3MGPB

Binding of cobalt ions to the nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpB00
4WU9B 4WNNA 2F8NG 4XUJC 4J8UB 3W96D 3AZMC 3AFAD 3X1TC 5B2IC 5AV5C 3UTBC 1BH9A 5C3IB 1P3PB 5AVCD 3WKJC 1H3OB 4KHAA 3AV1D 3X1SD 1F1EA 1P3OC 5B31C 3AN2A 4R8PB 1AOIB 3KXBA 4J8UD 3MGRC 4WU9D 3AZGA 5B1LC 3AZFC 1P3BC 3AZHB 4WU8A 5E5AC 4KGCC 3O62C 3X1TD 3LZ1A 1ZLAB 2CV5B 1TAFA 3LELB 1WWIA 3W97A 1U35A 3MGPA 5AV5D 3UTBD 4G92B 1KX3C 1M1AA 3WKJD 5B33A 1F66C 3NQJB 3W99A 5BO0B 4M6BA 5JA4A 4R8PD 5B31D 4CAYB 3MGRD 3REKB 4X23B 1M19B 5CP6A 2HUEB 4XZQB 2FJ7A 5KDMB 3VH5A 1ZLAD 4JJNC 5E5AD 3MNNC 3KSYA 4H9RB 4H9NA 3O62D 3LELD 3REJA 3LJAC 4ZUXC 5AV8B 5AVBB 3AZKC 5GT3A 5B2JB 1KX3D 4G91B 3NQUA 3AZNC 3WAAB 3RELA 4Z5TB 3AZLA 3C1CC 5BNXB 1F66D 3UTAA 4NE6A 5JRGA 1S32C 5B0YC 1P3MC 5CPKA 1P3AB 4X23D 4H9OB 1P3IA 4XZQD 3A6NB 3AZEA 2NQBC 4YM6B 5GSUC 5CPJA 3MNND 4Z66B 5F99C 5AV8D 4ZUXD 5AV9C 3KWQB 5B2JD 5AY8B 3AZKD 3WA9B 5B40B 5AV9B 1HQ3C 4QLCA 1P34B 2AROC 3AYWC 5DNMA 5B32A 4EO5B 3C1CD 3MGQB 1P3GC 1S32D 1P3AD 1P3GB 1P3LB 3W98C 1P3MD 3REIB 2RVQD 4J8VA 3LZ0C 4YS3C 2HIOA 1BH8A 5GXQB 3A6ND 4LD9B 4YS3B 4YM6D 3WTPC 5GSUD 3B6FB 3C1BC 5B32G 3REHC 5B0ZB 3KWQD 1B67A 3WA9D 3MGSC 5AV9D 1M18A 3UT9C 2PYOC 4J8VC 5B24C 5CPIB 2IO5C 2AROD 2YFWB 2IO5B 3AZJA 1TZYA 1P3GD 1P3LD 3AZIB 3TU4B 4H9PB 3REID 3W98D 5GT0B 4LD9D 5GXQD 4AWLB 3LZ0D 4YS3D 3X1UA 5B1MA 2NZDA 4CSRB 3B6FD 3B6GC 3MVDC 3REHD 3W96A 4KUDB 3MGSD 5CPID 5DNNC 1ID3C 1P3KC 1EQZC 3AV1B 1EQZB 2YFVB 5BS7C 3AZID 4E45A 4H9SC 5GT0D 3V9RB 4J8WC 5AV6C 4J8XA 5G49A 1KX4C 3B0DC 1KX5A 4XUJB 4J8UA 3X1VA 3VH6A 3AZMB 3X1TB 4WU9A 3B6GD 1N1JB 5B2IB 5AV5B 3UTBB 4KUDD 4J8XC 2BYMB 1ID3D 1EQZD 3WKJB 4DRBA 1P3PA 1P3OB 5B31B 1H3OA 3MGRB 3KUYA 4J8WD 3B0BA 5B1LB 3AZFB 1P3BB 4R8PA 4XUJD 1KX4D 1AOIA 4WV4B 3AZMD 4KGCB 5E5AB 3O62B 3AN2C 5B2ID 3KXBC 3AZHA 3KXBB 3AZGC 2CV5A 1KX3B 3LELA 2F8NH 1P3FA 1F66B 4WU8C 1P3OD 3LZ1C 3W97C 1U35C 5BO0A 3MGPC 5B1LD 3AZFD 1P3BD 1M1AC 4NFTA 4CAYA 5B33C 4KGCD 3REKA 3W99C 1KU5A 4X23A 1M19A 4JJNB 3MNNB 3W99B 4XZQA 3AN2D 3LJAB 4HGAC 3KXBD 5KDMA 4ZUXB 3AZKB 5CP6C 4H9RA 5BT1C 4NE5A 2FJ7C 3AZNB 3C1CB 5AVBA 4WU8D 5B2JA 1S32B 3REJC 1JFIB 5B0YB 1P3MB 3WAAA 4Z5TA 5BNXA 1U35D 5GT3C 4ZBJC 1P3AA 3RELC 3AZLC 2NQBB 1WWSA 4H9OA 5GSUB 5B33D 3W99D 4JJND 5JRGC 3UTAC 3AZLB 3A6NA 5F99B 3LJAD 5CPKC 4YM6A 3R45B 2L5AA 1P3IC 5BNVB 1HTAA 5CP6D 4Z66A 3AV2A 3AZND 1HQ3B 3AZEC 2AROB 2FJ7D 3AYWB 3KWQA 5AY8A 3WA9A 5B40A 5CPJC 5B0YD 1P34A 3REJD 3W98B 3LZ0B 3MGQA 5GT3D 2NQBD 4QLCC 3AV2C 1P3LA 3RELD 3REIA 3AZLD 3WTPB 5DNMC 5B32C 5FUGB 4LD9A 5GXQA 3UTAD 5F99D 5JRGD 3C1BB 3REHB 3MGSB 2HIOC 2PYOB 3UT9B 1HQ3D 4J8VB 1P3ID 5B24B 5B0ZA 3AYWD 3AZED 2BYKB 2YFWA 4UUZB 1M18C 4NE3A 4Z2MG 3TU4A 3AZIA 4H9PA 5GT0A 3WTPD 5DNMD 3AZJC 3B6GB 5CHLB 3C1BD 1TZYC 2JSSA 3MVDB 4CSRA 3AFAA 3UT9D 2PYOD 4J8VD 2HIOD 5B24D 5DNNB 5B1MC 3X1UC 1ID3B 1P3KB 1ULYA 2NZDC 4KUDA 4H9QB 5AVCA 2LY8A 3AV1A 4J8WB 3X1SA 5AV6B 3W96C 2F8NB 1M18D 1KX4B 3B0DB 3V9RA 1TZYD 3MVDD 4XUJA 4J8XB 3AZMA 3X1SC 5DNND 3X1TA 1P3KD 4WNNB 3X1UD 1KX5C 3B0CW 5B2IA 4J8UC 5AV5A 3UTBA 3X1VC 2BYMA 4WU9C 3WKJA 5AV6D 2F8ND 1BH9B 1P3OA 5B31A 3MGRA 4KHAB 5C3IC 1P3PC 5B1LA 3AZFA 1P3BA 3AN2B 3KUYC 4J8XD 1ZLAA 4KGCA 5E5AA 3O62A 3KUYB 3AZGB 2CWEA 4R8PC 1AOIC 3VH5T 1KX5D 5B31G 4WU8B 3X1VD 3LZ1B 1KX3A 1TAFB 3NQJA 1B6WA 3AZHC 1U35B 1F66A 3MGPB 3W97B 1ZLAC 2CV5C 1M1AB 3LELC 5B33B 1P3FC 4G92C 1P3FB 5JA4B 1P3PD 4HGAB 3KUYD 3AZGD 4JJNA 5CP6B 3MNNA 3LJAA 1A7WA 5AV8A 1AOID 2FJ7B 4ZUXA 3REKC 3AZKA 4X23C 3LZ1D 1M19C 2HUEC 4H9NB 4XZQC 3REJB 3AZNA 3W97D 3MGPD 3C1CA 3AZHD 3VH6W 5GT3B 1M1AD 1S32A 4ZBJB 2CV5D 1JFIA 3NQUB 5B0YA 1P3MA 3RELB 5AVBC 5AV8C 1P3FD 3UTAB 5JRGB 5B2JC 3B0CT 4G91C 3WAAC 2NQBA 4Z5TC 5CPKB 5GSUA 1P3IB 5BT1D 5F99A 3AZEB 1R4VA 1P3AC 3R45A 5AV9A 3REKD 2RVQC 1M19D 5BNVA 5CPJB 3A6NC 1HQ3A 2AROA 4YM6C 3AYWA 1P3GA 4Z66C 4QLCB 3W98A 3AV2B 3KWQC 5B32B 5AVBD 5AY8C 3LZ0A 5DNMB 4YS3A 5B40C 3WA9C 1P34C 5CPKD 3WAAD 4Z5TD 3WTPA 3B6FA 5FUGA 4EO5C 2HIOB 1BH8B 3MGQC 3C1BA 3REHA 1P3LC 3REIC 3MGSA 5CPJD 5GXQC 3UT9A 5CPIA 2PYOA 4LD9C 5B24A 3VH5W 1M18B 2F8NK 3B6FC 4QLCD 2BYKA 3AV2D 4E44A 4Z66D 5B0ZC 4UUZA 5B32D 3AZJB 5AY8D 1TZYB 5B40D 5CPIC 1P34D 3B6GA 3MGQD 3X1UB 5B1MB 3AZIC 3TU4C 3MVDA 5GT0C 2NZDB 3VH6T 4AWLC 4DRAA 1ID3A 5DNNA 1P3KA 2YFVA 1EQZA 1BFMA 1Q9CA 3AFAC 5BS7A 3W96B 4H9QA 3AFAB 4WZSB 4H9SA 3WTPE 5B0ZD 4J8WA 5AV6A 3AZJD 2F8NA 4KUDC 5AVCC 1KX4A 5AVCB 3AV1C 5G49B 1N1JA 3X1SB 5B1MD 1KX5B 3TU4D 2NZDD 4Z2MH 3X1VB
chains in the Genus database with same CATH superfamily
2DF4C 4WU9B 4WNNA 2F8NG 4XUJC 4J8UB 3W96D 2ZY2A 3AZMC 3AFAD 3X1TC 5B2IC 5AV5C 3UTBC 1BH9A 5C3IB 3A1IA 1P3PB 5AVCD 2DQNC 3WKJC 1H3OB 3P5JB 4KHAA 3AV1D 3X1SD 1F1EA 1P3OC 5B31C 3AN2A 2W8SA 4R8PB 3KXBA 4J8UD 1AOIB 3MGRC 2Y2LA 4WU9D 3AZGA 5B1LC 3AZFC 1P3BC 2UWXA 1W2EA 3AZHB 4WU8A 5E5AC 4KGCC 3O62C 3X1TD 3LZ1A 1ZLAB 2CV5B 1TAFA 3LELB 1WWIA 3W97A 1U35A 3MGPA 5AV5D 3UTBD 4G92B 1KX3C 1M1AA 3WKJD 5B33A 1F66C 3NQJB 3W99A 5BO0B 4M6BA 5JA4A 4R8PD 5B31D 4CAYB 3MGRD 3REKB 4X23B 1M19B 5CP6A 2HUEB 3EPJA 4XZQB 2FJ7A 5KDMB 3VH5A 1ZLAD 4JJNC 5E5AD 3MNNC 3KSYA 4H9RB 4H9NA 3O62D 3LELD 3REJA 3LJAC 4ZUXC 5AV8B 5AVBB 3AZKC 5GT3A 3KFUG 5B2JB 1KX3D 4G91B 3NQUA 3AZNC 3WAAB 3RELA 4Z5TB 3AZLA 3C1CC 5BNXB 1F66D 3UTAA 4NE6A 5JRGA 1S32C 5B0YC 1P3MC 5CPKA 1P3AB 4X23D 4H9OB 1P3IA 4XZQD 3A6NB 3AZEA 2NQBC 4YM6B 5GSUC 5CPJA 3MNND 4Z66B 5F99C 5AV8D 2F2AC 4ZUXD 5AV9C 3KWQB 5B2JD 5AY8B 3AZKD 3WA9B 5B40B 5AV9B 1HQ3C 4QLCA 1P34B 2AROC 3AYWC 3AL0C 5DNMA 5B32A 4EO5B 3C1CD 3MGQB 1P3GC 1S32D 1P3AD 1P3GB 1P3LB 3W98C 1P3MD 3A1KA 3REIB 2RVQD 4J8VA 3LZ0C 4YS3C 2HIOA 1BH8A 5GXQB 3A6ND 4LD9B 4YS3B 4YM6D 3WTPC 5GSUD 3B6FB 3C1BC 5B32G 3REHC 5B0ZB 3KWQD 1B67A 3WA9D 3MGSC 2VQRA 5AV9D 3UT9C 1M18A 2PYOC 4J8VC 5B24C 5CPIB 2IO5C 2AROD 2YFWB 2IO5B 3AZJA 1TZYA 1P3GD 1P3LD 3AZIB 3TU4B 4H9PB 3REID 3W98D 5GT0B 4LD9D 5GXQD 4AWLB 1PZRA 3LZ0D 4YS3D 3X1UA 5B1MA 2NZDA 4CSRB 3B6FD 3B6GC 3MVDC 3REHD 3W96A 4KUDB 3MGSD 3EPLA 5CPID 5DNNC 1ID3C 1P3KC 1EQZC 2XD1A 3AV1B 1EQZB 2YFVB 5BS7C 3AZID 4E45A 4H9SC 5GT0D 3V9RB 4J8WC 5AV6C 4J8XA 5G49A 3FDDA 1KX4C 3B0DC 1KX5A 4DQYB 4XUJB 4J8UA 3X1VA 3VH6A 3AZMB 3X1TB 4WU9A 3B6GD 1N1JB 5B2IB 5AV5B 3UTBB 4KUDD 4J8XC 2BYMB 1ID3D 1EQZD 3WKJB 4DRBA 1P3PA 1P3OB 5B31B 1H3OA 3MGRB 3KUYA 4J8WD 3B0BA 5B1LB 3AZFB 1P3BB 4R8PA 4XUJD 1KX4D 1AOIA 4WV4B 3AZMD 4KGCB 2Y2QA 5E5AB 3O62B 3AN2C 5B2ID 3KXBC 1T3UA 3AZHA 3KXBB 2JCHA 3AZGC 3EPHA 2CV5A 1KX3B 2Y2OA 3LELA 2F8NH 1P3FA 1F66B 4WU8C 1P3OD 3LZ1C 2ZY4A 3W97C 1U35C 5BO0A 3MGPC 4WJ3C 5B1LD 3AZFD 1P3BD 2ZY3A 1M1AC 4NFTA 4CAYA 5B33C 4KGCD 3REKA 3W99C 1KU5A 4X23A 1M19A 4JJNB 3MNNB 3W99B 4XZQA 3AN2D 3LJAB 4HGAC 3KXBD 5KDMA 4ZUXB 3AZKB 5CP6C 4H9RA 5BT1C 4NE5A 2FJ7C 3AZNB 3C1CB 5AVBA 4WU8D 5B2JA 1S32B 3REJC 1JFIB 5B0YB 1P3MB 3WAAA 4Z5TA 5BNXA 3IP4C 1U35D 5GT3C 4ZBJC 1P3AA 3RELC 3AZLC 2NQBB 1WWSA 4H9OA 2Y2IA 5GSUB 3W99D 2JE5A 5JRGC 5B33D 4JJND 3UTAC 3AZLB 3A6NA 5F99B 3LJAD 5CPKC 4YM6A 3R45B 2ZM5A 2L5AA 1P3IC 5BNVB 1HTAA 5CP6D 4Z66A 3AV2A 3AZND 1HQ3B 3AZEC 2AROB 2FJ7D 3AYWB 3KWQA 5AY8A 3WA9A 5B40A 5CPJC 5B0YD 1P34A 3REJD 3W98B 3LZ0B 3MGQA 5GT3D 2NQBD 4QLCC 3AV2C 1P3LA 3RELD 3REIA 3AZLD 3WTPB 5DNMC 5B32C 5FUGB 4LD9A 5GXQA 3UTAD 5F99D 5JRGD 3C1BB 3REHB 3MGSB 2HIOC 2PYOB 3UT9B 1HQ3D 4J8VB 1P3ID 5B24B 5B0ZA 3AYWD 3AZED 2BYKB 2YFWA 4UUZB 2Y2HA 1M18C 4NE3A 4Z2MG 3TU4A 3AZIA 4H9PA 5GT0A 3WTPD 5DNMD 3AZJC 3B6GB 5CHLB 3C1BD 1TZYC 2JSSA 3MVDB 4CSRA 3AFAA 3F6TA 3UT9D 2PYOD 4J8VD 2HIOD 5B24D 5DNNB 5B1MC 3X1UC 1ID3B 1P3KB 1ULYA 2NZDC 4KUDA 4H9QB 5AVCA 2LY8A 3AV1A 4J8WB 3X1SA 5AV6B 3W96C 2F8NB 1M18D 1KX4B 3B0DB 3V9RA 2XD5A 3H0RC 1TZYD 3MVDD 2Y2JA 4XUJA 4J8XB 3AZMA 3X1SC 5DNND 3X1TA 1P3KD 4WNNB 3X1UD 1KX5C 3B0CW 5B2IA 4J8UC 5AV5A 3UTBA 3X1VC 2BYMA 2RIQA 4WU9C 1Z2CB 3WKJA 5AV6D 2Y2NA 2F8ND 2FFFB 1BH9B 1P3OA 5B31A 3MGRA 4KHAB 5C3IC 1P3PC 2Y2PA 5B1LA 3AZFA 1P3BA 3AN2B 3KUYC 4J8XD 1ZLAA 4KGCA 5E5AA 3O62A 3KUYB 3AZGB 2CWEA 4R8PC 2G5IC 1AOIC 3VH5T 1KX5D 5B31G 4WU8B 3X1VD 3LZ1B 1KX3A 1TAFB 3NQJA 1B6WA 2ZY5A 3AZHC 1U35B 1F66A 3MGPB 3W97B 1ZLAC 2CV5C 1M1AB 3LELC 5B33B 1P3FC 4G92C 1P3FB 5JA4B 1P3PD 4UPKA 4HGAB 3KUYD 3AZGD 4JJNA 5CP6B 3MNNA 3LJAA 1A7WA 5AV8A 1AOID 2FJ7B 4ZUXA 3REKC 3AZKA 4X23C 3LZ1D 1M19C 2HUEC 4H9NB 4XZQC 3REJB 3AZNA 3W97D 3MGPD 3C1CA 3AZHD 3VH6W 5GT3B 1M1AD 1S32A 4ZBJB 2G5HC 2CV5D 3NQUB 5B0YA 1P3MA 1JFIA 3RELB 5AVBC 5AV8C 1P3FD 3UTAB 5JRGB 5B2JC 3B0CT 4G91C 3WAAC 2NQBA 4Z5TC 5CPKB 2Y2GA 5GSUA 1P3IB 5BT1D 5F99A 3AZEB 1R4VA 1P3AC 3R45A 2BG1A 5AV9A 3REKD 2RVQC 1M19D 5BNVA 5CPJB 3A6NC 1HQ3A 2AROA 4YM6C 3AYWA 1P3GA 4Z66C 4QLCB 3W98A 3AV2B 3H0LC 3KWQC 5B32B 5AVBD 5AY8C 3LZ0A 5DNMB 4YS3A 5B40C 3WA9C 1P34C 5CPKD 3WAAD 4Z5TD 3WTPA 3B6FA 5FUGA 4EO5C 2HIOB 1BH8B 3MGQC 3C1BA 3REHA 1P3LC 3REIC 3MGSA 5CPJD 5GXQC 3UT9A 5CPIA 3H0MC 2PYOA 4LD9C 5B24A 3VH5W 3EG5B 1M18B 2F8NK 3B6FC 4QLCD 2BYKA 3AV2D 4E44A 4Z66D 5B0ZC 4UUZA 5B32D 3AZJB 5AY8D 1TZYB 5B40D 5CPIC 1P34D 2Y2MA 3B6GA 3MGQD 3X1UB 5B1MB 3AZIC 3TU4C 3MVDA 5GT0C 2NZDB 3VH6T 4AWLC 4DRAA 1ID3A 5DNNA 1P3KA 2YFVA 1EQZA 1BFMA 1Q9CA 3AFAC 5BS7A 3W96B 4H9QA 3AFAB 4WZSB 4H9SA 3EPKA 3WTPE 5B0ZD 4J8WA 5AV6A 3AZJD 2F8NA 4KUDC 5AVCC 1KX4A 5AVCB 3AV1C 5G49B 1N1JA 2Y2KA 3X1SB 5B1MD 2J8PA 1KX5B 3TU4D 2NZDD 4Z2MH 3X1VB
chains in the Genus database with same CATH topology
2DF4C 4WU9B 4WNNA 2F8NG 4XUJC 4J8UB 3W96D 2ZY2A 3AZMC 3AFAD 3X1TC 5B2IC 5AV5C 3UTBC 1BH9A 5C3IB 3A1IA 1P3PB 5AVCD 2DQNC 3WKJC 1H3OB 3P5JB 4KHAA 3AV1D 3X1SD 1F1EA 1P3OC 5B31C 3AN2A 2W8SA 4R8PB 3KXBA 4J8UD 1AOIB 3MGRC 2Y2LA 4WU9D 3AZGA 5B1LC 3AZFC 1P3BC 2UWXA 1W2EA 3AZHB 4WU8A 5E5AC 4KGCC 3O62C 3X1TD 3LZ1A 1ZLAB 2CV5B 1TAFA 3LELB 1WWIA 3W97A 1U35A 3MGPA 5AV5D 3UTBD 4G92B 1KX3C 1M1AA 3WKJD 5B33A 1F66C 3NQJB 3W99A 5BO0B 4M6BA 5JA4A 4R8PD 5B31D 4CAYB 3MGRD 3REKB 4X23B 1M19B 5CP6A 2HUEB 3EPJA 4XZQB 2FJ7A 5KDMB 3VH5A 1ZLAD 4JJNC 5E5AD 3MNNC 3KSYA 4H9RB 4H9NA 3O62D 3LELD 3REJA 3LJAC 4ZUXC 5AV8B 5AVBB 3AZKC 5GT3A 3KFUG 5B2JB 1KX3D 4G91B 3NQUA 3AZNC 3WAAB 3RELA 4Z5TB 3AZLA 3C1CC 5BNXB 1F66D 3UTAA 4NE6A 5JRGA 1S32C 5B0YC 1P3MC 5CPKA 1P3AB 4X23D 4H9OB 1P3IA 4XZQD 3A6NB 3AZEA 2NQBC 4YM6B 5GSUC 5CPJA 3MNND 4Z66B 5F99C 5AV8D 2F2AC 4ZUXD 5AV9C 3KWQB 5B2JD 5AY8B 3AZKD 3WA9B 5B40B 5AV9B 1HQ3C 4QLCA 1P34B 2AROC 3AYWC 3AL0C 5DNMA 5B32A 4EO5B 3C1CD 3MGQB 1P3GC 1S32D 1P3AD 1P3GB 1P3LB 3W98C 1P3MD 3A1KA 3REIB 2RVQD 4J8VA 3LZ0C 4YS3C 2HIOA 1BH8A 5GXQB 3A6ND 4LD9B 4YS3B 4YM6D 3WTPC 5GSUD 3B6FB 3C1BC 5B32G 3REHC 5B0ZB 3KWQD 1B67A 3WA9D 3MGSC 2VQRA 5AV9D 3UT9C 1M18A 2PYOC 4J8VC 5B24C 5CPIB 2IO5C 2AROD 2YFWB 2IO5B 3AZJA 1TZYA 1P3GD 1P3LD 3AZIB 3TU4B 4H9PB 3REID 3W98D 5GT0B 4LD9D 5GXQD 4AWLB 1PZRA 3LZ0D 4YS3D 3X1UA 5B1MA 2NZDA 4CSRB 3B6FD 3B6GC 3MVDC 3REHD 3W96A 4KUDB 3MGSD 3EPLA 5CPID 5DNNC 1ID3C 1P3KC 1EQZC 2XD1A 3AV1B 1EQZB 2YFVB 5BS7C 3AZID 4E45A 4H9SC 5GT0D 3V9RB 4J8WC 5AV6C 4J8XA 5G49A 3FDDA 1KX4C 3B0DC 1KX5A 4DQYB 4XUJB 4J8UA 3X1VA 3VH6A 3AZMB 3X1TB 4WU9A 3B6GD 1N1JB 5B2IB 5AV5B 3UTBB 4KUDD 4J8XC 2BYMB 1ID3D 1EQZD 3WKJB 4DRBA 1P3PA 1P3OB 5B31B 1H3OA 3MGRB 3KUYA 4J8WD 3B0BA 5B1LB 3AZFB 1P3BB 4R8PA 4XUJD 1KX4D 1AOIA 4WV4B 3AZMD 4KGCB 2Y2QA 5E5AB 3O62B 3AN2C 5B2ID 3KXBC 1T3UA 3AZHA 3KXBB 2JCHA 3AZGC 3EPHA 2CV5A 1KX3B 2Y2OA 3LELA 2F8NH 1P3FA 1F66B 4WU8C 1P3OD 3LZ1C 2ZY4A 3W97C 1U35C 5BO0A 3MGPC 4WJ3C 5B1LD 3AZFD 1P3BD 2ZY3A 1M1AC 4NFTA 4CAYA 5B33C 4KGCD 3REKA 3W99C 1KU5A 4X23A 1M19A 4JJNB 3MNNB 3W99B 4XZQA 3AN2D 3LJAB 4HGAC 3KXBD 5KDMA 4ZUXB 3AZKB 5CP6C 4H9RA 5BT1C 4NE5A 2FJ7C 3AZNB 3C1CB 5AVBA 4WU8D 5B2JA 1S32B 3REJC 1JFIB 5B0YB 1P3MB 3WAAA 4Z5TA 5BNXA 3IP4C 1U35D 5GT3C 4ZBJC 1P3AA 3RELC 3AZLC 2NQBB 1WWSA 4H9OA 2Y2IA 5GSUB 3W99D 2JE5A 5JRGC 5B33D 4JJND 3UTAC 3AZLB 3A6NA 5F99B 3LJAD 5CPKC 4YM6A 3R45B 2ZM5A 2L5AA 1P3IC 5BNVB 1HTAA 5CP6D 4Z66A 3AV2A 3AZND 1HQ3B 3AZEC 2AROB 2FJ7D 3AYWB 3KWQA 5AY8A 3WA9A 5B40A 5CPJC 5B0YD 1P34A 3REJD 3W98B 3LZ0B 3MGQA 5GT3D 2NQBD 4QLCC 3AV2C 1P3LA 3RELD 3REIA 3AZLD 3WTPB 5DNMC 5B32C 5FUGB 4LD9A 5GXQA 3UTAD 5F99D 5JRGD 3C1BB 3REHB 3MGSB 2HIOC 2PYOB 3UT9B 1HQ3D 4J8VB 1P3ID 5B24B 5B0ZA 3AYWD 3AZED 2BYKB 2YFWA 4UUZB 2Y2HA 1M18C 4NE3A 4Z2MG 3TU4A 3AZIA 4H9PA 5GT0A 3WTPD 5DNMD 3AZJC 3B6GB 5CHLB 3C1BD 1TZYC 2JSSA 3MVDB 4CSRA 3AFAA 3F6TA 3UT9D 2PYOD 4J8VD 2HIOD 5B24D 5DNNB 5B1MC 3X1UC 1ID3B 1P3KB 1ULYA 2NZDC 4KUDA 4H9QB 5AVCA 2LY8A 3AV1A 4J8WB 3X1SA 5AV6B 3W96C 2F8NB 1M18D 1KX4B 3B0DB 3V9RA 2XD5A 3H0RC 1TZYD 3MVDD 2Y2JA 4XUJA 4J8XB 3AZMA 3X1SC 5DNND 3X1TA 1P3KD 4WNNB 3X1UD 1KX5C 3B0CW 5B2IA 4J8UC 5AV5A 3UTBA 3X1VC 2BYMA 2RIQA 4WU9C 1Z2CB 3WKJA 5AV6D 2Y2NA 2F8ND 2FFFB 1BH9B 1P3OA 5B31A 3MGRA 4KHAB 5C3IC 1P3PC 2Y2PA 5B1LA 3AZFA 1P3BA 3AN2B 3KUYC 4J8XD 1ZLAA 4KGCA 5E5AA 3O62A 3KUYB 3AZGB 2CWEA 4R8PC 2G5IC 1AOIC 3VH5T 1KX5D 5B31G 4WU8B 3X1VD 3LZ1B 1KX3A 1TAFB 3NQJA 1B6WA 2ZY5A 3AZHC 1U35B 1F66A 3MGPB 3W97B 1ZLAC 2CV5C 1M1AB 3LELC 5B33B 1P3FC 4G92C 1P3FB 5JA4B 1P3PD 4UPKA 4HGAB 3KUYD 3AZGD 4JJNA 5CP6B 3MNNA 3LJAA 1A7WA 5AV8A 1AOID 2FJ7B 4ZUXA 3REKC 3AZKA 4X23C 3LZ1D 1M19C 2HUEC 4H9NB 4XZQC 3REJB 3AZNA 3W97D 3MGPD 3C1CA 3AZHD 3VH6W 5GT3B 1M1AD 1S32A 4ZBJB 2G5HC 2CV5D 3NQUB 5B0YA 1P3MA 1JFIA 3RELB 5AVBC 5AV8C 1P3FD 3UTAB 5JRGB 5B2JC 3B0CT 4G91C 3WAAC 2NQBA 4Z5TC 5CPKB 2Y2GA 5GSUA 1P3IB 5BT1D 5F99A 3AZEB 1R4VA 1P3AC 3R45A 2BG1A 5AV9A 3REKD 2RVQC 1M19D 5BNVA 5CPJB 3A6NC 1HQ3A 2AROA 4YM6C 3AYWA 1P3GA 4Z66C 4QLCB 3W98A 3AV2B 3H0LC 3KWQC 5B32B 5AVBD 5AY8C 3LZ0A 5DNMB 4YS3A 5B40C 3WA9C 1P34C 5CPKD 3WAAD 4Z5TD 3WTPA 3B6FA 5FUGA 4EO5C 2HIOB 1BH8B 3MGQC 3C1BA 3REHA 1P3LC 3REIC 3MGSA 5CPJD 5GXQC 3UT9A 5CPIA 3H0MC 2PYOA 4LD9C 5B24A 3VH5W 3EG5B 1M18B 2F8NK 3B6FC 4QLCD 2BYKA 3AV2D 4E44A 4Z66D 5B0ZC 4UUZA 5B32D 3AZJB 5AY8D 1TZYB 5B40D 5CPIC 1P34D 2Y2MA 3B6GA 3MGQD 3X1UB 5B1MB 3AZIC 3TU4C 3MVDA 5GT0C 2NZDB 3VH6T 4AWLC 4DRAA 1ID3A 5DNNA 1P3KA 2YFVA 1EQZA 1BFMA 1Q9CA 3AFAC 5BS7A 3W96B 4H9QA 3AFAB 4WZSB 4H9SA 3EPKA 3WTPE 5B0ZD 4J8WA 5AV6A 3AZJD 2F8NA 4KUDC 5AVCC 1KX4A 5AVCB 3AV1C 5G49B 1N1JA 2Y2KA 3X1SB 5B1MD 2J8PA 1KX5B 3TU4D 2NZDD 4Z2MH 3X1VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 B;  4WNN A;  2F8N G;  4XUJ C;  4J8U B;  3W96 D;  3AZM C;  3AFA D;  3X1T C;  5B2I C;  5AV5 C;  3UTB C;  1BH9 A;  5C3I B;  1P3P B;  5AVC D;  3WKJ C;  1H3O B;  4KHA A;  3AV1 D;  3X1S D;  1F1E A;  1P3O C;  5B31 C;  3AN2 A;  4R8P B;  1AOI B;  3KXB A;  4J8U D;  3MGR C;  4WU9 D;  3AZG A;  5B1L C;  3AZF C;  1P3B C;  3AZH B;  4WU8 A;  5E5A C;  4KGC C;  3O62 C;  3X1T D;  3LZ1 A;  1ZLA B;  2CV5 B;  1TAF A;  3LEL B;  1WWI A;  3W97 A;  1U35 A;  3MGP A;  5AV5 D;  3UTB D;  4G92 B;  1KX3 C;  1M1A A;  3WKJ D;  5B33 A;  1F66 C;  3NQJ B;  3W99 A;  5BO0 B;  4M6B A;  5JA4 A;  4R8P D;  5B31 D;  4CAY B;  3MGR D;  3REK B;  4X23 B;  1M19 B;  5CP6 A;  2HUE B;  4XZQ B;  2FJ7 A;  5KDM B;  3VH5 A;  1ZLA D;  4JJN C;  5E5A D;  3MNN C;  3KSY A;  4H9R B;  4H9N A;  3O62 D;  3LEL D;  3REJ A;  3LJA C;  4ZUX C;  5AV8 B;  5AVB B;  3AZK C;  5GT3 A;  5B2J B;  1KX3 D;  4G91 B;  3NQU A;  3AZN C;  3WAA B;  3REL A;  4Z5T B;  3AZL A;  3C1C C;  5BNX B;  1F66 D;  3UTA A;  4NE6 A;  5JRG A;  1S32 C;  5B0Y C;  1P3M C;  5CPK A;  1P3A B;  4X23 D;  4H9O B;  1P3I A;  4XZQ D;  3A6N B;  3AZE A;  2NQB C;  4YM6 B;  5GSU C;  5CPJ A;  3MNN D;  4Z66 B;  5F99 C;  5AV8 D;  4ZUX D;  5AV9 C;  3KWQ B;  5B2J D;  5AY8 B;  3AZK D;  3WA9 B;  5B40 B;  5AV9 B;  1HQ3 C;  4QLC A;  1P34 B;  2ARO C;  3AYW C;  5DNM A;  5B32 A;  4EO5 B;  3C1C D;  3MGQ B;  1P3G C;  1S32 D;  1P3A D;  1P3G B;  1P3L B;  3W98 C;  1P3M D;  3REI B;  2RVQ D;  4J8V A;  3LZ0 C;  4YS3 C;  2HIO A;  1BH8 A;  5GXQ B;  3A6N D;  4LD9 B;  4YS3 B;  4YM6 D;  3WTP C;  5GSU D;  3B6F B;  3C1B C;  5B32 G;  3REH C;  5B0Z B;  3KWQ D;  1B67 A;  3WA9 D;  3MGS C;  5AV9 D;  1M18 A;  3UT9 C;  2PYO C;  4J8V C;  5B24 C;  5CPI B;  2IO5 C;  2ARO D;  2YFW B;  2IO5 B;  3AZJ A;  1TZY A;  1P3G D;  1P3L D;  3AZI B;  3TU4 B;  4H9P B;  3REI D;  3W98 D;  5GT0 B;  4LD9 D;  5GXQ D;  4AWL B;  3LZ0 D;  4YS3 D;  3X1U A;  5B1M A;  2NZD A;  4CSR B;  3B6F D;  3B6G C;  3MVD C;  3REH D;  3W96 A;  4KUD B;  3MGS D;  5CPI D;  5DNN C;  1ID3 C;  1P3K C;  1EQZ C;  3AV1 B;  1EQZ B;  2YFV B;  5BS7 C;  3AZI D;  4E45 A;  4H9S C;  5GT0 D;  3V9R B;  4J8W C;  5AV6 C;  4J8X A;  5G49 A;  1KX4 C;  3B0D C;  1KX5 A;  4XUJ B;  4J8U A;  3X1V A;  3VH6 A;  3AZM B;  3X1T B;  4WU9 A;  3B6G D;  1N1J B;  5B2I B;  5AV5 B;  3UTB B;  4KUD D;  4J8X C;  2BYM B;  1ID3 D;  1EQZ D;  3WKJ B;  4DRB A;  1P3P A;  1P3O B;  5B31 B;  1H3O A;  3MGR B;  3KUY A;  4J8W D;  3B0B A;  5B1L B;  3AZF B;  1P3B B;  4R8P A;  4XUJ D;  1KX4 D;  1AOI A;  4WV4 B;  3AZM D;  4KGC B;  5E5A B;  3O62 B;  3AN2 C;  5B2I D;  3KXB C;  3AZH A;  3KXB B;  3AZG C;  2CV5 A;  1KX3 B;  3LEL A;  2F8N H;  1P3F A;  1F66 B;  4WU8 C;  1P3O D;  3LZ1 C;  3W97 C;  1U35 C;  5BO0 A;  3MGP C;  5B1L D;  3AZF D;  1P3B D;  1M1A C;  4NFT A;  4CAY A;  5B33 C;  4KGC D;  3REK A;  3W99 C;  1KU5 A;  4X23 A;  1M19 A;  4JJN B;  3MNN B;  3W99 B;  4XZQ A;  3AN2 D;  3LJA B;  4HGA C;  3KXB D;  5KDM A;  4ZUX B;  3AZK B;  5CP6 C;  4H9R A;  5BT1 C;  4NE5 A;  2FJ7 C;  3AZN B;  3C1C B;  5AVB A;  4WU8 D;  5B2J A;  1S32 B;  3REJ C;  1JFI B;  5B0Y B;  1P3M B;  3WAA A;  4Z5T A;  5BNX A;  1U35 D;  5GT3 C;  4ZBJ C;  1P3A A;  3REL C;  3AZL C;  2NQB B;  1WWS A;  4H9O A;  5GSU B;  5B33 D;  3W99 D;  4JJN D;  5JRG C;  3UTA C;  3AZL B;  3A6N A;  5F99 B;  3LJA D;  5CPK C;  4YM6 A;  3R45 B;  2L5A A;  1P3I C;  5BNV B;  1HTA A;  5CP6 D;  4Z66 A;  3AV2 A;  3AZN D;  1HQ3 B;  3AZE C;  2ARO B;  2FJ7 D;  3AYW B;  3KWQ A;  5AY8 A;  3WA9 A;  5B40 A;  5CPJ C;  5B0Y D;  1P34 A;  3REJ D;  3W98 B;  3LZ0 B;  3MGQ A;  5GT3 D;  2NQB D;  4QLC C;  3AV2 C;  1P3L A;  3REL D;  3REI A;  3AZL D;  3WTP B;  5DNM C;  5B32 C;  5FUG B;  4LD9 A;  5GXQ A;  3UTA D;  5F99 D;  5JRG D;  3C1B B;  3REH B;  3MGS B;  2HIO C;  2PYO B;  3UT9 B;  1HQ3 D;  4J8V B;  1P3I D;  5B24 B;  5B0Z A;  3AYW D;  3AZE D;  2BYK B;  2YFW A;  4UUZ B;  1M18 C;  4NE3 A;  4Z2M G;  3TU4 A;  3AZI A;  4H9P A;  5GT0 A;  3WTP D;  5DNM D;  3AZJ C;  3B6G B;  5CHL B;  3C1B D;  1TZY C;  2JSS A;  3MVD B;  4CSR A;  3AFA A;  3UT9 D;  2PYO D;  4J8V D;  2HIO D;  5B24 D;  5DNN B;  5B1M C;  3X1U C;  1ID3 B;  1P3K B;  1ULY A;  2NZD C;  4KUD A;  4H9Q B;  5AVC A;  2LY8 A;  3AV1 A;  4J8W B;  3X1S A;  5AV6 B;  3W96 C;  2F8N B;  1M18 D;  1KX4 B;  3B0D B;  3V9R A;  1TZY D;  3MVD D;  4XUJ A;  4J8X B;  3AZM A;  3X1S C;  5DNN D;  3X1T A;  1P3K D;  4WNN B;  3X1U D;  1KX5 C;  3B0C W;  5B2I A;  4J8U C;  5AV5 A;  3UTB A;  3X1V C;  2BYM A;  4WU9 C;  3WKJ A;  5AV6 D;  2F8N D;  1BH9 B;  1P3O A;  5B31 A;  3MGR A;  4KHA B;  5C3I C;  1P3P C;  5B1L A;  3AZF A;  1P3B A;  3AN2 B;  3KUY C;  4J8X D;  1ZLA A;  4KGC A;  5E5A A;  3O62 A;  3KUY B;  3AZG B;  2CWE A;  4R8P C;  1AOI C;  3VH5 T;  1KX5 D;  5B31 G;  4WU8 B;  3X1V D;  3LZ1 B;  1KX3 A;  1TAF B;  3NQJ A;  1B6W A;  3AZH C;  1U35 B;  1F66 A;  3MGP B;  3W97 B;  1ZLA C;  2CV5 C;  1M1A B;  3LEL C;  5B33 B;  1P3F C;  4G92 C;  1P3F B;  5JA4 B;  1P3P D;  4HGA B;  3KUY D;  3AZG D;  4JJN A;  5CP6 B;  3MNN A;  3LJA A;  1A7W A;  5AV8 A;  1AOI D;  2FJ7 B;  4ZUX A;  3REK C;  3AZK A;  4X23 C;  3LZ1 D;  1M19 C;  2HUE C;  4H9N B;  4XZQ C;  3REJ B;  3AZN A;  3W97 D;  3MGP D;  3C1C A;  3AZH D;  3VH6 W;  5GT3 B;  1M1A D;  1S32 A;  4ZBJ B;  2CV5 D;  1JFI A;  3NQU B;  5B0Y A;  1P3M A;  3REL B;  5AVB C;  5AV8 C;  1P3F D;  3UTA B;  5JRG B;  5B2J C;  3B0C T;  4G91 C;  3WAA C;  2NQB A;  4Z5T C;  5CPK B;  5GSU A;  1P3I B;  5BT1 D;  5F99 A;  3AZE B;  1R4V A;  1P3A C;  3R45 A;  5AV9 A;  3REK D;  2RVQ C;  1M19 D;  5BNV A;  5CPJ B;  3A6N C;  1HQ3 A;  2ARO A;  4YM6 C;  3AYW A;  1P3G A;  4Z66 C;  4QLC B;  3W98 A;  3AV2 B;  3KWQ C;  5B32 B;  5AVB D;  5AY8 C;  3LZ0 A;  5DNM B;  4YS3 A;  5B40 C;  3WA9 C;  1P34 C;  5CPK D;  3WAA D;  4Z5T D;  3WTP A;  3B6F A;  5FUG A;  4EO5 C;  2HIO B;  1BH8 B;  3MGQ C;  3C1B A;  3REH A;  1P3L C;  3REI C;  3MGS A;  5CPJ D;  5GXQ C;  3UT9 A;  5CPI A;  2PYO A;  4LD9 C;  5B24 A;  3VH5 W;  1M18 B;  2F8N K;  3B6F C;  4QLC D;  2BYK A;  3AV2 D;  4E44 A;  4Z66 D;  5B0Z C;  4UUZ A;  5B32 D;  3AZJ B;  5AY8 D;  1TZY B;  5B40 D;  5CPI C;  1P34 D;  3B6G A;  3MGQ D;  3X1U B;  5B1M B;  3AZI C;  3TU4 C;  3MVD A;  5GT0 C;  2NZD B;  3VH6 T;  4AWL C;  4DRA A;  1ID3 A;  5DNN A;  1P3K A;  2YFV A;  1EQZ A;  1BFM A;  1Q9C A;  3AFA C;  5BS7 A;  3W96 B;  4H9Q A;  3AFA B;  4WZS B;  4H9S A;  3WTP E;  5B0Z D;  4J8W A;  5AV6 A;  3AZJ D;  2F8N A;  4KUD C;  5AVC C;  1KX4 A;  5AVC B;  3AV1 C;  5G49 B;  1N1J A;  3X1S B;  5B1M D;  1KX5 B;  3TU4 D;  2NZD D;  4Z2M H;  3X1V B; 
#chains in the Genus database with same CATH topology
 2DF4 C;  4WU9 B;  4WNN A;  2F8N G;  4XUJ C;  4J8U B;  3W96 D;  2ZY2 A;  3AZM C;  3AFA D;  3X1T C;  5B2I C;  5AV5 C;  3UTB C;  1BH9 A;  5C3I B;  3A1I A;  1P3P B;  5AVC D;  2DQN C;  3WKJ C;  1H3O B;  3P5J B;  4KHA A;  3AV1 D;  3X1S D;  1F1E A;  1P3O C;  5B31 C;  3AN2 A;  2W8S A;  4R8P B;  3KXB A;  4J8U D;  1AOI B;  3MGR C;  2Y2L A;  4WU9 D;  3AZG A;  5B1L C;  3AZF C;  1P3B C;  2UWX A;  1W2E A;  3AZH B;  4WU8 A;  5E5A C;  4KGC C;  3O62 C;  3X1T D;  3LZ1 A;  1ZLA B;  2CV5 B;  1TAF A;  3LEL B;  1WWI A;  3W97 A;  1U35 A;  3MGP A;  5AV5 D;  3UTB D;  4G92 B;  1KX3 C;  1M1A A;  3WKJ D;  5B33 A;  1F66 C;  3NQJ B;  3W99 A;  5BO0 B;  4M6B A;  5JA4 A;  4R8P D;  5B31 D;  4CAY B;  3MGR D;  3REK B;  4X23 B;  1M19 B;  5CP6 A;  2HUE B;  3EPJ A;  4XZQ B;  2FJ7 A;  5KDM B;  3VH5 A;  1ZLA D;  4JJN C;  5E5A D;  3MNN C;  3KSY A;  4H9R B;  4H9N A;  3O62 D;  3LEL D;  3REJ A;  3LJA C;  4ZUX C;  5AV8 B;  5AVB B;  3AZK C;  5GT3 A;  3KFU G;  5B2J B;  1KX3 D;  4G91 B;  3NQU A;  3AZN C;  3WAA B;  3REL A;  4Z5T B;  3AZL A;  3C1C C;  5BNX B;  1F66 D;  3UTA A;  4NE6 A;  5JRG A;  1S32 C;  5B0Y C;  1P3M C;  5CPK A;  1P3A B;  4X23 D;  4H9O B;  1P3I A;  4XZQ D;  3A6N B;  3AZE A;  2NQB C;  4YM6 B;  5GSU C;  5CPJ A;  3MNN D;  4Z66 B;  5F99 C;  5AV8 D;  2F2A C;  4ZUX D;  5AV9 C;  3KWQ B;  5B2J D;  5AY8 B;  3AZK D;  3WA9 B;  5B40 B;  5AV9 B;  1HQ3 C;  4QLC A;  1P34 B;  2ARO C;  3AYW C;  3AL0 C;  5DNM A;  5B32 A;  4EO5 B;  3C1C D;  3MGQ B;  1P3G C;  1S32 D;  1P3A D;  1P3G B;  1P3L B;  3W98 C;  1P3M D;  3A1K A;  3REI B;  2RVQ D;  4J8V A;  3LZ0 C;  4YS3 C;  2HIO A;  1BH8 A;  5GXQ B;  3A6N D;  4LD9 B;  4YS3 B;  4YM6 D;  3WTP C;  5GSU D;  3B6F B;  3C1B C;  5B32 G;  3REH C;  5B0Z B;  3KWQ D;  1B67 A;  3WA9 D;  3MGS C;  2VQR A;  5AV9 D;  3UT9 C;  1M18 A;  2PYO C;  4J8V C;  5B24 C;  5CPI B;  2IO5 C;  2ARO D;  2YFW B;  2IO5 B;  3AZJ A;  1TZY A;  1P3G D;  1P3L D;  3AZI B;  3TU4 B;  4H9P B;  3REI D;  3W98 D;  5GT0 B;  4LD9 D;  5GXQ D;  4AWL B;  1PZR A;  3LZ0 D;  4YS3 D;  3X1U A;  5B1M A;  2NZD A;  4CSR B;  3B6F D;  3B6G C;  3MVD C;  3REH D;  3W96 A;  4KUD B;  3MGS D;  3EPL A;  5CPI D;  5DNN C;  1ID3 C;  1P3K C;  1EQZ C;  2XD1 A;  3AV1 B;  1EQZ B;  2YFV B;  5BS7 C;  3AZI D;  4E45 A;  4H9S C;  5GT0 D;  3V9R B;  4J8W C;  5AV6 C;  4J8X A;  5G49 A;  3FDD A;  1KX4 C;  3B0D C;  1KX5 A;  4DQY B;  4XUJ B;  4J8U A;  3X1V A;  3VH6 A;  3AZM B;  3X1T B;  4WU9 A;  3B6G D;  1N1J B;  5B2I B;  5AV5 B;  3UTB B;  4KUD D;  4J8X C;  2BYM B;  1ID3 D;  1EQZ D;  3WKJ B;  4DRB A;  1P3P A;  1P3O B;  5B31 B;  1H3O A;  3MGR B;  3KUY A;  4J8W D;  3B0B A;  5B1L B;  3AZF B;  1P3B B;  4R8P A;  4XUJ D;  1KX4 D;  1AOI A;  4WV4 B;  3AZM D;  4KGC B;  2Y2Q A;  5E5A B;  3O62 B;  3AN2 C;  5B2I D;  3KXB C;  1T3U A;  3AZH A;  3KXB B;  2JCH A;  3AZG C;  3EPH A;  2CV5 A;  1KX3 B;  2Y2O A;  3LEL A;  2F8N H;  1P3F A;  1F66 B;  4WU8 C;  1P3O D;  3LZ1 C;  2ZY4 A;  3W97 C;  1U35 C;  5BO0 A;  3MGP C;  4WJ3 C;  5B1L D;  3AZF D;  1P3B D;  2ZY3 A;  1M1A C;  4NFT A;  4CAY A;  5B33 C;  4KGC D;  3REK A;  3W99 C;  1KU5 A;  4X23 A;  1M19 A;  4JJN B;  3MNN B;  3W99 B;  4XZQ A;  3AN2 D;  3LJA B;  4HGA C;  3KXB D;  5KDM A;  4ZUX B;  3AZK B;  5CP6 C;  4H9R A;  5BT1 C;  4NE5 A;  2FJ7 C;  3AZN B;  3C1C B;  5AVB A;  4WU8 D;  5B2J A;  1S32 B;  3REJ C;  1JFI B;  5B0Y B;  1P3M B;  3WAA A;  4Z5T A;  5BNX A;  3IP4 C;  1U35 D;  5GT3 C;  4ZBJ C;  1P3A A;  3REL C;  3AZL C;  2NQB B;  1WWS A;  4H9O A;  2Y2I A;  5GSU B;  3W99 D;  2JE5 A;  5JRG C;  5B33 D;  4JJN D;  3UTA C;  3AZL B;  3A6N A;  5F99 B;  3LJA D;  5CPK C;  4YM6 A;  3R45 B;  2ZM5 A;  2L5A A;  1P3I C;  5BNV B;  1HTA A;  5CP6 D;  4Z66 A;  3AV2 A;  3AZN D;  1HQ3 B;  3AZE C;  2ARO B;  2FJ7 D;  3AYW B;  3KWQ A;  5AY8 A;  3WA9 A;  5B40 A;  5CPJ C;  5B0Y D;  1P34 A;  3REJ D;  3W98 B;  3LZ0 B;  3MGQ A;  5GT3 D;  2NQB D;  4QLC C;  3AV2 C;  1P3L A;  3REL D;  3REI A;  3AZL D;  3WTP B;  5DNM C;  5B32 C;  5FUG B;  4LD9 A;  5GXQ A;  3UTA D;  5F99 D;  5JRG D;  3C1B B;  3REH B;  3MGS B;  2HIO C;  2PYO B;  3UT9 B;  1HQ3 D;  4J8V B;  1P3I D;  5B24 B;  5B0Z A;  3AYW D;  3AZE D;  2BYK B;  2YFW A;  4UUZ B;  2Y2H A;  1M18 C;  4NE3 A;  4Z2M G;  3TU4 A;  3AZI A;  4H9P A;  5GT0 A;  3WTP D;  5DNM D;  3AZJ C;  3B6G B;  5CHL B;  3C1B D;  1TZY C;  2JSS A;  3MVD B;  4CSR A;  3AFA A;  3F6T A;  3UT9 D;  2PYO D;  4J8V D;  2HIO D;  5B24 D;  5DNN B;  5B1M C;  3X1U C;  1ID3 B;  1P3K B;  1ULY A;  2NZD C;  4KUD A;  4H9Q B;  5AVC A;  2LY8 A;  3AV1 A;  4J8W B;  3X1S A;  5AV6 B;  3W96 C;  2F8N B;  1M18 D;  1KX4 B;  3B0D B;  3V9R A;  2XD5 A;  3H0R C;  1TZY D;  3MVD D;  2Y2J A;  4XUJ A;  4J8X B;  3AZM A;  3X1S C;  5DNN D;  3X1T A;  1P3K D;  4WNN B;  3X1U D;  1KX5 C;  3B0C W;  5B2I A;  4J8U C;  5AV5 A;  3UTB A;  3X1V C;  2BYM A;  2RIQ A;  4WU9 C;  1Z2C B;  3WKJ A;  5AV6 D;  2Y2N A;  2F8N D;  2FFF B;  1BH9 B;  1P3O A;  5B31 A;  3MGR A;  4KHA B;  5C3I C;  1P3P C;  2Y2P A;  5B1L A;  3AZF A;  1P3B A;  3AN2 B;  3KUY C;  4J8X D;  1ZLA A;  4KGC A;  5E5A A;  3O62 A;  3KUY B;  3AZG B;  2CWE A;  4R8P C;  2G5I C;  1AOI C;  3VH5 T;  1KX5 D;  5B31 G;  4WU8 B;  3X1V D;  3LZ1 B;  1KX3 A;  1TAF B;  3NQJ A;  1B6W A;  2ZY5 A;  3AZH C;  1U35 B;  1F66 A;  3MGP B;  3W97 B;  1ZLA C;  2CV5 C;  1M1A B;  3LEL C;  5B33 B;  1P3F C;  4G92 C;  1P3F B;  5JA4 B;  1P3P D;  4UPK A;  4HGA B;  3KUY D;  3AZG D;  4JJN A;  5CP6 B;  3MNN A;  3LJA A;  1A7W A;  5AV8 A;  1AOI D;  2FJ7 B;  4ZUX A;  3REK C;  3AZK A;  4X23 C;  3LZ1 D;  1M19 C;  2HUE C;  4H9N B;  4XZQ C;  3REJ B;  3AZN A;  3W97 D;  3MGP D;  3C1C A;  3AZH D;  3VH6 W;  5GT3 B;  1M1A D;  1S32 A;  4ZBJ B;  2G5H C;  2CV5 D;  3NQU B;  5B0Y A;  1P3M A;  1JFI A;  3REL B;  5AVB C;  5AV8 C;  1P3F D;  3UTA B;  5JRG B;  5B2J C;  3B0C T;  4G91 C;  3WAA C;  2NQB A;  4Z5T C;  5CPK B;  2Y2G A;  5GSU A;  1P3I B;  5BT1 D;  5F99 A;  3AZE B;  1R4V A;  1P3A C;  3R45 A;  2BG1 A;  5AV9 A;  3REK D;  2RVQ C;  1M19 D;  5BNV A;  5CPJ B;  3A6N C;  1HQ3 A;  2ARO A;  4YM6 C;  3AYW A;  1P3G A;  4Z66 C;  4QLC B;  3W98 A;  3AV2 B;  3H0L C;  3KWQ C;  5B32 B;  5AVB D;  5AY8 C;  3LZ0 A;  5DNM B;  4YS3 A;  5B40 C;  3WA9 C;  1P34 C;  5CPK D;  3WAA D;  4Z5T D;  3WTP A;  3B6F A;  5FUG A;  4EO5 C;  2HIO B;  1BH8 B;  3MGQ C;  3C1B A;  3REH A;  1P3L C;  3REI C;  3MGS A;  5CPJ D;  5GXQ C;  3UT9 A;  5CPI A;  3H0M C;  2PYO A;  4LD9 C;  5B24 A;  3VH5 W;  3EG5 B;  1M18 B;  2F8N K;  3B6F C;  4QLC D;  2BYK A;  3AV2 D;  4E44 A;  4Z66 D;  5B0Z C;  4UUZ A;  5B32 D;  3AZJ B;  5AY8 D;  1TZY B;  5B40 D;  5CPI C;  1P34 D;  2Y2M A;  3B6G A;  3MGQ D;  3X1U B;  5B1M B;  3AZI C;  3TU4 C;  3MVD A;  5GT0 C;  2NZD B;  3VH6 T;  4AWL C;  4DRA A;  1ID3 A;  5DNN A;  1P3K A;  2YFV A;  1EQZ A;  1BFM A;  1Q9C A;  3AFA C;  5BS7 A;  3W96 B;  4H9Q A;  3AFA B;  4WZS B;  4H9S A;  3EPK A;  3WTP E;  5B0Z D;  4J8W A;  5AV6 A;  3AZJ D;  2F8N A;  4KUD C;  5AVC C;  1KX4 A;  5AVC B;  3AV1 C;  5G49 B;  1N1J A;  2Y2K A;  3X1S B;  5B1M D;  2J8P A;  1KX5 B;  3TU4 D;  2NZD D;  4Z2M H;  3X1V B; 
#chains in the Genus database with same CATH homology
 2DF4 C;  4WU9 B;  4WNN A;  2F8N G;  4XUJ C;  4J8U B;  3W96 D;  2ZY2 A;  3AZM C;  3AFA D;  3X1T C;  5B2I C;  5AV5 C;  3UTB C;  1BH9 A;  5C3I B;  3A1I A;  1P3P B;  5AVC D;  2DQN C;  3WKJ C;  1H3O B;  3P5J B;  4KHA A;  3AV1 D;  3X1S D;  1F1E A;  1P3O C;  5B31 C;  3AN2 A;  2W8S A;  4R8P B;  3KXB A;  4J8U D;  1AOI B;  3MGR C;  2Y2L A;  4WU9 D;  3AZG A;  5B1L C;  3AZF C;  1P3B C;  2UWX A;  1W2E A;  3AZH B;  4WU8 A;  5E5A C;  4KGC C;  3O62 C;  3X1T D;  3LZ1 A;  1ZLA B;  2CV5 B;  1TAF A;  3LEL B;  1WWI A;  3W97 A;  1U35 A;  3MGP A;  5AV5 D;  3UTB D;  4G92 B;  1KX3 C;  1M1A A;  3WKJ D;  5B33 A;  1F66 C;  3NQJ B;  3W99 A;  5BO0 B;  4M6B A;  5JA4 A;  4R8P D;  5B31 D;  4CAY B;  3MGR D;  3REK B;  4X23 B;  1M19 B;  5CP6 A;  2HUE B;  3EPJ A;  4XZQ B;  2FJ7 A;  5KDM B;  3VH5 A;  1ZLA D;  4JJN C;  5E5A D;  3MNN C;  3KSY A;  4H9R B;  4H9N A;  3O62 D;  3LEL D;  3REJ A;  3LJA C;  4ZUX C;  5AV8 B;  5AVB B;  3AZK C;  5GT3 A;  3KFU G;  5B2J B;  1KX3 D;  4G91 B;  3NQU A;  3AZN C;  3WAA B;  3REL A;  4Z5T B;  3AZL A;  3C1C C;  5BNX B;  1F66 D;  3UTA A;  4NE6 A;  5JRG A;  1S32 C;  5B0Y C;  1P3M C;  5CPK A;  1P3A B;  4X23 D;  4H9O B;  1P3I A;  4XZQ D;  3A6N B;  3AZE A;  2NQB C;  4YM6 B;  5GSU C;  5CPJ A;  3MNN D;  4Z66 B;  5F99 C;  5AV8 D;  2F2A C;  4ZUX D;  5AV9 C;  3KWQ B;  5B2J D;  5AY8 B;  3AZK D;  3WA9 B;  5B40 B;  5AV9 B;  1HQ3 C;  4QLC A;  1P34 B;  2ARO C;  3AYW C;  3AL0 C;  5DNM A;  5B32 A;  4EO5 B;  3C1C D;  3MGQ B;  1P3G C;  1S32 D;  1P3A D;  1P3G B;  1P3L B;  3W98 C;  1P3M D;  3A1K A;  3REI B;  2RVQ D;  4J8V A;  3LZ0 C;  4YS3 C;  2HIO A;  1BH8 A;  5GXQ B;  3A6N D;  4LD9 B;  4YS3 B;  4YM6 D;  3WTP C;  5GSU D;  3B6F B;  3C1B C;  5B32 G;  3REH C;  5B0Z B;  3KWQ D;  1B67 A;  3WA9 D;  3MGS C;  2VQR A;  5AV9 D;  3UT9 C;  1M18 A;  2PYO C;  4J8V C;  5B24 C;  5CPI B;  2IO5 C;  2ARO D;  2YFW B;  2IO5 B;  3AZJ A;  1TZY A;  1P3G D;  1P3L D;  3AZI B;  3TU4 B;  4H9P B;  3REI D;  3W98 D;  5GT0 B;  4LD9 D;  5GXQ D;  4AWL B;  1PZR A;  3LZ0 D;  4YS3 D;  3X1U A;  5B1M A;  2NZD A;  4CSR B;  3B6F D;  3B6G C;  3MVD C;  3REH D;  3W96 A;  4KUD B;  3MGS D;  3EPL A;  5CPI D;  5DNN C;  1ID3 C;  1P3K C;  1EQZ C;  2XD1 A;  3AV1 B;  1EQZ B;  2YFV B;  5BS7 C;  3AZI D;  4E45 A;  4H9S C;  5GT0 D;  3V9R B;  4J8W C;  5AV6 C;  4J8X A;  5G49 A;  3FDD A;  1KX4 C;  3B0D C;  1KX5 A;  4DQY B;  4XUJ B;  4J8U A;  3X1V A;  3VH6 A;  3AZM B;  3X1T B;  4WU9 A;  3B6G D;  1N1J B;  5B2I B;  5AV5 B;  3UTB B;  4KUD D;  4J8X C;  2BYM B;  1ID3 D;  1EQZ D;  3WKJ B;  4DRB A;  1P3P A;  1P3O B;  5B31 B;  1H3O A;  3MGR B;  3KUY A;  4J8W D;  3B0B A;  5B1L B;  3AZF B;  1P3B B;  4R8P A;  4XUJ D;  1KX4 D;  1AOI A;  4WV4 B;  3AZM D;  4KGC B;  2Y2Q A;  5E5A B;  3O62 B;  3AN2 C;  5B2I D;  3KXB C;  1T3U A;  3AZH A;  3KXB B;  2JCH A;  3AZG C;  3EPH A;  2CV5 A;  1KX3 B;  2Y2O A;  3LEL A;  2F8N H;  1P3F A;  1F66 B;  4WU8 C;  1P3O D;  3LZ1 C;  2ZY4 A;  3W97 C;  1U35 C;  5BO0 A;  3MGP C;  4WJ3 C;  5B1L D;  3AZF D;  1P3B D;  2ZY3 A;  1M1A C;  4NFT A;  4CAY A;  5B33 C;  4KGC D;  3REK A;  3W99 C;  1KU5 A;  4X23 A;  1M19 A;  4JJN B;  3MNN B;  3W99 B;  4XZQ A;  3AN2 D;  3LJA B;  4HGA C;  3KXB D;  5KDM A;  4ZUX B;  3AZK B;  5CP6 C;  4H9R A;  5BT1 C;  4NE5 A;  2FJ7 C;  3AZN B;  3C1C B;  5AVB A;  4WU8 D;  5B2J A;  1S32 B;  3REJ C;  1JFI B;  5B0Y B;  1P3M B;  3WAA A;  4Z5T A;  5BNX A;  3IP4 C;  1U35 D;  5GT3 C;  4ZBJ C;  1P3A A;  3REL C;  3AZL C;  2NQB B;  1WWS A;  4H9O A;  2Y2I A;  5GSU B;  3W99 D;  2JE5 A;  5JRG C;  5B33 D;  4JJN D;  3UTA C;  3AZL B;  3A6N A;  5F99 B;  3LJA D;  5CPK C;  4YM6 A;  3R45 B;  2ZM5 A;  2L5A A;  1P3I C;  5BNV B;  1HTA A;  5CP6 D;  4Z66 A;  3AV2 A;  3AZN D;  1HQ3 B;  3AZE C;  2ARO B;  2FJ7 D;  3AYW B;  3KWQ A;  5AY8 A;  3WA9 A;  5B40 A;  5CPJ C;  5B0Y D;  1P34 A;  3REJ D;  3W98 B;  3LZ0 B;  3MGQ A;  5GT3 D;  2NQB D;  4QLC C;  3AV2 C;  1P3L A;  3REL D;  3REI A;  3AZL D;  3WTP B;  5DNM C;  5B32 C;  5FUG B;  4LD9 A;  5GXQ A;  3UTA D;  5F99 D;  5JRG D;  3C1B B;  3REH B;  3MGS B;  2HIO C;  2PYO B;  3UT9 B;  1HQ3 D;  4J8V B;  1P3I D;  5B24 B;  5B0Z A;  3AYW D;  3AZE D;  2BYK B;  2YFW A;  4UUZ B;  2Y2H A;  1M18 C;  4NE3 A;  4Z2M G;  3TU4 A;  3AZI A;  4H9P A;  5GT0 A;  3WTP D;  5DNM D;  3AZJ C;  3B6G B;  5CHL B;  3C1B D;  1TZY C;  2JSS A;  3MVD B;  4CSR A;  3AFA A;  3F6T A;  3UT9 D;  2PYO D;  4J8V D;  2HIO D;  5B24 D;  5DNN B;  5B1M C;  3X1U C;  1ID3 B;  1P3K B;  1ULY A;  2NZD C;  4KUD A;  4H9Q B;  5AVC A;  2LY8 A;  3AV1 A;  4J8W B;  3X1S A;  5AV6 B;  3W96 C;  2F8N B;  1M18 D;  1KX4 B;  3B0D B;  3V9R A;  2XD5 A;  3H0R C;  1TZY D;  3MVD D;  2Y2J A;  4XUJ A;  4J8X B;  3AZM A;  3X1S C;  5DNN D;  3X1T A;  1P3K D;  4WNN B;  3X1U D;  1KX5 C;  3B0C W;  5B2I A;  4J8U C;  5AV5 A;  3UTB A;  3X1V C;  2BYM A;  2RIQ A;  4WU9 C;  1Z2C B;  3WKJ A;  5AV6 D;  2Y2N A;  2F8N D;  2FFF B;  1BH9 B;  1P3O A;  5B31 A;  3MGR A;  4KHA B;  5C3I C;  1P3P C;  2Y2P A;  5B1L A;  3AZF A;  1P3B A;  3AN2 B;  3KUY C;  4J8X D;  1ZLA A;  4KGC A;  5E5A A;  3O62 A;  3KUY B;  3AZG B;  2CWE A;  4R8P C;  2G5I C;  1AOI C;  3VH5 T;  1KX5 D;  5B31 G;  4WU8 B;  3X1V D;  3LZ1 B;  1KX3 A;  1TAF B;  3NQJ A;  1B6W A;  2ZY5 A;  3AZH C;  1U35 B;  1F66 A;  3MGP B;  3W97 B;  1ZLA C;  2CV5 C;  1M1A B;  3LEL C;  5B33 B;  1P3F C;  4G92 C;  1P3F B;  5JA4 B;  1P3P D;  4UPK A;  4HGA B;  3KUY D;  3AZG D;  4JJN A;  5CP6 B;  3MNN A;  3LJA A;  1A7W A;  5AV8 A;  1AOI D;  2FJ7 B;  4ZUX A;  3REK C;  3AZK A;  4X23 C;  3LZ1 D;  1M19 C;  2HUE C;  4H9N B;  4XZQ C;  3REJ B;  3AZN A;  3W97 D;  3MGP D;  3C1C A;  3AZH D;  3VH6 W;  5GT3 B;  1M1A D;  1S32 A;  4ZBJ B;  2G5H C;  2CV5 D;  3NQU B;  5B0Y A;  1P3M A;  1JFI A;  3REL B;  5AVB C;  5AV8 C;  1P3F D;  3UTA B;  5JRG B;  5B2J C;  3B0C T;  4G91 C;  3WAA C;  2NQB A;  4Z5T C;  5CPK B;  2Y2G A;  5GSU A;  1P3I B;  5BT1 D;  5F99 A;  3AZE B;  1R4V A;  1P3A C;  3R45 A;  2BG1 A;  5AV9 A;  3REK D;  2RVQ C;  1M19 D;  5BNV A;  5CPJ B;  3A6N C;  1HQ3 A;  2ARO A;  4YM6 C;  3AYW A;  1P3G A;  4Z66 C;  4QLC B;  3W98 A;  3AV2 B;  3H0L C;  3KWQ C;  5B32 B;  5AVB D;  5AY8 C;  3LZ0 A;  5DNM B;  4YS3 A;  5B40 C;  3WA9 C;  1P34 C;  5CPK D;  3WAA D;  4Z5T D;  3WTP A;  3B6F A;  5FUG A;  4EO5 C;  2HIO B;  1BH8 B;  3MGQ C;  3C1B A;  3REH A;  1P3L C;  3REI C;  3MGS A;  5CPJ D;  5GXQ C;  3UT9 A;  5CPI A;  3H0M C;  2PYO A;  4LD9 C;  5B24 A;  3VH5 W;  3EG5 B;  1M18 B;  2F8N K;  3B6F C;  4QLC D;  2BYK A;  3AV2 D;  4E44 A;  4Z66 D;  5B0Z C;  4UUZ A;  5B32 D;  3AZJ B;  5AY8 D;  1TZY B;  5B40 D;  5CPI C;  1P34 D;  2Y2M A;  3B6G A;  3MGQ D;  3X1U B;  5B1M B;  3AZI C;  3TU4 C;  3MVD A;  5GT0 C;  2NZD B;  3VH6 T;  4AWL C;  4DRA A;  1ID3 A;  5DNN A;  1P3K A;  2YFV A;  1EQZ A;  1BFM A;  1Q9C A;  3AFA C;  5BS7 A;  3W96 B;  4H9Q A;  3AFA B;  4WZS B;  4H9S A;  3EPK A;  3WTP E;  5B0Z D;  4J8W A;  5AV6 A;  3AZJ D;  2F8N A;  4KUD C;  5AVC C;  1KX4 A;  5AVC B;  3AV1 C;  5G49 B;  1N1J A;  2Y2K A;  3X1S B;  5B1M D;  2J8P A;  1KX5 B;  3TU4 D;  2NZD D;  4Z2M H;  3X1V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...