5CPJB

Nucleosome containing methylated sat2r dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags "structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjB00
3MGQA 4NE3A 1BH8B 2BYMB 4Z66A 5CP6C 5B0ZC 3AZEB 3WTPB 4WU8D 3AZJA 2YFVB 3VH5A 1P3OA 3AZNB 5DNMD 3W96B 1TZYD 5B0ZA 4ZUXD 3W99D 3LZ1D 5F99D 4G92C 3AZID 5CPIC 5B32G 5CPKB 3W98D 4WU8B 2LY8A 3AFAA 2NZDB 5B1MC 4H9QA 4KUDB 3AZJB 5B2IC 1P3OB 1P3LD 5B1MA 3X1VD 5CP6B 5BNXA 5GT3C 5DNND 3LJAC 5KDMB 4G92B 1HQ3A 4WNNA 5CPIB 2CWEA 5B2IB 3MNND 3V9RA 5B33C 3X1TD 5BT1C 3AZGA 3B6GC 2PYOD 5GT3B 3LJAB 5B33A 5B31D 3WKJC 4KGCC 4YS3C 1AOIA 4J8WD 3AZKD 3WKJA 4KGCA 3V9RB 4DRAA 1P3IC 5GSUC 1P3MC 4H9SC 4LD9C 5B33B 5GSUA 3UTBA 4HGAC 3B6GB 3WKJB 4KGCB 5FUGB 4YS3B 1N1JA 3AZHC 3AYWD 5B40C 3AZHA 1P3BD 1P3IB 5GSUB 4E44A 1P3MB 4LD9B 5CPJD 4HGAB 3X1SD 4J8VD 3REKD 4XZQC 3NQJA 4YM6D 5B24C 3MGPD 5AV5C 1P3BB 4WU9A 5B32D 5G49B 4CSRA 4XZQA 3AZHB 5AV5A 2F8NH 3REIA 3NQUA 4J8VB 3W97A 5B40B 3X1UC 4J8XD 2AROD 3MGSD 1KX5A 3X1UA 2CV5D 4G91C 2HIOD 5AVCC 4EO5C 4XZQB 5B24B 1EQZD 4H9PA 5AV5B 3NQUB 1HTAA 5B0YC 1S32D 3LZ0C 3UT9C 3X1UB 5B0YA 1ZLAA 3LZ0A 5AVBC 3RELA 3C1CA 5BNVA 4G91B 2HUEC 5AVCB 5AVBA 3O62C 1M1AD 4EO5B 1M18D 5E5AA 4JJNC 5AV6C 5JRGC 4Z5TA 3MGRC 3LZ0B 3LELA 2RVQC 3B0CT 3UT9B 3KXBD 3AZMA 1F66C 3B0BA 4H9OB 5AVBB 3MVDC 3AV2C 2NQBC 2HUEB 4QLCC 3O62B 2F8NA 1JFIA 4JJNB 5AV6B 5JRGB 3UTAA 1P3FC 1P3GC 5AV9C 5GT0D 3REJC 2F8NK 3MGRB 5BS7A 3REHC 3A6ND 1P3GA 3REJA 3AZFA 1F66B 4H9NB 1BH8A 2BYMA 3REHA 3AZEA 3AZLC 3MVDB 3AV2B 4XUJD 2YFVA 5GXQD 1JFIB 3AZNA 2NQBB 4QLCB 3W96A 5DNMC 1P3FB 1P3GB 3VH6A 5AV9B 1TZYC 3REJB 4Z2MH 4ZUXC 3W99C 4WU8A 4XUJB 3LZ1C 5CPKA 5F99C 3REHB 4KUDA 4X23D 4ZUXA 3AZIC 3W98C 3WAAD 5CP6A 3AZLB 3AZIA 1P3LC 3X1VC 3WA9D 5KDMA 5DNMB 1TZYB 5CPIA 4ZUXB 3LZ1B 3W99B 5DNNC 5F99B 1P34D 2YFWB 1WWSA 3AZIB 5B2IA 3KUYD 1TAFB 5DNNA 3W98B 4H9RB 1P3LB 3MNNC 1P34B 3X1VB 3MGQD 5GT3A 3LJAA 4Z66D 5C3IB 3MNNA 3X1TC 2PYOC 5DNNB 5B31C 5B2JD 4J8WC 3AZKC 3AFAD 4J8WA 3AZKA 3MNNB 3B6GA 5B1LD 3VH5W 1P3PD 5FUGA 4YS3A 3X1TB 2PYOB 1KX3C 5B31B 1HQ3D 4J8WB 1P3PB 1P3IA 3AZKB 1BH9B 3AYWC 1P3MA 1KX3D 4H9SA 4LD9A 1P3KD 1P3BC 1P3BA 5G49A 4J8VC 3REKC 3X1SC 5CPJC 3MGPC 4YM6C 1KX3B 3AZGD 4J8VA 5B40A 5B32C 3VH6T 1AOID 3AYWB 4J8XC 2AROC 3MGSC 3AV1D 5B24A 4WZSB 2CV5C 2HIOC 4AWLC 5CPJB 3REKB 3X1SB 3MGPB 4YM6B 2FJ7D 4CAYB 3UTBD 3B0CW 1EQZC 1R4VA 2F8NG 1ULYA 5B32B 1ID3D 4R8PD 1S32C 4J8XB 5AVCA 2AROB 3MGSB 1S32A 2CV5B 2HIOB 4AWLB 1M1AC 1M18C 3TU4D 1EQZB 3UT9A 3C1BC 1H3OB 4WU9D 4H9OA 1S32B 3KXBC 3REID 3O62A 1KX5D 3C1BD 4JJNA 5AV6A 5JRGA 1B67A 1M18B 1M1AB 3MGRA 5GT0C 1F66A 4H9NA 3C1BB 4J8UD 3A6NC 3MVDA 5GT0A 3AV2A 2NQBA 3KXBB 4QLCA 3B0DC 1ZLAD 4KHAB 2BYKB 3RELD 4XUJC 3C1CD 5GXQC 1P3FA 1F1EA 5AY8D 5AV9A 5JA4B 4XUJA 2JSSA 1U35D 5E5AD 1KX4D 5GT0B 4WV4B 1P3AD 4Z5TD 3A6NB 3AZLA 4X23C 3LELD 3B0DB 3AZMD 3WAAC 5GXQB 5DNMA 1TZYA 3LZ1A 3W99A 3WA9C 5F99A 2F8ND 2YFWA 3KWQD 3UTAD 3W98A 1TAFA 4ZBJC 1M19D 4H9RA 1P3OC 1P34C 3B6FD 4X23B 3KUYC 3AN2D 1P3LA 5C3IC 5AV8D 3AZFD 3X1VA 1P34A 3WAAB 3KUYA 3AZED 3WTPD 3B6FB 3AZND 4DRBA 3MGQC 3WA9B 3W96D 4Z66C 3AN2B 4ZBJB 5CPKD 2NZDD 1KU5A 4E45A 5B2JC 1B6WA 3KUYB 4KUDD 4NE5A 3AZJD 1P3OD 5B2JA 3AFAC 4UUZB 5CP6D 5B0ZD 3X1TA 5B1LC 3MGQB 2PYOA 1P3PC 4Z66B 5B31A 3VH6W 5B1LA 1P3PA 5CPID 5B0ZB 1BH9A 5B2JB 5B1MD 1BFMA 4NE6A 1HQ3C 5B2ID 3AFAB 4H9QB 1P3KC 2IO5C 3AZJC 5B1LB 1KX3A 5B1MB 5GT3D 1P3KA 3LJAD 5BNXB 3AZGC 3AYWA 3KSYA 1HQ3B 1AOIC 4WNNB 1P3KB 3AV1C 5CPJA 3REKA 2IO5B 3X1SA 5B33D 3MGPA 4YM6A 5BT1D 4CAYA 3B6GD 3AV1A 5B32A 3WKJD 4KGCD 4YS3D 2FJ7C 3UTBC 3AZGB 4J8XA 1ID3C 2FJ7A 2AROA 4R8PC 3MGSA 1A7WA 1AOIB 1P3ID 5GSUD 1ID3A 2CV5A 4R8PA 2HIOA 1P3MD 3AV1B 4LD9D 1EQZA 3TU4C 1H3OA 2FJ7B 3UTBB 3AZHD 3TU4A 1ID3B 4R8PB 4WU9C 5B40D 1N1JB 3VH5T 3REIC 3W97C 1M18A 1M1AA 1KX5C 4XZQD 5B24D 3C1BA 5AV5D 3TU4B 3W97D 3NQJB 3KXBA 4WU9B 3X1UD 4J8UC 4CSRB 4KHAA 2BYKA 3REIB 4J8UA 3W97B 5AVCD 1ZLAC 5JA4A 1KX5B 3RELC 3C1CC 5AY8C 5B0YD 1U35C 5E5AC 5AY8A 4M6BA 3A6NA 1KX4C 4NFTA 4H9PB 3LZ0D 3UT9D 4J8UB 1U35A 1P3AC 1KX4A 4Z5TC 5AVBD 3LELC 5GXQA 1P3AA 5B0YB 3AZMC 1ZLAB 3O62D 3RELB 3C1CB 5BNVB 1Q9CA 5AY8B 4JJND 5AV6D 5JRGD 1U35B 5E5AB 1KX4B 3MGRD 4X23A 3KWQC 3UTAC 2RVQD 5B31G 1M19C 1P3AB 1F66D 3B6FC 3R45A 4Z5TB 3WTPE 3KWQA 3WAAA 4Z2MG 3LELB 5BS7C 1M19A 3AN2C 3MVDD 3AV2D 5AV8C 2NQBD 3AZFC 3B6FA 3AZMB 4QLCD 3WA9A 3AN2A 3AZEC 5AV8A 3WTPC 5BO0A 3AZNC 1P3FD 3W96C 1P3GD 5AV9D 3REJD 2F8NB 3WTPA 5CHLB 3R45B 3KWQB 3REHD 3UTAB 1M19B 5CPKC 2NZDC 1WWIA 4WU8C 4UUZA 3AZLD 4KUDC 2L5AA 5AV8B 3AZFB 2NZDA 5BO0B
chains in the Genus database with same CATH superfamily
3MGQA 4NE3A 1BH8B 2BYMB 2Y2OA 4Z66A 5CP6C 5B0ZC 4DQYB 3WTPB 3AZEB 3AZJA 2YFVB 3VH5A 4WU8D 3AZNB 5DNMD 1P3OA 3W96B 1TZYD 5B0ZA 4ZUXD 3W99D 3LZ1D 5F99D 4G92C 3AZID 5CPIC 5B32G 5CPKB 3W98D 4WU8B 2LY8A 3AFAA 2NZDB 5B1MC 4H9QA 4KUDB 3AZJB 5B2IC 1P3OB 1P3LD 5B1MA 3X1VD 4WJ3C 5CP6B 3KFUG 5BNXA 5GT3C 5DNND 3LJAC 5KDMB 4G92B 1HQ3A 3H0MC 4WNNA 5CPIB 2CWEA 5B2IB 3MNND 3V9RA 5B33C 3X1TD 5BT1C 3AZGA 3B6GC 2PYOD 2Y2MA 5GT3B 3LJAB 5B33A 5B31D 3WKJC 4KGCC 4YS3C 1AOIA 4J8WD 3AZKD 3WKJA 4KGCA 3V9RB 4DRAA 1P3IC 5GSUC 1P3MC 4H9SC 4LD9C 5B33B 5GSUA 3UTBA 4HGAC 3B6GB 1W2EA 3WKJB 4KGCB 5FUGB 4YS3B 2J8PA 1N1JA 3AZHC 2FFFB 3AYWD 5B40C 3AZHA 1P3BD 1P3IB 5GSUB 4E44A 2G5HC 1P3MB 4LD9B 5CPJD 4HGAB 3X1SD 4J8VD 3REKD 4XZQC 3NQJA 4YM6D 5B24C 3MGPD 5AV5C 1P3BB 4WU9A 5B32D 5G49B 4CSRA 4XZQA 3AZHB 5AV5A 2F8NH 3REIA 3NQUA 4J8VB 3W97A 1PZRA 5B40B 3X1UC 4J8XD 2AROD 3MGSD 1KX5A 3X1UA 2CV5D 4G91C 2HIOD 5AVCC 4EO5C 4XZQB 5B24B 1EQZD 4H9PA 5AV5B 3NQUB 1HTAA 5B0YC 1S32D 3LZ0C 3UT9C 3X1UB 5B0YA 1ZLAA 3LZ0A 5AVBC 3RELA 3C1CA 5BNVA 4G91B 2HUEC 5AVCB 5AVBA 3O62C 1M1AD 4EO5B 1M18D 5E5AA 3EPHA 4JJNC 5AV6C 5JRGC 4Z5TA 3MGRC 3LZ0B 3LELA 3B0CT 2RVQC 3UT9B 3KXBD 3AZMA 1F66C 2Y2IA 3B0BA 4H9OB 5AVBB 3MVDC 3AV2C 2NQBC 2HUEB 4QLCC 3O62B 2F8NA 3H0LC 1JFIA 4JJNB 5AV6B 5JRGB 3UTAA 1P3FC 1P3GC 5AV9C 5GT0D 3REJC 2F8NK 3MGRB 5BS7A 3REHC 3A6ND 1P3GA 3REJA 3AZFA 1F66B 4H9NB 1BH8A 2BYMA 3REHA 3AZEA 3EPKA 3MVDB 3AZLC 4XUJD 2YFVA 5GXQD 3AV2B 3AZNA 1JFIB 2NQBB 4QLCB 3W96A 5DNMC 1P3FB 1P3GB 3VH6A 5AV9B 1TZYC 3REJB 4Z2MH 4ZUXC 3W99C 4WU8A 4XUJB 3LZ1C 5CPKA 5F99C 3REHB 4KUDA 4X23D 4ZUXA 3AZIC 3W98C 2Y2LA 2XD5A 3WAAD 5CP6A 3AZLB 3AZIA 1Z2CB 1P3LC 3X1VC 3WA9D 5KDMA 5DNMB 2ZY5A 1TZYB 5CPIA 4ZUXB 3LZ1B 3W99B 5DNNC 5F99B 1P34D 2YFWB 1WWSA 3AZIB 5B2IA 3KUYD 1TAFB 5DNNA 3W98B 4H9RB 3FDDA 1P3LB 3MNNC 1P34B 2Y2HA 3X1VB 3MGQD 5GT3A 3LJAA 4Z66D 5C3IB 3MNNA 3X1TC 2PYOC 3H0RC 5DNNB 5B31C 5B2JD 4J8WC 3AZKC 3AFAD 3P5JB 4J8WA 3AZKA 3MNNB 3B6GA 5B1LD 3VH5W 1P3PD 5FUGA 4YS3A 3A1IA 3X1TB 2PYOB 1KX3C 5B31B 2JCHA 1HQ3D 4J8WB 1P3PB 1P3IA 3AZKB 1BH9B 3AYWC 1P3MA 1KX3D 4H9SA 4LD9A 1P3KD 1P3BC 1P3BA 5G49A 4J8VC 3REKC 3X1SC 5CPJC 3MGPC 4YM6C 1KX3B 3AZGD 4J8VA 5B40A 5B32C 2W8SA 3VH6T 1AOID 3AYWB 2JE5A 4J8XC 2AROC 3MGSC 3AV1D 5B24A 4WZSB 2CV5C 2HIOC 4AWLC 5CPJB 3REKB 3X1SB 3MGPB 4YM6B 2FJ7D 4CAYB 3UTBD 3B0CW 1EQZC 1R4VA 2F8NG 1ULYA 5B32B 1ID3D 4R8PD 1S32C 4J8XB 5AVCA 2AROB 3MGSB 1S32A 2CV5B 2HIOB 4AWLB 1M1AC 1M18C 3TU4D 1EQZB 3UT9A 3C1BC 1H3OB 4WU9D 4H9OA 3IP4C 1S32B 3KXBC 3REID 3O62A 1KX5D 3C1BD 4JJNA 5AV6A 5JRGA 1B67A 1M18B 1M1AB 3MGRA 5GT0C 1F66A 4H9NA 3C1BB 4J8UD 3A6NC 3MVDA 5GT0A 3AV2A 2NQBA 3KXBB 4QLCA 3B0DC 1ZLAD 4KHAB 2BYKB 3RELD 4XUJC 3C1CD 5GXQC 1P3FA 1F1EA 2Y2NA 5AY8D 5AV9A 5JA4B 4XUJA 2JSSA 1U35D 5E5AD 1KX4D 5GT0B 4WV4B 2BG1A 1P3AD 2UWXA 4Z5TD 3A6NB 3AZLA 4X23C 3LELD 2Y2PA 3B0DB 3AZMD 3WAAC 5GXQB 5DNMA 1TZYA 3LZ1A 3W99A 3WA9C 5F99A 2F8ND 2YFWA 3KWQD 3UTAD 3W98A 1TAFA 4ZBJC 1M19D 4H9RA 1P3OC 1P34C 3B6FD 2F2AC 4X23B 3KUYC 3AN2D 1P3LA 5C3IC 5AV8D 3AZFD 3X1VA 1P34A 3WAAB 3KUYA 3AZED 3WTPD 3B6FB 3AZND 4DRBA 3MGQC 3WA9B 3W96D 4Z66C 3AN2B 4ZBJB 5CPKD 4UPKA 2NZDD 1KU5A 4E45A 5B2JC 1B6WA 3KUYB 4KUDD 2Y2QA 4NE5A 2ZM5A 3EPJA 3AZJD 1P3OD 5B2JA 3AFAC 4UUZB 5CP6D 5B0ZD 3X1TA 5B1LC 3MGQB 2PYOA 1P3PC 4Z66B 5B31A 3VH6W 5B1LA 1P3PA 3AL0C 5CPID 5B0ZB 1BH9A 5B2JB 5B1MD 1BFMA 3A1KA 1HQ3C 4NE6A 3EPLA 5B2ID 3AFAB 4H9QB 1P3KC 2IO5C 3AZJC 5B1LB 1KX3A 5B1MB 5GT3D 1P3KA 3LJAD 3F6TA 5BNXB 3AZGC 3AYWA 3KSYA 1HQ3B 1AOIC 4WNNB 2XD1A 1P3KB 3AV1C 5CPJA 3REKA 2IO5B 3X1SA 5B33D 2RIQA 4YM6A 5BT1D 4CAYA 3MGPA 3B6GD 3AV1A 5B32A 3WKJD 4KGCD 4YS3D 2FJ7C 3UTBC 3AZGB 4J8XA 1ID3C 2FJ7A 2AROA 4R8PC 3MGSA 1A7WA 1AOIB 1P3ID 5GSUD 2ZY2A 1ID3A 3EG5B 4R8PA 2HIOA 2CV5A 2Y2KA 1P3MD 3AV1B 4LD9D 2Y2GA 1EQZA 3TU4C 1H3OA 2FJ7B 3UTBB 3AZHD 3TU4A 1ID3B 4R8PB 4WU9C 5B40D 1N1JB 3VH5T 3REIC 2ZY4A 3W97C 1M18A 1M1AA 2G5IC 1KX5C 4XZQD 5B24D 3C1BA 5AV5D 3TU4B 3W97D 3NQJB 3KXBA 4WU9B 3X1UD 4J8UC 2DQNC 4CSRB 4KHAA 2BYKA 3REIB 4J8UA 3W97B 5AVCD 1ZLAC 5JA4A 1KX5B 3RELC 3C1CC 5AY8C 2DF4C 5B0YD 1U35C 5E5AC 5AY8A 4M6BA 3A6NA 1KX4C 4NFTA 4H9PB 3LZ0D 3UT9D 4J8UB 1U35A 1P3AC 1KX4A 4Z5TC 5AVBD 3LELC 5GXQA 1P3AA 5B0YB 3AZMC 1ZLAB 3O62D 3RELB 3C1CB 5BNVB 1Q9CA 5AY8B 4JJND 5AV6D 5JRGD 2ZY3A 1U35B 5E5AB 1KX4B 3MGRD 4X23A 3KWQC 3UTAC 2RVQD 5B31G 1M19C 1P3AB 1F66D 1T3UA 3R45A 4Z5TB 3WTPE 3KWQA 3B6FC 4Z2MG 3WAAA 3LELB 5BS7C 1M19A 3AN2C 3MVDD 3AV2D 5AV8C 2NQBD 3AZFC 3B6FA 3AZMB 4QLCD 3WA9A 3AN2A 3AZEC 5AV8A 3WTPC 5BO0A 2VQRA 3AZNC 1P3FD 3W96C 1P3GD 5AV9D 2Y2JA 3REJD 2F8NB 3WTPA 5CHLB 3R45B 3KWQB 3REHD 3UTAB 1M19B 5CPKC 2NZDC 1WWIA 4WU8C 4UUZA 3AZLD 4KUDC 2L5AA 5AV8B 3AZFB 2NZDA 5BO0B
chains in the Genus database with same CATH topology
3MGQA 4NE3A 1BH8B 2BYMB 2Y2OA 4Z66A 5CP6C 5B0ZC 4DQYB 3WTPB 3AZEB 3AZJA 2YFVB 3VH5A 4WU8D 3AZNB 5DNMD 1P3OA 3W96B 1TZYD 5B0ZA 4ZUXD 3W99D 3LZ1D 5F99D 4G92C 3AZID 5CPIC 5B32G 5CPKB 3W98D 4WU8B 2LY8A 3AFAA 2NZDB 5B1MC 4H9QA 4KUDB 3AZJB 5B2IC 1P3OB 1P3LD 5B1MA 3X1VD 4WJ3C 5CP6B 3KFUG 5BNXA 5GT3C 5DNND 3LJAC 5KDMB 4G92B 1HQ3A 3H0MC 4WNNA 5CPIB 2CWEA 5B2IB 3MNND 3V9RA 5B33C 3X1TD 5BT1C 3AZGA 3B6GC 2PYOD 2Y2MA 5GT3B 3LJAB 5B33A 5B31D 3WKJC 4KGCC 4YS3C 1AOIA 4J8WD 3AZKD 3WKJA 4KGCA 3V9RB 4DRAA 1P3IC 5GSUC 1P3MC 4H9SC 4LD9C 5B33B 5GSUA 3UTBA 4HGAC 3B6GB 1W2EA 3WKJB 4KGCB 5FUGB 4YS3B 2J8PA 1N1JA 3AZHC 2FFFB 3AYWD 5B40C 3AZHA 1P3BD 1P3IB 5GSUB 4E44A 2G5HC 1P3MB 4LD9B 5CPJD 4HGAB 3X1SD 4J8VD 3REKD 4XZQC 3NQJA 4YM6D 5B24C 3MGPD 5AV5C 1P3BB 4WU9A 5B32D 5G49B 4CSRA 4XZQA 3AZHB 5AV5A 2F8NH 3REIA 3NQUA 4J8VB 3W97A 1PZRA 5B40B 3X1UC 4J8XD 2AROD 3MGSD 1KX5A 3X1UA 2CV5D 4G91C 2HIOD 5AVCC 4EO5C 4XZQB 5B24B 1EQZD 4H9PA 5AV5B 3NQUB 1HTAA 5B0YC 1S32D 3LZ0C 3UT9C 3X1UB 5B0YA 1ZLAA 3LZ0A 5AVBC 3RELA 3C1CA 5BNVA 4G91B 2HUEC 5AVCB 5AVBA 3O62C 1M1AD 4EO5B 1M18D 5E5AA 3EPHA 4JJNC 5AV6C 5JRGC 4Z5TA 3MGRC 3LZ0B 3LELA 3B0CT 2RVQC 3UT9B 3KXBD 3AZMA 1F66C 2Y2IA 3B0BA 4H9OB 5AVBB 3MVDC 3AV2C 2NQBC 2HUEB 4QLCC 3O62B 2F8NA 3H0LC 1JFIA 4JJNB 5AV6B 5JRGB 3UTAA 1P3FC 1P3GC 5AV9C 5GT0D 3REJC 2F8NK 3MGRB 5BS7A 3REHC 3A6ND 1P3GA 3REJA 3AZFA 1F66B 4H9NB 1BH8A 2BYMA 3REHA 3AZEA 3EPKA 3MVDB 3AZLC 4XUJD 2YFVA 5GXQD 3AV2B 3AZNA 1JFIB 2NQBB 4QLCB 3W96A 5DNMC 1P3FB 1P3GB 3VH6A 5AV9B 1TZYC 3REJB 4Z2MH 4ZUXC 3W99C 4WU8A 4XUJB 3LZ1C 5CPKA 5F99C 3REHB 4KUDA 4X23D 4ZUXA 3AZIC 3W98C 2Y2LA 2XD5A 3WAAD 5CP6A 3AZLB 3AZIA 1Z2CB 1P3LC 3X1VC 3WA9D 5KDMA 5DNMB 2ZY5A 1TZYB 5CPIA 4ZUXB 3LZ1B 3W99B 5DNNC 5F99B 1P34D 2YFWB 1WWSA 3AZIB 5B2IA 3KUYD 1TAFB 5DNNA 3W98B 4H9RB 3FDDA 1P3LB 3MNNC 1P34B 2Y2HA 3X1VB 3MGQD 5GT3A 3LJAA 4Z66D 5C3IB 3MNNA 3X1TC 2PYOC 3H0RC 5DNNB 5B31C 5B2JD 4J8WC 3AZKC 3AFAD 3P5JB 4J8WA 3AZKA 3MNNB 3B6GA 5B1LD 3VH5W 1P3PD 5FUGA 4YS3A 3A1IA 3X1TB 2PYOB 1KX3C 5B31B 2JCHA 1HQ3D 4J8WB 1P3PB 1P3IA 3AZKB 1BH9B 3AYWC 1P3MA 1KX3D 4H9SA 4LD9A 1P3KD 1P3BC 1P3BA 5G49A 4J8VC 3REKC 3X1SC 5CPJC 3MGPC 4YM6C 1KX3B 3AZGD 4J8VA 5B40A 5B32C 2W8SA 3VH6T 1AOID 3AYWB 2JE5A 4J8XC 2AROC 3MGSC 3AV1D 5B24A 4WZSB 2CV5C 2HIOC 4AWLC 5CPJB 3REKB 3X1SB 3MGPB 4YM6B 2FJ7D 4CAYB 3UTBD 3B0CW 1EQZC 1R4VA 2F8NG 1ULYA 5B32B 1ID3D 4R8PD 1S32C 4J8XB 5AVCA 2AROB 3MGSB 1S32A 2CV5B 2HIOB 4AWLB 1M1AC 1M18C 3TU4D 1EQZB 3UT9A 3C1BC 1H3OB 4WU9D 4H9OA 3IP4C 1S32B 3KXBC 3REID 3O62A 1KX5D 3C1BD 4JJNA 5AV6A 5JRGA 1B67A 1M18B 1M1AB 3MGRA 5GT0C 1F66A 4H9NA 3C1BB 4J8UD 3A6NC 3MVDA 5GT0A 3AV2A 2NQBA 3KXBB 4QLCA 3B0DC 1ZLAD 4KHAB 2BYKB 3RELD 4XUJC 3C1CD 5GXQC 1P3FA 1F1EA 2Y2NA 5AY8D 5AV9A 5JA4B 4XUJA 2JSSA 1U35D 5E5AD 1KX4D 5GT0B 4WV4B 2BG1A 1P3AD 2UWXA 4Z5TD 3A6NB 3AZLA 4X23C 3LELD 2Y2PA 3B0DB 3AZMD 3WAAC 5GXQB 5DNMA 1TZYA 3LZ1A 3W99A 3WA9C 5F99A 2F8ND 2YFWA 3KWQD 3UTAD 3W98A 1TAFA 4ZBJC 1M19D 4H9RA 1P3OC 1P34C 3B6FD 2F2AC 4X23B 3KUYC 3AN2D 1P3LA 5C3IC 5AV8D 3AZFD 3X1VA 1P34A 3WAAB 3KUYA 3AZED 3WTPD 3B6FB 3AZND 4DRBA 3MGQC 3WA9B 3W96D 4Z66C 3AN2B 4ZBJB 5CPKD 4UPKA 2NZDD 1KU5A 4E45A 5B2JC 1B6WA 3KUYB 4KUDD 2Y2QA 4NE5A 2ZM5A 3EPJA 3AZJD 1P3OD 5B2JA 3AFAC 4UUZB 5CP6D 5B0ZD 3X1TA 5B1LC 3MGQB 2PYOA 1P3PC 4Z66B 5B31A 3VH6W 5B1LA 1P3PA 3AL0C 5CPID 5B0ZB 1BH9A 5B2JB 5B1MD 1BFMA 3A1KA 1HQ3C 4NE6A 3EPLA 5B2ID 3AFAB 4H9QB 1P3KC 2IO5C 3AZJC 5B1LB 1KX3A 5B1MB 5GT3D 1P3KA 3LJAD 3F6TA 5BNXB 3AZGC 3AYWA 3KSYA 1HQ3B 1AOIC 4WNNB 2XD1A 1P3KB 3AV1C 5CPJA 3REKA 2IO5B 3X1SA 5B33D 2RIQA 4YM6A 5BT1D 4CAYA 3MGPA 3B6GD 3AV1A 5B32A 3WKJD 4KGCD 4YS3D 2FJ7C 3UTBC 3AZGB 4J8XA 1ID3C 2FJ7A 2AROA 4R8PC 3MGSA 1A7WA 1AOIB 1P3ID 5GSUD 2ZY2A 1ID3A 3EG5B 4R8PA 2HIOA 2CV5A 2Y2KA 1P3MD 3AV1B 4LD9D 2Y2GA 1EQZA 3TU4C 1H3OA 2FJ7B 3UTBB 3AZHD 3TU4A 1ID3B 4R8PB 4WU9C 5B40D 1N1JB 3VH5T 3REIC 2ZY4A 3W97C 1M18A 1M1AA 2G5IC 1KX5C 4XZQD 5B24D 3C1BA 5AV5D 3TU4B 3W97D 3NQJB 3KXBA 4WU9B 3X1UD 4J8UC 2DQNC 4CSRB 4KHAA 2BYKA 3REIB 4J8UA 3W97B 5AVCD 1ZLAC 5JA4A 1KX5B 3RELC 3C1CC 5AY8C 2DF4C 5B0YD 1U35C 5E5AC 5AY8A 4M6BA 3A6NA 1KX4C 4NFTA 4H9PB 3LZ0D 3UT9D 4J8UB 1U35A 1P3AC 1KX4A 4Z5TC 5AVBD 3LELC 5GXQA 1P3AA 5B0YB 3AZMC 1ZLAB 3O62D 3RELB 3C1CB 5BNVB 1Q9CA 5AY8B 4JJND 5AV6D 5JRGD 2ZY3A 1U35B 5E5AB 1KX4B 3MGRD 4X23A 3KWQC 3UTAC 2RVQD 5B31G 1M19C 1P3AB 1F66D 1T3UA 3R45A 4Z5TB 3WTPE 3KWQA 3B6FC 4Z2MG 3WAAA 3LELB 5BS7C 1M19A 3AN2C 3MVDD 3AV2D 5AV8C 2NQBD 3AZFC 3B6FA 3AZMB 4QLCD 3WA9A 3AN2A 3AZEC 5AV8A 3WTPC 5BO0A 2VQRA 3AZNC 1P3FD 3W96C 1P3GD 5AV9D 2Y2JA 3REJD 2F8NB 3WTPA 5CHLB 3R45B 3KWQB 3REHD 3UTAB 1M19B 5CPKC 2NZDC 1WWIA 4WU8C 4UUZA 3AZLD 4KUDC 2L5AA 5AV8B 3AZFB 2NZDA 5BO0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ A;  4NE3 A;  1BH8 B;  2BYM B;  4Z66 A;  5CP6 C;  5B0Z C;  3AZE B;  3WTP B;  4WU8 D;  3AZJ A;  2YFV B;  3VH5 A;  1P3O A;  3AZN B;  5DNM D;  3W96 B;  1TZY D;  5B0Z A;  4ZUX D;  3W99 D;  3LZ1 D;  5F99 D;  4G92 C;  3AZI D;  5CPI C;  5B32 G;  5CPK B;  3W98 D;  4WU8 B;  2LY8 A;  3AFA A;  2NZD B;  5B1M C;  4H9Q A;  4KUD B;  3AZJ B;  5B2I C;  1P3O B;  1P3L D;  5B1M A;  3X1V D;  5CP6 B;  5BNX A;  5GT3 C;  5DNN D;  3LJA C;  5KDM B;  4G92 B;  1HQ3 A;  4WNN A;  5CPI B;  2CWE A;  5B2I B;  3MNN D;  3V9R A;  5B33 C;  3X1T D;  5BT1 C;  3AZG A;  3B6G C;  2PYO D;  5GT3 B;  3LJA B;  5B33 A;  5B31 D;  3WKJ C;  4KGC C;  4YS3 C;  1AOI A;  4J8W D;  3AZK D;  3WKJ A;  4KGC A;  3V9R B;  4DRA A;  1P3I C;  5GSU C;  1P3M C;  4H9S C;  4LD9 C;  5B33 B;  5GSU A;  3UTB A;  4HGA C;  3B6G B;  3WKJ B;  4KGC B;  5FUG B;  4YS3 B;  1N1J A;  3AZH C;  3AYW D;  5B40 C;  3AZH A;  1P3B D;  1P3I B;  5GSU B;  4E44 A;  1P3M B;  4LD9 B;  5CPJ D;  4HGA B;  3X1S D;  4J8V D;  3REK D;  4XZQ C;  3NQJ A;  4YM6 D;  5B24 C;  3MGP D;  5AV5 C;  1P3B B;  4WU9 A;  5B32 D;  5G49 B;  4CSR A;  4XZQ A;  3AZH B;  5AV5 A;  2F8N H;  3REI A;  3NQU A;  4J8V B;  3W97 A;  5B40 B;  3X1U C;  4J8X D;  2ARO D;  3MGS D;  1KX5 A;  3X1U A;  2CV5 D;  4G91 C;  2HIO D;  5AVC C;  4EO5 C;  4XZQ B;  5B24 B;  1EQZ D;  4H9P A;  5AV5 B;  3NQU B;  1HTA A;  5B0Y C;  1S32 D;  3LZ0 C;  3UT9 C;  3X1U B;  5B0Y A;  1ZLA A;  3LZ0 A;  5AVB C;  3REL A;  3C1C A;  5BNV A;  4G91 B;  2HUE C;  5AVC B;  5AVB A;  3O62 C;  1M1A D;  4EO5 B;  1M18 D;  5E5A A;  4JJN C;  5AV6 C;  5JRG C;  4Z5T A;  3MGR C;  3LZ0 B;  3LEL A;  2RVQ C;  3B0C T;  3UT9 B;  3KXB D;  3AZM A;  1F66 C;  3B0B A;  4H9O B;  5AVB B;  3MVD C;  3AV2 C;  2NQB C;  2HUE B;  4QLC C;  3O62 B;  2F8N A;  1JFI A;  4JJN B;  5AV6 B;  5JRG B;  3UTA A;  1P3F C;  1P3G C;  5AV9 C;  5GT0 D;  3REJ C;  2F8N K;  3MGR B;  5BS7 A;  3REH C;  3A6N D;  1P3G A;  3REJ A;  3AZF A;  1F66 B;  4H9N B;  1BH8 A;  2BYM A;  3REH A;  3AZE A;  3AZL C;  3MVD B;  3AV2 B;  4XUJ D;  2YFV A;  5GXQ D;  1JFI B;  3AZN A;  2NQB B;  4QLC B;  3W96 A;  5DNM C;  1P3F B;  1P3G B;  3VH6 A;  5AV9 B;  1TZY C;  3REJ B;  4Z2M H;  4ZUX C;  3W99 C;  4WU8 A;  4XUJ B;  3LZ1 C;  5CPK A;  5F99 C;  3REH B;  4KUD A;  4X23 D;  4ZUX A;  3AZI C;  3W98 C;  3WAA D;  5CP6 A;  3AZL B;  3AZI A;  1P3L C;  3X1V C;  3WA9 D;  5KDM A;  5DNM B;  1TZY B;  5CPI A;  4ZUX B;  3LZ1 B;  3W99 B;  5DNN C;  5F99 B;  1P34 D;  2YFW B;  1WWS A;  3AZI B;  5B2I A;  3KUY D;  1TAF B;  5DNN A;  3W98 B;  4H9R B;  1P3L B;  3MNN C;  1P34 B;  3X1V B;  3MGQ D;  5GT3 A;  3LJA A;  4Z66 D;  5C3I B;  3MNN A;  3X1T C;  2PYO C;  5DNN B;  5B31 C;  5B2J D;  4J8W C;  3AZK C;  3AFA D;  4J8W A;  3AZK A;  3MNN B;  3B6G A;  5B1L D;  3VH5 W;  1P3P D;  5FUG A;  4YS3 A;  3X1T B;  2PYO B;  1KX3 C;  5B31 B;  1HQ3 D;  4J8W B;  1P3P B;  1P3I A;  3AZK B;  1BH9 B;  3AYW C;  1P3M A;  1KX3 D;  4H9S A;  4LD9 A;  1P3K D;  1P3B C;  1P3B A;  5G49 A;  4J8V C;  3REK C;  3X1S C;  5CPJ C;  3MGP C;  4YM6 C;  1KX3 B;  3AZG D;  4J8V A;  5B40 A;  5B32 C;  3VH6 T;  1AOI D;  3AYW B;  4J8X C;  2ARO C;  3MGS C;  3AV1 D;  5B24 A;  4WZS B;  2CV5 C;  2HIO C;  4AWL C;  5CPJ B;  3REK B;  3X1S B;  3MGP B;  4YM6 B;  2FJ7 D;  4CAY B;  3UTB D;  3B0C W;  1EQZ C;  1R4V A;  2F8N G;  1ULY A;  5B32 B;  1ID3 D;  4R8P D;  1S32 C;  4J8X B;  5AVC A;  2ARO B;  3MGS B;  1S32 A;  2CV5 B;  2HIO B;  4AWL B;  1M1A C;  1M18 C;  3TU4 D;  1EQZ B;  3UT9 A;  3C1B C;  1H3O B;  4WU9 D;  4H9O A;  1S32 B;  3KXB C;  3REI D;  3O62 A;  1KX5 D;  3C1B D;  4JJN A;  5AV6 A;  5JRG A;  1B67 A;  1M18 B;  1M1A B;  3MGR A;  5GT0 C;  1F66 A;  4H9N A;  3C1B B;  4J8U D;  3A6N C;  3MVD A;  5GT0 A;  3AV2 A;  2NQB A;  3KXB B;  4QLC A;  3B0D C;  1ZLA D;  4KHA B;  2BYK B;  3REL D;  4XUJ C;  3C1C D;  5GXQ C;  1P3F A;  1F1E A;  5AY8 D;  5AV9 A;  5JA4 B;  4XUJ A;  2JSS A;  1U35 D;  5E5A D;  1KX4 D;  5GT0 B;  4WV4 B;  1P3A D;  4Z5T D;  3A6N B;  3AZL A;  4X23 C;  3LEL D;  3B0D B;  3AZM D;  3WAA C;  5GXQ B;  5DNM A;  1TZY A;  3LZ1 A;  3W99 A;  3WA9 C;  5F99 A;  2F8N D;  2YFW A;  3KWQ D;  3UTA D;  3W98 A;  1TAF A;  4ZBJ C;  1M19 D;  4H9R A;  1P3O C;  1P34 C;  3B6F D;  4X23 B;  3KUY C;  3AN2 D;  1P3L A;  5C3I C;  5AV8 D;  3AZF D;  3X1V A;  1P34 A;  3WAA B;  3KUY A;  3AZE D;  3WTP D;  3B6F B;  3AZN D;  4DRB A;  3MGQ C;  3WA9 B;  3W96 D;  4Z66 C;  3AN2 B;  4ZBJ B;  5CPK D;  2NZD D;  1KU5 A;  4E45 A;  5B2J C;  1B6W A;  3KUY B;  4KUD D;  4NE5 A;  3AZJ D;  1P3O D;  5B2J A;  3AFA C;  4UUZ B;  5CP6 D;  5B0Z D;  3X1T A;  5B1L C;  3MGQ B;  2PYO A;  1P3P C;  4Z66 B;  5B31 A;  3VH6 W;  5B1L A;  1P3P A;  5CPI D;  5B0Z B;  1BH9 A;  5B2J B;  5B1M D;  1BFM A;  4NE6 A;  1HQ3 C;  5B2I D;  3AFA B;  4H9Q B;  1P3K C;  2IO5 C;  3AZJ C;  5B1L B;  1KX3 A;  5B1M B;  5GT3 D;  1P3K A;  3LJA D;  5BNX B;  3AZG C;  3AYW A;  3KSY A;  1HQ3 B;  1AOI C;  4WNN B;  1P3K B;  3AV1 C;  5CPJ A;  3REK A;  2IO5 B;  3X1S A;  5B33 D;  3MGP A;  4YM6 A;  5BT1 D;  4CAY A;  3B6G D;  3AV1 A;  5B32 A;  3WKJ D;  4KGC D;  4YS3 D;  2FJ7 C;  3UTB C;  3AZG B;  4J8X A;  1ID3 C;  2FJ7 A;  2ARO A;  4R8P C;  3MGS A;  1A7W A;  1AOI B;  1P3I D;  5GSU D;  1ID3 A;  2CV5 A;  4R8P A;  2HIO A;  1P3M D;  3AV1 B;  4LD9 D;  1EQZ A;  3TU4 C;  1H3O A;  2FJ7 B;  3UTB B;  3AZH D;  3TU4 A;  1ID3 B;  4R8P B;  4WU9 C;  5B40 D;  1N1J B;  3VH5 T;  3REI C;  3W97 C;  1M18 A;  1M1A A;  1KX5 C;  4XZQ D;  5B24 D;  3C1B A;  5AV5 D;  3TU4 B;  3W97 D;  3NQJ B;  3KXB A;  4WU9 B;  3X1U D;  4J8U C;  4CSR B;  4KHA A;  2BYK A;  3REI B;  4J8U A;  3W97 B;  5AVC D;  1ZLA C;  5JA4 A;  1KX5 B;  3REL C;  3C1C C;  5AY8 C;  5B0Y D;  1U35 C;  5E5A C;  5AY8 A;  4M6B A;  3A6N A;  1KX4 C;  4NFT A;  4H9P B;  3LZ0 D;  3UT9 D;  4J8U B;  1U35 A;  1P3A C;  1KX4 A;  4Z5T C;  5AVB D;  3LEL C;  5GXQ A;  1P3A A;  5B0Y B;  3AZM C;  1ZLA B;  3O62 D;  3REL B;  3C1C B;  5BNV B;  1Q9C A;  5AY8 B;  4JJN D;  5AV6 D;  5JRG D;  1U35 B;  5E5A B;  1KX4 B;  3MGR D;  4X23 A;  3KWQ C;  3UTA C;  2RVQ D;  5B31 G;  1M19 C;  1P3A B;  1F66 D;  3B6F C;  3R45 A;  4Z5T B;  3WTP E;  3KWQ A;  3WAA A;  4Z2M G;  3LEL B;  5BS7 C;  1M19 A;  3AN2 C;  3MVD D;  3AV2 D;  5AV8 C;  2NQB D;  3AZF C;  3B6F A;  3AZM B;  4QLC D;  3WA9 A;  3AN2 A;  3AZE C;  5AV8 A;  3WTP C;  5BO0 A;  3AZN C;  1P3F D;  3W96 C;  1P3G D;  5AV9 D;  3REJ D;  2F8N B;  3WTP A;  5CHL B;  3R45 B;  3KWQ B;  3REH D;  3UTA B;  1M19 B;  5CPK C;  2NZD C;  1WWI A;  4WU8 C;  4UUZ A;  3AZL D;  4KUD C;  2L5A A;  5AV8 B;  3AZF B;  2NZD A;  5BO0 B; 
#chains in the Genus database with same CATH topology
 3MGQ A;  4NE3 A;  1BH8 B;  2BYM B;  2Y2O A;  4Z66 A;  5CP6 C;  5B0Z C;  4DQY B;  3WTP B;  3AZE B;  3AZJ A;  2YFV B;  3VH5 A;  4WU8 D;  3AZN B;  5DNM D;  1P3O A;  3W96 B;  1TZY D;  5B0Z A;  4ZUX D;  3W99 D;  3LZ1 D;  5F99 D;  4G92 C;  3AZI D;  5CPI C;  5B32 G;  5CPK B;  3W98 D;  4WU8 B;  2LY8 A;  3AFA A;  2NZD B;  5B1M C;  4H9Q A;  4KUD B;  3AZJ B;  5B2I C;  1P3O B;  1P3L D;  5B1M A;  3X1V D;  4WJ3 C;  5CP6 B;  3KFU G;  5BNX A;  5GT3 C;  5DNN D;  3LJA C;  5KDM B;  4G92 B;  1HQ3 A;  3H0M C;  4WNN A;  5CPI B;  2CWE A;  5B2I B;  3MNN D;  3V9R A;  5B33 C;  3X1T D;  5BT1 C;  3AZG A;  3B6G C;  2PYO D;  2Y2M A;  5GT3 B;  3LJA B;  5B33 A;  5B31 D;  3WKJ C;  4KGC C;  4YS3 C;  1AOI A;  4J8W D;  3AZK D;  3WKJ A;  4KGC A;  3V9R B;  4DRA A;  1P3I C;  5GSU C;  1P3M C;  4H9S C;  4LD9 C;  5B33 B;  5GSU A;  3UTB A;  4HGA C;  3B6G B;  1W2E A;  3WKJ B;  4KGC B;  5FUG B;  4YS3 B;  2J8P A;  1N1J A;  3AZH C;  2FFF B;  3AYW D;  5B40 C;  3AZH A;  1P3B D;  1P3I B;  5GSU B;  4E44 A;  2G5H C;  1P3M B;  4LD9 B;  5CPJ D;  4HGA B;  3X1S D;  4J8V D;  3REK D;  4XZQ C;  3NQJ A;  4YM6 D;  5B24 C;  3MGP D;  5AV5 C;  1P3B B;  4WU9 A;  5B32 D;  5G49 B;  4CSR A;  4XZQ A;  3AZH B;  5AV5 A;  2F8N H;  3REI A;  3NQU A;  4J8V B;  3W97 A;  1PZR A;  5B40 B;  3X1U C;  4J8X D;  2ARO D;  3MGS D;  1KX5 A;  3X1U A;  2CV5 D;  4G91 C;  2HIO D;  5AVC C;  4EO5 C;  4XZQ B;  5B24 B;  1EQZ D;  4H9P A;  5AV5 B;  3NQU B;  1HTA A;  5B0Y C;  1S32 D;  3LZ0 C;  3UT9 C;  3X1U B;  5B0Y A;  1ZLA A;  3LZ0 A;  5AVB C;  3REL A;  3C1C A;  5BNV A;  4G91 B;  2HUE C;  5AVC B;  5AVB A;  3O62 C;  1M1A D;  4EO5 B;  1M18 D;  5E5A A;  3EPH A;  4JJN C;  5AV6 C;  5JRG C;  4Z5T A;  3MGR C;  3LZ0 B;  3LEL A;  3B0C T;  2RVQ C;  3UT9 B;  3KXB D;  3AZM A;  1F66 C;  2Y2I A;  3B0B A;  4H9O B;  5AVB B;  3MVD C;  3AV2 C;  2NQB C;  2HUE B;  4QLC C;  3O62 B;  2F8N A;  3H0L C;  1JFI A;  4JJN B;  5AV6 B;  5JRG B;  3UTA A;  1P3F C;  1P3G C;  5AV9 C;  5GT0 D;  3REJ C;  2F8N K;  3MGR B;  5BS7 A;  3REH C;  3A6N D;  1P3G A;  3REJ A;  3AZF A;  1F66 B;  4H9N B;  1BH8 A;  2BYM A;  3REH A;  3AZE A;  3EPK A;  3MVD B;  3AZL C;  4XUJ D;  2YFV A;  5GXQ D;  3AV2 B;  3AZN A;  1JFI B;  2NQB B;  4QLC B;  3W96 A;  5DNM C;  1P3F B;  1P3G B;  3VH6 A;  5AV9 B;  1TZY C;  3REJ B;  4Z2M H;  4ZUX C;  3W99 C;  4WU8 A;  4XUJ B;  3LZ1 C;  5CPK A;  5F99 C;  3REH B;  4KUD A;  4X23 D;  4ZUX A;  3AZI C;  3W98 C;  2Y2L A;  2XD5 A;  3WAA D;  5CP6 A;  3AZL B;  3AZI A;  1Z2C B;  1P3L C;  3X1V C;  3WA9 D;  5KDM A;  5DNM B;  2ZY5 A;  1TZY B;  5CPI A;  4ZUX B;  3LZ1 B;  3W99 B;  5DNN C;  5F99 B;  1P34 D;  2YFW B;  1WWS A;  3AZI B;  5B2I A;  3KUY D;  1TAF B;  5DNN A;  3W98 B;  4H9R B;  3FDD A;  1P3L B;  3MNN C;  1P34 B;  2Y2H A;  3X1V B;  3MGQ D;  5GT3 A;  3LJA A;  4Z66 D;  5C3I B;  3MNN A;  3X1T C;  2PYO C;  3H0R C;  5DNN B;  5B31 C;  5B2J D;  4J8W C;  3AZK C;  3AFA D;  3P5J B;  4J8W A;  3AZK A;  3MNN B;  3B6G A;  5B1L D;  3VH5 W;  1P3P D;  5FUG A;  4YS3 A;  3A1I A;  3X1T B;  2PYO B;  1KX3 C;  5B31 B;  2JCH A;  1HQ3 D;  4J8W B;  1P3P B;  1P3I A;  3AZK B;  1BH9 B;  3AYW C;  1P3M A;  1KX3 D;  4H9S A;  4LD9 A;  1P3K D;  1P3B C;  1P3B A;  5G49 A;  4J8V C;  3REK C;  3X1S C;  5CPJ C;  3MGP C;  4YM6 C;  1KX3 B;  3AZG D;  4J8V A;  5B40 A;  5B32 C;  2W8S A;  3VH6 T;  1AOI D;  3AYW B;  2JE5 A;  4J8X C;  2ARO C;  3MGS C;  3AV1 D;  5B24 A;  4WZS B;  2CV5 C;  2HIO C;  4AWL C;  5CPJ B;  3REK B;  3X1S B;  3MGP B;  4YM6 B;  2FJ7 D;  4CAY B;  3UTB D;  3B0C W;  1EQZ C;  1R4V A;  2F8N G;  1ULY A;  5B32 B;  1ID3 D;  4R8P D;  1S32 C;  4J8X B;  5AVC A;  2ARO B;  3MGS B;  1S32 A;  2CV5 B;  2HIO B;  4AWL B;  1M1A C;  1M18 C;  3TU4 D;  1EQZ B;  3UT9 A;  3C1B C;  1H3O B;  4WU9 D;  4H9O A;  3IP4 C;  1S32 B;  3KXB C;  3REI D;  3O62 A;  1KX5 D;  3C1B D;  4JJN A;  5AV6 A;  5JRG A;  1B67 A;  1M18 B;  1M1A B;  3MGR A;  5GT0 C;  1F66 A;  4H9N A;  3C1B B;  4J8U D;  3A6N C;  3MVD A;  5GT0 A;  3AV2 A;  2NQB A;  3KXB B;  4QLC A;  3B0D C;  1ZLA D;  4KHA B;  2BYK B;  3REL D;  4XUJ C;  3C1C D;  5GXQ C;  1P3F A;  1F1E A;  2Y2N A;  5AY8 D;  5AV9 A;  5JA4 B;  4XUJ A;  2JSS A;  1U35 D;  5E5A D;  1KX4 D;  5GT0 B;  4WV4 B;  2BG1 A;  1P3A D;  2UWX A;  4Z5T D;  3A6N B;  3AZL A;  4X23 C;  3LEL D;  2Y2P A;  3B0D B;  3AZM D;  3WAA C;  5GXQ B;  5DNM A;  1TZY A;  3LZ1 A;  3W99 A;  3WA9 C;  5F99 A;  2F8N D;  2YFW A;  3KWQ D;  3UTA D;  3W98 A;  1TAF A;  4ZBJ C;  1M19 D;  4H9R A;  1P3O C;  1P34 C;  3B6F D;  2F2A C;  4X23 B;  3KUY C;  3AN2 D;  1P3L A;  5C3I C;  5AV8 D;  3AZF D;  3X1V A;  1P34 A;  3WAA B;  3KUY A;  3AZE D;  3WTP D;  3B6F B;  3AZN D;  4DRB A;  3MGQ C;  3WA9 B;  3W96 D;  4Z66 C;  3AN2 B;  4ZBJ B;  5CPK D;  4UPK A;  2NZD D;  1KU5 A;  4E45 A;  5B2J C;  1B6W A;  3KUY B;  4KUD D;  2Y2Q A;  4NE5 A;  2ZM5 A;  3EPJ A;  3AZJ D;  1P3O D;  5B2J A;  3AFA C;  4UUZ B;  5CP6 D;  5B0Z D;  3X1T A;  5B1L C;  3MGQ B;  2PYO A;  1P3P C;  4Z66 B;  5B31 A;  3VH6 W;  5B1L A;  1P3P A;  3AL0 C;  5CPI D;  5B0Z B;  1BH9 A;  5B2J B;  5B1M D;  1BFM A;  3A1K A;  1HQ3 C;  4NE6 A;  3EPL A;  5B2I D;  3AFA B;  4H9Q B;  1P3K C;  2IO5 C;  3AZJ C;  5B1L B;  1KX3 A;  5B1M B;  5GT3 D;  1P3K A;  3LJA D;  3F6T A;  5BNX B;  3AZG C;  3AYW A;  3KSY A;  1HQ3 B;  1AOI C;  4WNN B;  2XD1 A;  1P3K B;  3AV1 C;  5CPJ A;  3REK A;  2IO5 B;  3X1S A;  5B33 D;  2RIQ A;  4YM6 A;  5BT1 D;  4CAY A;  3MGP A;  3B6G D;  3AV1 A;  5B32 A;  3WKJ D;  4KGC D;  4YS3 D;  2FJ7 C;  3UTB C;  3AZG B;  4J8X A;  1ID3 C;  2FJ7 A;  2ARO A;  4R8P C;  3MGS A;  1A7W A;  1AOI B;  1P3I D;  5GSU D;  2ZY2 A;  1ID3 A;  3EG5 B;  4R8P A;  2HIO A;  2CV5 A;  2Y2K A;  1P3M D;  3AV1 B;  4LD9 D;  2Y2G A;  1EQZ A;  3TU4 C;  1H3O A;  2FJ7 B;  3UTB B;  3AZH D;  3TU4 A;  1ID3 B;  4R8P B;  4WU9 C;  5B40 D;  1N1J B;  3VH5 T;  3REI C;  2ZY4 A;  3W97 C;  1M18 A;  1M1A A;  2G5I C;  1KX5 C;  4XZQ D;  5B24 D;  3C1B A;  5AV5 D;  3TU4 B;  3W97 D;  3NQJ B;  3KXB A;  4WU9 B;  3X1U D;  4J8U C;  2DQN C;  4CSR B;  4KHA A;  2BYK A;  3REI B;  4J8U A;  3W97 B;  5AVC D;  1ZLA C;  5JA4 A;  1KX5 B;  3REL C;  3C1C C;  5AY8 C;  2DF4 C;  5B0Y D;  1U35 C;  5E5A C;  5AY8 A;  4M6B A;  3A6N A;  1KX4 C;  4NFT A;  4H9P B;  3LZ0 D;  3UT9 D;  4J8U B;  1U35 A;  1P3A C;  1KX4 A;  4Z5T C;  5AVB D;  3LEL C;  5GXQ A;  1P3A A;  5B0Y B;  3AZM C;  1ZLA B;  3O62 D;  3REL B;  3C1C B;  5BNV B;  1Q9C A;  5AY8 B;  4JJN D;  5AV6 D;  5JRG D;  2ZY3 A;  1U35 B;  5E5A B;  1KX4 B;  3MGR D;  4X23 A;  3KWQ C;  3UTA C;  2RVQ D;  5B31 G;  1M19 C;  1P3A B;  1F66 D;  1T3U A;  3R45 A;  4Z5T B;  3WTP E;  3KWQ A;  3B6F C;  4Z2M G;  3WAA A;  3LEL B;  5BS7 C;  1M19 A;  3AN2 C;  3MVD D;  3AV2 D;  5AV8 C;  2NQB D;  3AZF C;  3B6F A;  3AZM B;  4QLC D;  3WA9 A;  3AN2 A;  3AZE C;  5AV8 A;  3WTP C;  5BO0 A;  2VQR A;  3AZN C;  1P3F D;  3W96 C;  1P3G D;  5AV9 D;  2Y2J A;  3REJ D;  2F8N B;  3WTP A;  5CHL B;  3R45 B;  3KWQ B;  3REH D;  3UTA B;  1M19 B;  5CPK C;  2NZD C;  1WWI A;  4WU8 C;  4UUZ A;  3AZL D;  4KUD C;  2L5A A;  5AV8 B;  3AZF B;  2NZD A;  5BO0 B; 
#chains in the Genus database with same CATH homology
 3MGQ A;  4NE3 A;  1BH8 B;  2BYM B;  2Y2O A;  4Z66 A;  5CP6 C;  5B0Z C;  4DQY B;  3WTP B;  3AZE B;  3AZJ A;  2YFV B;  3VH5 A;  4WU8 D;  3AZN B;  5DNM D;  1P3O A;  3W96 B;  1TZY D;  5B0Z A;  4ZUX D;  3W99 D;  3LZ1 D;  5F99 D;  4G92 C;  3AZI D;  5CPI C;  5B32 G;  5CPK B;  3W98 D;  4WU8 B;  2LY8 A;  3AFA A;  2NZD B;  5B1M C;  4H9Q A;  4KUD B;  3AZJ B;  5B2I C;  1P3O B;  1P3L D;  5B1M A;  3X1V D;  4WJ3 C;  5CP6 B;  3KFU G;  5BNX A;  5GT3 C;  5DNN D;  3LJA C;  5KDM B;  4G92 B;  1HQ3 A;  3H0M C;  4WNN A;  5CPI B;  2CWE A;  5B2I B;  3MNN D;  3V9R A;  5B33 C;  3X1T D;  5BT1 C;  3AZG A;  3B6G C;  2PYO D;  2Y2M A;  5GT3 B;  3LJA B;  5B33 A;  5B31 D;  3WKJ C;  4KGC C;  4YS3 C;  1AOI A;  4J8W D;  3AZK D;  3WKJ A;  4KGC A;  3V9R B;  4DRA A;  1P3I C;  5GSU C;  1P3M C;  4H9S C;  4LD9 C;  5B33 B;  5GSU A;  3UTB A;  4HGA C;  3B6G B;  1W2E A;  3WKJ B;  4KGC B;  5FUG B;  4YS3 B;  2J8P A;  1N1J A;  3AZH C;  2FFF B;  3AYW D;  5B40 C;  3AZH A;  1P3B D;  1P3I B;  5GSU B;  4E44 A;  2G5H C;  1P3M B;  4LD9 B;  5CPJ D;  4HGA B;  3X1S D;  4J8V D;  3REK D;  4XZQ C;  3NQJ A;  4YM6 D;  5B24 C;  3MGP D;  5AV5 C;  1P3B B;  4WU9 A;  5B32 D;  5G49 B;  4CSR A;  4XZQ A;  3AZH B;  5AV5 A;  2F8N H;  3REI A;  3NQU A;  4J8V B;  3W97 A;  1PZR A;  5B40 B;  3X1U C;  4J8X D;  2ARO D;  3MGS D;  1KX5 A;  3X1U A;  2CV5 D;  4G91 C;  2HIO D;  5AVC C;  4EO5 C;  4XZQ B;  5B24 B;  1EQZ D;  4H9P A;  5AV5 B;  3NQU B;  1HTA A;  5B0Y C;  1S32 D;  3LZ0 C;  3UT9 C;  3X1U B;  5B0Y A;  1ZLA A;  3LZ0 A;  5AVB C;  3REL A;  3C1C A;  5BNV A;  4G91 B;  2HUE C;  5AVC B;  5AVB A;  3O62 C;  1M1A D;  4EO5 B;  1M18 D;  5E5A A;  3EPH A;  4JJN C;  5AV6 C;  5JRG C;  4Z5T A;  3MGR C;  3LZ0 B;  3LEL A;  3B0C T;  2RVQ C;  3UT9 B;  3KXB D;  3AZM A;  1F66 C;  2Y2I A;  3B0B A;  4H9O B;  5AVB B;  3MVD C;  3AV2 C;  2NQB C;  2HUE B;  4QLC C;  3O62 B;  2F8N A;  3H0L C;  1JFI A;  4JJN B;  5AV6 B;  5JRG B;  3UTA A;  1P3F C;  1P3G C;  5AV9 C;  5GT0 D;  3REJ C;  2F8N K;  3MGR B;  5BS7 A;  3REH C;  3A6N D;  1P3G A;  3REJ A;  3AZF A;  1F66 B;  4H9N B;  1BH8 A;  2BYM A;  3REH A;  3AZE A;  3EPK A;  3MVD B;  3AZL C;  4XUJ D;  2YFV A;  5GXQ D;  3AV2 B;  3AZN A;  1JFI B;  2NQB B;  4QLC B;  3W96 A;  5DNM C;  1P3F B;  1P3G B;  3VH6 A;  5AV9 B;  1TZY C;  3REJ B;  4Z2M H;  4ZUX C;  3W99 C;  4WU8 A;  4XUJ B;  3LZ1 C;  5CPK A;  5F99 C;  3REH B;  4KUD A;  4X23 D;  4ZUX A;  3AZI C;  3W98 C;  2Y2L A;  2XD5 A;  3WAA D;  5CP6 A;  3AZL B;  3AZI A;  1Z2C B;  1P3L C;  3X1V C;  3WA9 D;  5KDM A;  5DNM B;  2ZY5 A;  1TZY B;  5CPI A;  4ZUX B;  3LZ1 B;  3W99 B;  5DNN C;  5F99 B;  1P34 D;  2YFW B;  1WWS A;  3AZI B;  5B2I A;  3KUY D;  1TAF B;  5DNN A;  3W98 B;  4H9R B;  3FDD A;  1P3L B;  3MNN C;  1P34 B;  2Y2H A;  3X1V B;  3MGQ D;  5GT3 A;  3LJA A;  4Z66 D;  5C3I B;  3MNN A;  3X1T C;  2PYO C;  3H0R C;  5DNN B;  5B31 C;  5B2J D;  4J8W C;  3AZK C;  3AFA D;  3P5J B;  4J8W A;  3AZK A;  3MNN B;  3B6G A;  5B1L D;  3VH5 W;  1P3P D;  5FUG A;  4YS3 A;  3A1I A;  3X1T B;  2PYO B;  1KX3 C;  5B31 B;  2JCH A;  1HQ3 D;  4J8W B;  1P3P B;  1P3I A;  3AZK B;  1BH9 B;  3AYW C;  1P3M A;  1KX3 D;  4H9S A;  4LD9 A;  1P3K D;  1P3B C;  1P3B A;  5G49 A;  4J8V C;  3REK C;  3X1S C;  5CPJ C;  3MGP C;  4YM6 C;  1KX3 B;  3AZG D;  4J8V A;  5B40 A;  5B32 C;  2W8S A;  3VH6 T;  1AOI D;  3AYW B;  2JE5 A;  4J8X C;  2ARO C;  3MGS C;  3AV1 D;  5B24 A;  4WZS B;  2CV5 C;  2HIO C;  4AWL C;  5CPJ B;  3REK B;  3X1S B;  3MGP B;  4YM6 B;  2FJ7 D;  4CAY B;  3UTB D;  3B0C W;  1EQZ C;  1R4V A;  2F8N G;  1ULY A;  5B32 B;  1ID3 D;  4R8P D;  1S32 C;  4J8X B;  5AVC A;  2ARO B;  3MGS B;  1S32 A;  2CV5 B;  2HIO B;  4AWL B;  1M1A C;  1M18 C;  3TU4 D;  1EQZ B;  3UT9 A;  3C1B C;  1H3O B;  4WU9 D;  4H9O A;  3IP4 C;  1S32 B;  3KXB C;  3REI D;  3O62 A;  1KX5 D;  3C1B D;  4JJN A;  5AV6 A;  5JRG A;  1B67 A;  1M18 B;  1M1A B;  3MGR A;  5GT0 C;  1F66 A;  4H9N A;  3C1B B;  4J8U D;  3A6N C;  3MVD A;  5GT0 A;  3AV2 A;  2NQB A;  3KXB B;  4QLC A;  3B0D C;  1ZLA D;  4KHA B;  2BYK B;  3REL D;  4XUJ C;  3C1C D;  5GXQ C;  1P3F A;  1F1E A;  2Y2N A;  5AY8 D;  5AV9 A;  5JA4 B;  4XUJ A;  2JSS A;  1U35 D;  5E5A D;  1KX4 D;  5GT0 B;  4WV4 B;  2BG1 A;  1P3A D;  2UWX A;  4Z5T D;  3A6N B;  3AZL A;  4X23 C;  3LEL D;  2Y2P A;  3B0D B;  3AZM D;  3WAA C;  5GXQ B;  5DNM A;  1TZY A;  3LZ1 A;  3W99 A;  3WA9 C;  5F99 A;  2F8N D;  2YFW A;  3KWQ D;  3UTA D;  3W98 A;  1TAF A;  4ZBJ C;  1M19 D;  4H9R A;  1P3O C;  1P34 C;  3B6F D;  2F2A C;  4X23 B;  3KUY C;  3AN2 D;  1P3L A;  5C3I C;  5AV8 D;  3AZF D;  3X1V A;  1P34 A;  3WAA B;  3KUY A;  3AZE D;  3WTP D;  3B6F B;  3AZN D;  4DRB A;  3MGQ C;  3WA9 B;  3W96 D;  4Z66 C;  3AN2 B;  4ZBJ B;  5CPK D;  4UPK A;  2NZD D;  1KU5 A;  4E45 A;  5B2J C;  1B6W A;  3KUY B;  4KUD D;  2Y2Q A;  4NE5 A;  2ZM5 A;  3EPJ A;  3AZJ D;  1P3O D;  5B2J A;  3AFA C;  4UUZ B;  5CP6 D;  5B0Z D;  3X1T A;  5B1L C;  3MGQ B;  2PYO A;  1P3P C;  4Z66 B;  5B31 A;  3VH6 W;  5B1L A;  1P3P A;  3AL0 C;  5CPI D;  5B0Z B;  1BH9 A;  5B2J B;  5B1M D;  1BFM A;  3A1K A;  1HQ3 C;  4NE6 A;  3EPL A;  5B2I D;  3AFA B;  4H9Q B;  1P3K C;  2IO5 C;  3AZJ C;  5B1L B;  1KX3 A;  5B1M B;  5GT3 D;  1P3K A;  3LJA D;  3F6T A;  5BNX B;  3AZG C;  3AYW A;  3KSY A;  1HQ3 B;  1AOI C;  4WNN B;  2XD1 A;  1P3K B;  3AV1 C;  5CPJ A;  3REK A;  2IO5 B;  3X1S A;  5B33 D;  2RIQ A;  4YM6 A;  5BT1 D;  4CAY A;  3MGP A;  3B6G D;  3AV1 A;  5B32 A;  3WKJ D;  4KGC D;  4YS3 D;  2FJ7 C;  3UTB C;  3AZG B;  4J8X A;  1ID3 C;  2FJ7 A;  2ARO A;  4R8P C;  3MGS A;  1A7W A;  1AOI B;  1P3I D;  5GSU D;  2ZY2 A;  1ID3 A;  3EG5 B;  4R8P A;  2HIO A;  2CV5 A;  2Y2K A;  1P3M D;  3AV1 B;  4LD9 D;  2Y2G A;  1EQZ A;  3TU4 C;  1H3O A;  2FJ7 B;  3UTB B;  3AZH D;  3TU4 A;  1ID3 B;  4R8P B;  4WU9 C;  5B40 D;  1N1J B;  3VH5 T;  3REI C;  2ZY4 A;  3W97 C;  1M18 A;  1M1A A;  2G5I C;  1KX5 C;  4XZQ D;  5B24 D;  3C1B A;  5AV5 D;  3TU4 B;  3W97 D;  3NQJ B;  3KXB A;  4WU9 B;  3X1U D;  4J8U C;  2DQN C;  4CSR B;  4KHA A;  2BYK A;  3REI B;  4J8U A;  3W97 B;  5AVC D;  1ZLA C;  5JA4 A;  1KX5 B;  3REL C;  3C1C C;  5AY8 C;  2DF4 C;  5B0Y D;  1U35 C;  5E5A C;  5AY8 A;  4M6B A;  3A6N A;  1KX4 C;  4NFT A;  4H9P B;  3LZ0 D;  3UT9 D;  4J8U B;  1U35 A;  1P3A C;  1KX4 A;  4Z5T C;  5AVB D;  3LEL C;  5GXQ A;  1P3A A;  5B0Y B;  3AZM C;  1ZLA B;  3O62 D;  3REL B;  3C1C B;  5BNV B;  1Q9C A;  5AY8 B;  4JJN D;  5AV6 D;  5JRG D;  2ZY3 A;  1U35 B;  5E5A B;  1KX4 B;  3MGR D;  4X23 A;  3KWQ C;  3UTA C;  2RVQ D;  5B31 G;  1M19 C;  1P3A B;  1F66 D;  1T3U A;  3R45 A;  4Z5T B;  3WTP E;  3KWQ A;  3B6F C;  4Z2M G;  3WAA A;  3LEL B;  5BS7 C;  1M19 A;  3AN2 C;  3MVD D;  3AV2 D;  5AV8 C;  2NQB D;  3AZF C;  3B6F A;  3AZM B;  4QLC D;  3WA9 A;  3AN2 A;  3AZE C;  5AV8 A;  3WTP C;  5BO0 A;  2VQR A;  3AZN C;  1P3F D;  3W96 C;  1P3G D;  5AV9 D;  2Y2J A;  3REJ D;  2F8N B;  3WTP A;  5CHL B;  3R45 B;  3KWQ B;  3REH D;  3UTA B;  1M19 B;  5CPK C;  2NZD C;  1WWI A;  4WU8 C;  4UUZ A;  3AZL D;  4KUD C;  2L5A A;  5AV8 B;  3AZF B;  2NZD A;  5BO0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...