  4KGC B;  4H9R A;  3AZF C;  2PYO D;  3IP4 C;  4HGA B;  3WA9 B;  3WTP B;  5AVC C;  4WNN B;  3KUY D;  2CV5 C;  3B6G B;  4H9R B;  5GT3 D;  5AV8 C;  1ID3 D;  5B32 A;  1P3K A;  3X1V A;  3A6N C;  3MGS B;  3AZH D;  3X1V B;  2PYO A;  5B0Z C;  4J8X D;  3LJA C;  3O62 D;  3KUY A;  3REK D;  1EQZ C;  5GT3 A;  2PYO B;  4Z5T A;  5F99 D;  4QLC C;  3C1C D;  4G92 C;  4ZUX D;  3KUY B;  4XZQ D;  4YM6 C;  5GT3 B;  4Z5T B;  5B2I C;  3AZH A;  3W97 A;  1M18 C;  1M19 D;  4J8X A;  3O62 A;  1B67 A;  5GXQ C;  1M1A D;  5CPJ C;  3W97 B;  2NZD D;  3C1C A;  3MGP C;  4XZQ A;  5GT0 D;  3C1C B;  1KX4 D;  3W98 D;  4KUD C;  4XZQ B;  5B1M B;  3AZM C;  5DNM D;  5GSU D;  4WU8 D;  4X23 C;  3REI A;  3REJ D;  3UT9 D;  5CPK C;  1WWI A;  3MGQ D;  5B0Y C;  4J8V C;  2NZD A;  3REI B;  3W99 D;  5CPI C;  5B2J C;  5GT0 A;  5AV5 C;  3WKJ C;  2NZD B;  1KX4 A;  3W98 A;  5C3I B;  3REL A;  1JFI A;  1F66 C;  5GT0 B;  5DNM A;  3AN2 A;  4WU8 A;  4H9N A;  3X1S D;  1KX4 B;  4R8P B;  3REL B;  3AV2 D;  3EPJ A;  1JFI B;  3B0C T;  3KSY A;  5DNM B;  3AN2 B;  3LZ1 D;  1ID3 C;  2NQB A;  3WAA A;  3AL0 C;  5B24 C;  2NQB B;  3WAA B;  2Y2O A;  3MGR A;  3AV2 A;  2Y2Q A;  3B0D B;  2J8P A;  3MGR B;  3REK C;  3AV2 B;  3LZ1 A;  5F99 C;  3AZG D;  3LZ1 B;  3H0L C;  3MNN B;  1M19 C;  1BH9 A;  2YFV A;  1M1A C;  3TU4 B;  5CP6 A;  5DNN B;  3AZF D;  3AZG A;  1BH9 B;  2DQN C;  2YFV B;  4UUZ A;  5AVC D;  2CV5 D;  1HQ3 A;  5CP6 B;  2CWE A;  5AV8 D;  1P3P C;  3AZG B;  1HQ3 B;  5GSU C;  3VH6 A;  3A6N D;  3W96 C;  2JSS A;  3AZF A;  3VH6 T;  3UT9 C;  2BG1 A;  5BS7 C;  3LJA D;  2CV5 A;  5AVC A;  4ZBJ B;  3W99 C;  1P3M B;  4QLC D;  1BH8 A;  2CV5 B;  5AVC B;  4E44 A;  1AOI C;  4NE6 A;  1BH8 B;  3X1S C;  3A6N A;  5B2I D;  3X1U C;  5AV6 C;  1M18 D;  5B0Z A;  3A6N B;  3LJA A;  5GXQ D;  5CPJ D;  1EQZ A;  3VH5 W;  4QLC A;  5B0Z B;  4WZS B;  3AV1 C;  4YM6 A;  1EQZ B;  2Y2J A;  4Z2M G;  4G92 B;  1S32 D;  5B2I A;  4KUD D;  1N1J A;  4YM6 B;  1M18 A;  4X23 D;  1KU5 A;  1P3I C;  5B2I B;  2F8N K;  1N1J B;  5AVB D;  5GXQ A;  5CPJ A;  3AZI B;  5B0Y D;  4J8V D;  3MGP A;  5CPJ B;  5CPI D;  5B2J D;  1P3G C;  3AFA C;  3AYW C;  4KUD A;  3MGP B;  3AZM A;  4H9P A;  3AZE C;  2FJ7 C;  1KX5 C;  1B6W A;  3AZM B;  4H9P B;  5KDM A;  5CPK A;  3B6F C;  5B1L D;  5B33 D;  5B2J A;  5AV5 A;  5BNV A;  5KDM B;  5CPI A;  5CPK B;  3WKJ A;  5B24 D;  5B32 B;  1P3K B;  2ZY4 A;  2JE5 A;  5CPI B;  5AV5 B;  5AV9 D;  3WKJ B;  3H0M C;  2ARO C;  3WTP E;  3C1B C;  1TZY C;  1ZLA C;  1ID3 A;  2ZY3 A;  2Y2N A;  5FUG A;  2F8N G;  1ID3 B;  2YFW A;  4J8U C;  5FUG B;  2VQR A;  2YFW B;  3AZH B;  3REK A;  3A1K A;  5F99 A;  4J8X B;  3O62 B;  4ZUX A;  3REK B;  3MVD C;  5F99 B;  1P3P D;  4ZUX B;  1S32 C;  4G91 C;  1P3L D;  2BYK A;  1H3O A;  4LD9 C;  3REH C;  2XD5 A;  3LEL D;  1M19 A;  3KXB C;  4NE3 A;  3W96 D;  5AVB C;  3X1T C;  1M1A A;  4NFT A;  1M19 B;  1HTA A;  1M1A B;  4JJN D;  1P3P A;  1TAF A;  5B40 C;  1AOI D;  1P3O C;  5GSU A;  1P3P B;  3W98 B;  1Z2C B;  3W96 A;  1TAF B;  3X1U D;  5AV6 D;  5GSU B;  4WU8 B;  4Z66 D;  4H9N B;  3REJ A;  3UT9 A;  3UTB C;  5BS7 A;  3MGQ A;  2F8N D;  3W96 B;  5B1L C;  3W99 A;  2XD1 A;  3REJ B;  5B33 C;  3UT9 B;  3MGQ B;  3MGS C;  3AV1 D;  3AZJ C;  3W99 B;  1AOI A;  5AV9 C;  1PZR A;  3X1S A;  3X1U A;  1P3A D;  3B0C W;  1AOI B;  5AV6 A;  2F8N A;  4EO5 B;  3X1S B;  1P3I D;  5E5A C;  3X1U B;  3V9R A;  5AV6 B;  2Y2H A;  3EPH A;  3AV1 A;  3V9R B;  2W8S A;  3AZL D;  1P3G D;  3AFA D;  2Y2I A;  3FDD A;  3AYW D;  3B0B A;  4Z5T C;  3AZE D;  4H9S C;  2Y2P A;  2FJ7 D;  2HUE C;  1P3I A;  1KX5 D;  1U35 D;  4DRB A;  3B6F D;  2LY8 A;  1A7W A;  4UUZ B;  1P3B C;  1P3L C;  3AFA A;  3AYW A;  4J8W C;  3LEL C;  3AZE A;  5CHL B;  1F1E A;  5B1M C;  1KX5 A;  2ARO D;  3AZE B;  3C1B D;  2JCH A;  1TZY D;  3B6F A;  3LZ0 C;  3AZF B;  5AV8 A;  4JJN C;  1P34 D;  1ZLA D;  4KHA A;  3B6F B;  5AV8 B;  4KHA B;  3NQU A;  4J8U D;  1F66 D;  4Z66 C;  2ARO A;  3NQU B;  3C1B A;  1TZY A;  2F2A C;  4R8P C;  1ZLA A;  2ARO B;  5BT1 D;  3LJA B;  3C1B B;  2BYM A;  3MVD D;  5AY8 C;  1ZLA B;  2ZY2 A;  3KFU G;  4QLC B;  4WU9 C;  2G5I C;  1P3A C;  3VH5 A;  4LD9 D;  2BYM B;  3REH D;  3AZN C;  2NQB C;  3KXB D;  3X1T D;  1M18 B;  3B0D C;  5GXQ B;  3EPK A;  3AZL C;  3MVD A;  4AWL C;  1S32 A;  5B40 D;  5BO0 A;  3MVD B;  4LD9 A;  1P3O D;  4X23 A;  3KXB A;  1S32 B;  4KUD B;  3MNN C;  1U35 C;  5AVB A;  5BO0 B;  3X1T A;  5JRG D;  5G49 A;  4X23 B;  4NE5 A;  3UTB D;  5B0Y A;  4J8V A;  3TU4 C;  3A1I A;  5AVB B;  5DNN C;  3X1T B;  5G49 B;  2ZM5 A;  3WA9 D;  3R45 A;  5B0Y B;  4J8V B;  3MGS D;  3B6G D;  3AZJ D;  5B2J B;  5BNV B;  1P3O A;  3R45 B;  3KWQ C;  3AZK C;  3UTB A;  5E5A D;  1P34 C;  5B1L A;  5B33 A;  2Y2L A;  5B24 A;  3MGS A;  5B1L B;  3UTA C;  3AZJ A;  1P3M C;  5B33 B;  5AV9 A;  4XUJ C;  5B24 B;  3AZJ B;  5B31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...