3MGPB

Binding of cobalt ions to the nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpB00
1HTAA 3X1VB 1KX3A 4CSRB 1KX3D 3W97B 3W98B 1P3KC 4G91B 5BNVA 5GT3A 4XZQB 4AWLB 4QLCB 3C1CD 3X1VA 4ZBJB 3KUYA 3AZHA 3B0CT 5AVBD 5GT3D 3UTAA 3X1TA 4CSRA 4J8XC 3REIC 1P3ID 3MGRC 3UTAD 3X1TD 3MGPA 3TU4D 3AZIB 3AZLD 5B40A 5B33A 4JJNC 1M18B 4UUZB 3MGPD 3AZGA 5B33D 5F99C 1BH9B 3LELA 3W96D 3AZGD 2YFVB 3REKC 1M18A 5CHLB 1U35A 3LELD 4WNNB 3KXBB 5GXQC 3WAAA 1AOID 1U35D 1BH9A 3WAAD 1S32C 4WNNA 1P3KB 4ZUXC 3KXBA 2RVQC 4H9QB 3O62D 3AV2C 3X1SA 3B6FA 5GT0B 1HQ3D 3AZND 4Z66C 2HIOD 3X1SD 1N1JB 5B31C 2JSSA 3B6FD 3MGRB 3LJAC 5AY8D 1KX4C 5AV9C 5FUGA 5GT0A 1P3AC 3UTBA 5F99B 5B1LC 3AZJB 3AN2C 4WU8A 1P3BC 5GXQB 1F66C 1H3OA 2L5AA 3AZJA 1B67A 4KUDB 4ZUXB 3MNNA 5BT1C 1JFIA 3AV2B 1M1AC 4Z66B 5CPKB 2F8NK 4KHAA 3LZ0C 5CP6C 5AV8D 5B31B 4KUDA 4DRBA 5DNMD 1WWIA 5AV6B 1KX4B 1KX5C 5AV9B 3RELB 4J8VA 3AZFD 4KGCB 3VH6A 5CPKA 1P3AB 5B32G 4J8VD 2BYMB 5B1LB 4YM6A 1P3GB 5AV6A 3AN2B 4R8PC 1P34C 3RELA 4YM6D 4KGCA 3MGQA 1P3BB 3VH5W 1P3LB 3MGQD 1P3GA 3AN2A 3B6GD 2PYOA 2AROA 1P3PC 1TZYA 3KWQC 1P3LA 2PYOD 3AZEA 3REHA 2AROD 3UT9D 4YS3A 1M1AB 3WA9C 3LZ0B 1M19D 1TZYD 5B1MA 5CP6B 3AZED 1ID3C 4YS3D 5B2JB 5B1MD 1KX5B 5B0ZA 5CPJB 3WKJA 1F1EA 1P3MA 5B0ZD 4NFTA 5B24A 3MGSB 3B0DC 3WKJD 5B2JA 1P3MD 3B0CW 3WTPB 3AZMA 1P34B 3W99B 5CPJA 3X1UA 5JRGC 3A6NA 3C1CC 3AZKA 3AV1C 4X23C 5AVBC 3MGSA 3V9RB 3LZ1A 3REJD 1WWSA 3A6ND 1P3IC 3WTPA 5AV5C 3W99A 4J8WA 2FJ7A 3TU4C 5CPIA 3LZ1D 1P3PB 4J8WD 2FJ7D 2NZDC 5CPID 3WA9B 4WU9A 5B32D 3C1BB 3W96C 1ID3B 4WU9D 3AFAC 2NQBA 2IO5C 2NQBD 1BH8B 1AOIC 5E5AC 3C1BA 1ZLAC 3B0DB 2CV5B 3X1VD 3W97A 3KUYD 3AZHD 4H9SC 3NQUB 3W98A 4XZQA 3O62C 4QLCA 3W97D 3W98D 5JRGB 3C1CB 3AV1B 2F8NH 1HQ3C 4X23B 3AZNC 4XZQD 2HIOC 5B40D 4QLCD 2CV5A 1P3IB 3NQUA 4Z5TC 5AV5B 3AZIA 5AY8C 4UUZA 4NE5A 3AZID 2NZDB 1M18D 4XUJB 2YFVA 3W96B 3AFAB 1P3OC 1A7WA 4Z2MH 5B0YC 2IO5B 4XUJA 1AOIB 5E5AB 3KXBD 2LY8A 5BNXB 1ZLAB 4J8XB 3REIB 3WTPE 1P3KA 4H9QA 2HUEC 4JJNB 1P3KD 1HQ3B 5BNXA 1P3FC 1ZLAA 4J8XA 1N1JA 3REIA 1R4VA 5G49B 5AV8C 5GT0D 3MGRA 2F8NB 4Z5TB 5DNMC 3REKB 3UTBD 4LD9C 4JJNA 4H9OB 4CAYB 3MGRD 3AZFC 5B2IC 5F99A 4WU8D 2F8NA 3REKA 5AVCC 5F99D 4HGAC 3R45B 1S32B 3AZJD 1P3OB 5GXQA 5B0YB 3MNND 3B6GC 5GXQD 1S32A 4ZUXA 3LJAB 2HUEB 3AV2A 4H9PB 5BS7C 4KUDD 4ZUXD 4Z66A 3VH6W 3UT9C 1P3FB 3AV2D 5B31A 1M19C 4Z66D 5CPKD 5DNMB 3LJAA 4LD9B 1KX4A 5B31D 5AV9A 5AV6D 1P3AA 1KX4D 5BO0B 5B2IB 5AV9D 3RELD 2BYMA 5B1LA 1F66B 4KGCD 5GSUC 1P3AD 4J8UC 1EQZC 5AVCB 5B1LD 4HGAB 5KDMB 1P3GD 3AN2D 1P3BA 3MVDC 3AYWC 1F66A 1P3BD 4WZSB 1P3LD 3REHD 3VH6T 1TAFB 3NQJB 5DNNC 1M1AA 5BT1D 3LZ0A 5CP6A 1B6WA 1M19B 5B32C 1M1AD 4R8PB 3LZ0D 5CP6D 1KX5A 1KX3C 5B24D 5B2JD 1KX5D 3AZMD 5CPJD 5GSUB 5GT3C 4R8PA 3X1UD 4J8UB 1EQZB 3AZKD 3X1VC 3KUYC 3AZHC 4DRAA 3UTAC 3X1TC 1P34A 3MGSD 3AZLC 3MVDB 3AYWB 3WTPD 1P34D 3W99D 3KWQB 3MGPC 4H9NB 3V9RA 5C3IC 5B40C 2YFWB 5B33C 1BFMA 3AZGC 2BYKB 1P3PA 5DNNB 3KWQA 3LELC 4H9NA 3WA9A 1P3PD 2YFWA 1M18C 1U35C 5B32B 1ID3A 3WA9D 3WAAC 3C1BD 1KX3B 5JA4B 1ID3D 1BH8A 5BNVB 3KXBC 5AVBB 5GT3B 3X1SC 3B6FC 5JA4A 3KUYB 1KU5A 3UTAB 3AZHB 3X1TB 3TU4B 3AZLB 2CV5D 5JRGA 3C1CA 3AV1A 4X23A 3MGPB 5AVBA 5C3IB 5B40B 4Z2MG 5B33B 5JRGD 3AV1D 5GT0C 1P3IA 5AV5A 4X23D 5B31G 3AZGB 3TU4A 3AZLA 3UTBC 5AV5D 3LELB 2NZDA 4WU8C 1U35B 2NZDD 4E45A 3W96A 4E44A 4XUJD 3AFAA 3WAAB 3AZJC 3AFAD 3O62B 1AOIA 5E5AA 4G92C 3AZNB 3MNNC 2HIOB 5E5AD 3X1SB 3B6FB 4H9SA 1ZLAD 4J8XD 3REID 3O62A 5AY8B 4WV4B 4KUDC 1HQ3A 3AZNA 2HIOA 4JJND 5G49A 5FUGB 4J8VC 4Z5TA 5CPKC 1Q9CA 4H9OA 5AY8A 3UTBB 2F8ND 4CAYA 4Z5TD 4YM6C 5AV6C 3REKD 3RELC 4WU8B 4KGCC 3MGQC 3R45A 1P3OA 1H3OB 1P3GC 5B0YA 1S32D 1P3OD 2PYOC 4G92B 2RVQD 2AROC 5B0YD 3MNNB 1JFIB 1TZYC 1P3LC 5AV8B 3AZEC 3REHC 4YS3C 4KHAB 4H9PA 5B1MC 3AZFB 3LJAD 1P3FA 5AV8A 4NE3A 5B0ZC 4J8VB 1P3FD 5DNMA 4LD9A 3WKJC 1ULYA 1P3MC 3AZFA 4YM6B 5B24C 4LD9D 5BO0A 5B2JC 5B2IA 3AZMC 5CPJC 3MGQB 3B6GB 5AVCA 4NE6A 5B2ID 3X1UC 3A6NC 3REJC 3AZKC 3KSYA 1F66D 5KDMA 3MGSC 3LZ1C 5AVCD 3WTPC 3W99C 4J8WC 2FJ7C 2PYOB 4EO5C 5CPIC 3B6GA 2AROB 4M6BA 3VH5A 3UT9B 1TZYB 3AZEB 3REHB 4YS3B 1TAFA 3NQJA 4WU9C 5BS7A 5B1MB 3UT9A 2NQBC 1M19A 5B0ZB 3WKJB 1P3MB 3C1BC 4R8PD 5B24B 3W97C 4H9RB 3W98C 4G91C 3AZMB 5GSUA 4XZQC 4J8UA 4AWLC 4QLCC 1EQZA 3X1UB 3REJB 4ZBJC 3A6NB 3AZKB 3B0BA 5GSUD 3MVDA 4J8UD 1EQZD 3LZ1B 2CV5C 3AYWA 4H9RA 3VH5T 3AZIC 4J8WB 2FJ7B 4EO5B 3MVDD 5CPIB 3AYWD 3REJA 3KWQD 2F8NG 2CWEA 2BYKA 5DNNA 4WU9B 5DNND 2NQBB 5B32A 4XUJC
chains in the Genus database with same CATH superfamily
1HTAA 3X1VB 1KX3A 4CSRB 1KX3D 3W97B 3W98B 1P3KC 4G91B 5BNVA 5GT3A 4XZQB 4AWLB 4QLCB 3C1CD 3X1VA 4ZBJB 3KUYA 3AZHA 3B0CT 5AVBD 5GT3D 3UTAA 3X1TA 4CSRA 2J8PA 4J8XC 3P5JB 3REIC 1P3ID 3MGRC 3UTAD 3X1TD 3MGPA 3TU4D 3AZIB 3AZLD 5B40A 5B33A 4JJNC 1M18B 4UUZB 3MGPD 3AZGA 5B33D 5F99C 1BH9B 3LELA 3W96D 3AZGD 2YFVB 3REKC 2Y2GA 1M18A 5CHLB 1U35A 3LELD 4WNNB 3KXBB 5GXQC 3WAAA 1AOID 1U35D 1BH9A 3H0LC 3WAAD 1S32C 4WNNA 1P3KB 4ZUXC 3KXBA 2RVQC 4H9QB 3O62D 3AV2C 3X1SA 3B6FA 5GT0B 1HQ3D 3AZND 4Z66C 2HIOD 3H0RC 3X1SD 1N1JB 5B31C 2JSSA 3EG5B 3B6FD 3MGRB 3EPHA 3LJAC 5AY8D 1KX4C 5AV9C 5FUGA 5GT0A 3AL0C 1P3AC 3UTBA 5F99B 5B1LC 3AZJB 3AN2C 4WU8A 1P3BC 3H0MC 5GXQB 1F66C 1H3OA 2L5AA 3AZJA 3IP4C 1B67A 4KUDB 4ZUXB 3MNNA 5BT1C 3EPLA 1JFIA 3AV2B 1M1AC 4Z66B 5CPKB 2F8NK 4KHAA 3LZ0C 5CP6C 5AV8D 5B31B 4KUDA 4DRBA 5DNMD 1WWIA 5AV6B 1KX4B 1KX5C 5AV9B 3RELB 4J8VA 3AZFD 4KGCB 3VH6A 5CPKA 1P3AB 5B32G 4J8VD 2BYMB 5B1LB 4YM6A 1P3GB 5AV6A 3AN2B 4R8PC 1P34C 3RELA 2JE5A 4YM6D 4KGCA 3MGQA 1P3BB 3VH5W 1P3LB 3MGQD 1P3GA 3AN2A 3B6GD 2PYOA 2AROA 1P3PC 1TZYA 3KWQC 1P3LA 2PYOD 3AZEA 3REHA 2AROD 3UT9D 4YS3A 1M1AB 3WA9C 2DQNC 3LZ0B 1M19D 1TZYD 5B1MA 5CP6B 3AZED 1ID3C 4YS3D 5B2JB 5B1MD 1KX5B 5B0ZA 5CPJB 3WKJA 1F1EA 1P3MA 5B0ZD 4NFTA 2VQRA 5B24A 3MGSB 3B0DC 3WKJD 5B2JA 1P3MD 3B0CW 3WTPB 3AZMA 1P34B 3W99B 5CPJA 3X1UA 5JRGC 3A6NA 3C1CC 3AZKA 3AV1C 4X23C 5AVBC 3MGSA 3V9RB 3LZ1A 3REJD 1WWSA 3A6ND 1P3IC 3WTPA 5AV5C 3W99A 4J8WA 2FJ7A 3TU4C 5CPIA 3LZ1D 3A1IA 1P3PB 4J8WD 2FJ7D 2NZDC 5CPID 2UWXA 3WA9B 4WU9A 5B32D 3C1BB 3W96C 1ID3B 4WU9D 3AFAC 2NQBA 2IO5C 2NQBD 1BH8B 1AOIC 5E5AC 3C1BA 1ZLAC 3B0DB 3EPKA 2CV5B 3X1VD 3W97A 3KUYD 3AZHD 4H9SC 3NQUB 2JCHA 3W98A 4XZQA 3O62C 4QLCA 3W97D 3W98D 5JRGB 3C1CB 3AV1B 2F8NH 1HQ3C 2BG1A 4X23B 3AZNC 2HIOC 5B40D 4XZQD 4QLCD 2CV5A 1P3IB 3NQUA 4Z5TC 5AV5B 3AZIA 5AY8C 4UUZA 4NE5A 3AZID 2NZDB 2XD5A 1M18D 4XUJB 2YFVA 3W96B 2Y2OA 3AFAB 1P3OC 1A7WA 4Z2MH 5B0YC 2IO5B 4XUJA 1AOIB 5E5AB 3KXBD 2LY8A 5BNXB 1ZLAB 4J8XB 3REIB 3WTPE 1P3KA 4H9QA 2HUEC 4JJNB 1P3KD 1HQ3B 5BNXA 1P3FC 2ZY3A 4J8XA 1ZLAA 1N1JA 3REIA 1R4VA 5G49B 5AV8C 2Y2QA 5GT0D 3MGRA 2F8NB 4Z5TB 5DNMC 3REKB 3UTBD 4LD9C 4JJNA 4H9OB 4CAYB 3MGRD 3AZFC 5B2IC 5F99A 4WU8D 2F8NA 3REKA 5AVCC 5F99D 4HGAC 3R45B 1S32B 3AZJD 2F2AC 1P3OB 5GXQA 5B0YB 3MNND 3B6GC 5GXQD 1S32A 4ZUXA 3LJAB 2HUEB 3AV2A 4H9PB 5BS7C 4KUDD 4ZUXD 4Z66A 3VH6W 3UT9C 1P3FB 3AV2D 5B31A 1M19C 4Z66D 5CPKD 5DNMB 3LJAA 4LD9B 1KX4A 5B31D 5AV9A 5AV6D 1P3AA 1KX4D 5BO0B 5B2IB 5AV9D 3RELD 2BYMA 5B1LA 1F66B 4KGCD 5GSUC 1P3AD 4J8UC 1EQZC 5AVCB 5B1LD 4HGAB 5KDMB 1P3GD 3AN2D 1P3BA 2ZY2A 3MVDC 3AYWC 1F66A 1P3BD 4WZSB 1P3LD 3REHD 3VH6T 1TAFB 3NQJB 5DNNC 1M1AA 5BT1D 3LZ0A 5CP6A 1B6WA 1M19B 5B32C 1M1AD 4R8PB 3LZ0D 5CP6D 1KX5A 1KX3C 5B24D 5B2JD 1KX5D 3AZMD 5CPJD 5GSUB 5GT3C 4R8PA 3X1UD 4J8UB 1EQZB 3AZKD 3X1VC 3KUYC 3AZHC 4DRAA 3UTAC 3X1TC 1P34A 3MGSD 3AZLC 2Y2JA 3MVDB 3AYWB 3WTPD 1P34D 3W99D 3KWQB 3MGPC 4H9NB 3V9RA 5C3IC 5B40C 2YFWB 5B33C 2Y2PA 1BFMA 3AZGC 2BYKB 1P3PA 5DNNB 3KWQA 3LELC 2Y2NA 4H9NA 3WA9A 1P3PD 2YFWA 1M18C 1U35C 5B32B 1ID3A 3WA9D 3WAAC 3C1BD 1KX3B 5JA4B 1ID3D 1BH8A 5BNVB 3KXBC 5AVBB 5GT3B 3X1SC 3B6FC 5JA4A 3KUYB 1KU5A 3UTAB 3AZHB 3X1TB 3TU4B 3AZLB 2CV5D 5JRGA 3C1CA 3AV1A 4X23A 3MGPB 5AVBA 5C3IB 5B40B 4Z2MG 5B33B 5JRGD 3AV1D 5GT0C 1P3IA 5AV5A 4X23D 5B31G 1PZRA 3TU4A 3AZGB 3AZLA 3UTBC 5AV5D 3LELB 2NZDA 4WU8C 1U35B 2NZDD 4E45A 2DF4C 3W96A 4E44A 2Y2KA 4XUJD 3AFAA 3WAAB 3AZJC 2XD1A 3AFAD 3O62B 1AOIA 5E5AA 4G92C 3FDDA 3AZNB 3MNNC 2HIOB 2FFFB 5E5AD 3X1SB 3B6FB 4H9SA 1ZLAD 4J8XD 3REID 3O62A 5AY8B 4WV4B 4KUDC 1HQ3A 3AZNA 2Y2HA 2HIOA 4JJND 5G49A 5FUGB 4J8VC 4Z5TA 5CPKC 1Q9CA 2Y2IA 4H9OA 5AY8A 3UTBB 4CAYA 2F8ND 4Z5TD 4YM6C 3EPJA 5AV6C 3REKD 3RELC 4WU8B 4KGCC 3MGQC 2G5IC 3R45A 1P3OA 1H3OB 1P3GC 5B0YA 4WJ3C 1S32D 1P3OD 3F6TA 2PYOC 4G92B 2RVQD 2AROC 5B0YD 3MNNB 1JFIB 1TZYC 1P3LC 5AV8B 3AZEC 3REHC 4YS3C 2W8SA 4KHAB 1T3UA 4H9PA 5B1MC 4UPKA 3AZFB 2Y2LA 3LJAD 1P3FA 5AV8A 4NE3A 5B0ZC 4J8VB 2ZM5A 1P3FD 5DNMA 4LD9A 3WKJC 1Z2CB 1ULYA 1P3MC 3AZFA 4YM6B 5B24C 4LD9D 5BO0A 5B2JC 5B2IA 3AZMC 5CPJC 3MGQB 3B6GB 5AVCA 4NE6A 5B2ID 3X1UC 3A6NC 3REJC 3AZKC 3KSYA 1F66D 5KDMA 3MGSC 3LZ1C 5AVCD 3WTPC 3W99C 4J8WC 2FJ7C 2PYOB 4EO5C 5CPIC 3B6GA 1W2EA 2AROB 4M6BA 3VH5A 3UT9B 1TZYB 3AZEB 3REHB 4YS3B 1TAFA 3NQJA 4DQYB 4WU9C 5BS7A 5B1MB 3UT9A 2NQBC 1M19A 2ZY4A 5B0ZB 3WKJB 2Y2MA 1P3MB 3C1BC 4R8PD 5B24B 2ZY5A 3A1KA 3W97C 4H9RB 3W98C 2G5HC 4G91C 3AZMB 5GSUA 4XZQC 2RIQA 4J8UA 4AWLC 4QLCC 1EQZA 3X1UB 3REJB 4ZBJC 3A6NB 3AZKB 3B0BA 5GSUD 3MVDA 4J8UD 1EQZD 3LZ1B 2CV5C 3AYWA 4H9RA 3VH5T 3AZIC 4J8WB 2FJ7B 4EO5B 3MVDD 5CPIB 3AYWD 3KFUG 3REJA 3KWQD 2F8NG 2CWEA 2BYKA 5DNNA 4WU9B 5DNND 2NQBB 5B32A 4XUJC
chains in the Genus database with same CATH topology
1HTAA 3X1VB 1KX3A 4CSRB 1KX3D 3W97B 3W98B 1P3KC 4G91B 5BNVA 5GT3A 4XZQB 4AWLB 4QLCB 3C1CD 3X1VA 4ZBJB 3KUYA 3AZHA 3B0CT 5AVBD 5GT3D 3UTAA 3X1TA 4CSRA 2J8PA 4J8XC 3P5JB 3REIC 1P3ID 3MGRC 3UTAD 3X1TD 3MGPA 3TU4D 3AZIB 3AZLD 5B40A 5B33A 4JJNC 1M18B 4UUZB 3MGPD 3AZGA 5B33D 5F99C 1BH9B 3LELA 3W96D 3AZGD 2YFVB 3REKC 2Y2GA 1M18A 5CHLB 1U35A 3LELD 4WNNB 3KXBB 5GXQC 3WAAA 1AOID 1U35D 1BH9A 3H0LC 3WAAD 1S32C 4WNNA 1P3KB 4ZUXC 3KXBA 2RVQC 4H9QB 3O62D 3AV2C 3X1SA 3B6FA 5GT0B 1HQ3D 3AZND 4Z66C 2HIOD 3H0RC 3X1SD 1N1JB 5B31C 2JSSA 3EG5B 3B6FD 3MGRB 3EPHA 3LJAC 5AY8D 1KX4C 5AV9C 5FUGA 5GT0A 3AL0C 1P3AC 3UTBA 5F99B 5B1LC 3AZJB 3AN2C 4WU8A 1P3BC 3H0MC 5GXQB 1F66C 1H3OA 2L5AA 3AZJA 3IP4C 1B67A 4KUDB 4ZUXB 3MNNA 5BT1C 3EPLA 1JFIA 3AV2B 1M1AC 4Z66B 5CPKB 2F8NK 4KHAA 3LZ0C 5CP6C 5AV8D 5B31B 4KUDA 4DRBA 5DNMD 1WWIA 5AV6B 1KX4B 1KX5C 5AV9B 3RELB 4J8VA 3AZFD 4KGCB 3VH6A 5CPKA 1P3AB 5B32G 4J8VD 2BYMB 5B1LB 4YM6A 1P3GB 5AV6A 3AN2B 4R8PC 1P34C 3RELA 2JE5A 4YM6D 4KGCA 3MGQA 1P3BB 3VH5W 1P3LB 3MGQD 1P3GA 3AN2A 3B6GD 2PYOA 2AROA 1P3PC 1TZYA 3KWQC 1P3LA 2PYOD 3AZEA 3REHA 2AROD 3UT9D 4YS3A 1M1AB 3WA9C 2DQNC 3LZ0B 1M19D 1TZYD 5B1MA 5CP6B 3AZED 1ID3C 4YS3D 5B2JB 5B1MD 1KX5B 5B0ZA 5CPJB 3WKJA 1F1EA 1P3MA 5B0ZD 4NFTA 2VQRA 5B24A 3MGSB 3B0DC 3WKJD 5B2JA 1P3MD 3B0CW 3WTPB 3AZMA 1P34B 3W99B 5CPJA 3X1UA 5JRGC 3A6NA 3C1CC 3AZKA 3AV1C 4X23C 5AVBC 3MGSA 3V9RB 3LZ1A 3REJD 1WWSA 3A6ND 1P3IC 3WTPA 5AV5C 3W99A 4J8WA 2FJ7A 3TU4C 5CPIA 3LZ1D 3A1IA 1P3PB 4J8WD 2FJ7D 2NZDC 5CPID 2UWXA 3WA9B 4WU9A 5B32D 3C1BB 3W96C 1ID3B 4WU9D 3AFAC 2NQBA 2IO5C 2NQBD 1BH8B 1AOIC 5E5AC 3C1BA 1ZLAC 3B0DB 3EPKA 2CV5B 3X1VD 3W97A 3KUYD 3AZHD 4H9SC 3NQUB 2JCHA 3W98A 4XZQA 3O62C 4QLCA 3W97D 3W98D 5JRGB 3C1CB 3AV1B 2F8NH 1HQ3C 2BG1A 4X23B 3AZNC 2HIOC 5B40D 4XZQD 4QLCD 2CV5A 1P3IB 3NQUA 4Z5TC 5AV5B 3AZIA 5AY8C 4UUZA 4NE5A 3AZID 2NZDB 2XD5A 1M18D 4XUJB 2YFVA 3W96B 2Y2OA 3AFAB 1P3OC 1A7WA 4Z2MH 5B0YC 2IO5B 4XUJA 1AOIB 5E5AB 3KXBD 2LY8A 5BNXB 1ZLAB 4J8XB 3REIB 3WTPE 1P3KA 4H9QA 2HUEC 4JJNB 1P3KD 1HQ3B 5BNXA 1P3FC 2ZY3A 4J8XA 1ZLAA 1N1JA 3REIA 1R4VA 5G49B 5AV8C 2Y2QA 5GT0D 3MGRA 2F8NB 4Z5TB 5DNMC 3REKB 3UTBD 4LD9C 4JJNA 4H9OB 4CAYB 3MGRD 3AZFC 5B2IC 5F99A 4WU8D 2F8NA 3REKA 5AVCC 5F99D 4HGAC 3R45B 1S32B 3AZJD 2F2AC 1P3OB 5GXQA 5B0YB 3MNND 3B6GC 5GXQD 1S32A 4ZUXA 3LJAB 2HUEB 3AV2A 4H9PB 5BS7C 4KUDD 4ZUXD 4Z66A 3VH6W 3UT9C 1P3FB 3AV2D 5B31A 1M19C 4Z66D 5CPKD 5DNMB 3LJAA 4LD9B 1KX4A 5B31D 5AV9A 5AV6D 1P3AA 1KX4D 5BO0B 5B2IB 5AV9D 3RELD 2BYMA 5B1LA 1F66B 4KGCD 5GSUC 1P3AD 4J8UC 1EQZC 5AVCB 5B1LD 4HGAB 5KDMB 1P3GD 3AN2D 1P3BA 2ZY2A 3MVDC 3AYWC 1F66A 1P3BD 4WZSB 1P3LD 3REHD 3VH6T 1TAFB 3NQJB 5DNNC 1M1AA 5BT1D 3LZ0A 5CP6A 1B6WA 1M19B 5B32C 1M1AD 4R8PB 3LZ0D 5CP6D 1KX5A 1KX3C 5B24D 5B2JD 1KX5D 3AZMD 5CPJD 5GSUB 5GT3C 4R8PA 3X1UD 4J8UB 1EQZB 3AZKD 3X1VC 3KUYC 3AZHC 4DRAA 3UTAC 3X1TC 1P34A 3MGSD 3AZLC 2Y2JA 3MVDB 3AYWB 3WTPD 1P34D 3W99D 3KWQB 3MGPC 4H9NB 3V9RA 5C3IC 5B40C 2YFWB 5B33C 2Y2PA 1BFMA 3AZGC 2BYKB 1P3PA 5DNNB 3KWQA 3LELC 2Y2NA 4H9NA 3WA9A 1P3PD 2YFWA 1M18C 1U35C 5B32B 1ID3A 3WA9D 3WAAC 3C1BD 1KX3B 5JA4B 1ID3D 1BH8A 5BNVB 3KXBC 5AVBB 5GT3B 3X1SC 3B6FC 5JA4A 3KUYB 1KU5A 3UTAB 3AZHB 3X1TB 3TU4B 3AZLB 2CV5D 5JRGA 3C1CA 3AV1A 4X23A 3MGPB 5AVBA 5C3IB 5B40B 4Z2MG 5B33B 5JRGD 3AV1D 5GT0C 1P3IA 5AV5A 4X23D 5B31G 1PZRA 3TU4A 3AZGB 3AZLA 3UTBC 5AV5D 3LELB 2NZDA 4WU8C 1U35B 2NZDD 4E45A 2DF4C 3W96A 4E44A 2Y2KA 4XUJD 3AFAA 3WAAB 3AZJC 2XD1A 3AFAD 3O62B 1AOIA 5E5AA 4G92C 3FDDA 3AZNB 3MNNC 2HIOB 2FFFB 5E5AD 3X1SB 3B6FB 4H9SA 1ZLAD 4J8XD 3REID 3O62A 5AY8B 4WV4B 4KUDC 1HQ3A 3AZNA 2Y2HA 2HIOA 4JJND 5G49A 5FUGB 4J8VC 4Z5TA 5CPKC 1Q9CA 2Y2IA 4H9OA 5AY8A 3UTBB 4CAYA 2F8ND 4Z5TD 4YM6C 3EPJA 5AV6C 3REKD 3RELC 4WU8B 4KGCC 3MGQC 2G5IC 3R45A 1P3OA 1H3OB 1P3GC 5B0YA 4WJ3C 1S32D 1P3OD 3F6TA 2PYOC 4G92B 2RVQD 2AROC 5B0YD 3MNNB 1JFIB 1TZYC 1P3LC 5AV8B 3AZEC 3REHC 4YS3C 2W8SA 4KHAB 1T3UA 4H9PA 5B1MC 4UPKA 3AZFB 2Y2LA 3LJAD 1P3FA 5AV8A 4NE3A 5B0ZC 4J8VB 2ZM5A 1P3FD 5DNMA 4LD9A 3WKJC 1Z2CB 1ULYA 1P3MC 3AZFA 4YM6B 5B24C 4LD9D 5BO0A 5B2JC 5B2IA 3AZMC 5CPJC 3MGQB 3B6GB 5AVCA 4NE6A 5B2ID 3X1UC 3A6NC 3REJC 3AZKC 3KSYA 1F66D 5KDMA 3MGSC 3LZ1C 5AVCD 3WTPC 3W99C 4J8WC 2FJ7C 2PYOB 4EO5C 5CPIC 3B6GA 1W2EA 2AROB 4M6BA 3VH5A 3UT9B 1TZYB 3AZEB 3REHB 4YS3B 1TAFA 3NQJA 4DQYB 4WU9C 5BS7A 5B1MB 3UT9A 2NQBC 1M19A 2ZY4A 5B0ZB 3WKJB 2Y2MA 1P3MB 3C1BC 4R8PD 5B24B 2ZY5A 3A1KA 3W97C 4H9RB 3W98C 2G5HC 4G91C 3AZMB 5GSUA 4XZQC 2RIQA 4J8UA 4AWLC 4QLCC 1EQZA 3X1UB 3REJB 4ZBJC 3A6NB 3AZKB 3B0BA 5GSUD 3MVDA 4J8UD 1EQZD 3LZ1B 2CV5C 3AYWA 4H9RA 3VH5T 3AZIC 4J8WB 2FJ7B 4EO5B 3MVDD 5CPIB 3AYWD 3KFUG 3REJA 3KWQD 2F8NG 2CWEA 2BYKA 5DNNA 4WU9B 5DNND 2NQBB 5B32A 4XUJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTA A;  3X1V B;  1KX3 A;  4CSR B;  1KX3 D;  3W97 B;  3W98 B;  1P3K C;  4G91 B;  5BNV A;  5GT3 A;  4XZQ B;  4AWL B;  4QLC B;  3C1C D;  3X1V A;  4ZBJ B;  3KUY A;  3AZH A;  3B0C T;  5AVB D;  5GT3 D;  3UTA A;  3X1T A;  4CSR A;  4J8X C;  3REI C;  1P3I D;  3MGR C;  3UTA D;  3X1T D;  3MGP A;  3TU4 D;  3AZI B;  3AZL D;  5B40 A;  5B33 A;  4JJN C;  1M18 B;  4UUZ B;  3MGP D;  3AZG A;  5B33 D;  5F99 C;  1BH9 B;  3LEL A;  3W96 D;  3AZG D;  2YFV B;  3REK C;  1M18 A;  5CHL B;  1U35 A;  3LEL D;  4WNN B;  3KXB B;  5GXQ C;  3WAA A;  1AOI D;  1U35 D;  1BH9 A;  3WAA D;  1S32 C;  4WNN A;  1P3K B;  4ZUX C;  3KXB A;  2RVQ C;  4H9Q B;  3O62 D;  3AV2 C;  3X1S A;  3B6F A;  5GT0 B;  1HQ3 D;  3AZN D;  4Z66 C;  2HIO D;  3X1S D;  1N1J B;  5B31 C;  2JSS A;  3B6F D;  3MGR B;  3LJA C;  5AY8 D;  1KX4 C;  5AV9 C;  5FUG A;  5GT0 A;  1P3A C;  3UTB A;  5F99 B;  5B1L C;  3AZJ B;  3AN2 C;  4WU8 A;  1P3B C;  5GXQ B;  1F66 C;  1H3O A;  2L5A A;  3AZJ A;  1B67 A;  4KUD B;  4ZUX B;  3MNN A;  5BT1 C;  1JFI A;  3AV2 B;  1M1A C;  4Z66 B;  5CPK B;  2F8N K;  4KHA A;  3LZ0 C;  5CP6 C;  5AV8 D;  5B31 B;  4KUD A;  4DRB A;  5DNM D;  1WWI A;  5AV6 B;  1KX4 B;  1KX5 C;  5AV9 B;  3REL B;  4J8V A;  3AZF D;  4KGC B;  3VH6 A;  5CPK A;  1P3A B;  5B32 G;  4J8V D;  2BYM B;  5B1L B;  4YM6 A;  1P3G B;  5AV6 A;  3AN2 B;  4R8P C;  1P34 C;  3REL A;  4YM6 D;  4KGC A;  3MGQ A;  1P3B B;  3VH5 W;  1P3L B;  3MGQ D;  1P3G A;  3AN2 A;  3B6G D;  2PYO A;  2ARO A;  1P3P C;  1TZY A;  3KWQ C;  1P3L A;  2PYO D;  3AZE A;  3REH A;  2ARO D;  3UT9 D;  4YS3 A;  1M1A B;  3WA9 C;  3LZ0 B;  1M19 D;  1TZY D;  5B1M A;  5CP6 B;  3AZE D;  1ID3 C;  4YS3 D;  5B2J B;  5B1M D;  1KX5 B;  5B0Z A;  5CPJ B;  3WKJ A;  1F1E A;  1P3M A;  5B0Z D;  4NFT A;  5B24 A;  3MGS B;  3B0D C;  3WKJ D;  5B2J A;  1P3M D;  3B0C W;  3WTP B;  3AZM A;  1P34 B;  3W99 B;  5CPJ A;  3X1U A;  5JRG C;  3A6N A;  3C1C C;  3AZK A;  3AV1 C;  4X23 C;  5AVB C;  3MGS A;  3V9R B;  3LZ1 A;  3REJ D;  1WWS A;  3A6N D;  1P3I C;  3WTP A;  5AV5 C;  3W99 A;  4J8W A;  2FJ7 A;  3TU4 C;  5CPI A;  3LZ1 D;  1P3P B;  4J8W D;  2FJ7 D;  2NZD C;  5CPI D;  3WA9 B;  4WU9 A;  5B32 D;  3C1B B;  3W96 C;  1ID3 B;  4WU9 D;  3AFA C;  2NQB A;  2IO5 C;  2NQB D;  1BH8 B;  1AOI C;  5E5A C;  3C1B A;  1ZLA C;  3B0D B;  2CV5 B;  3X1V D;  3W97 A;  3KUY D;  3AZH D;  4H9S C;  3NQU B;  3W98 A;  4XZQ A;  3O62 C;  4QLC A;  3W97 D;  3W98 D;  5JRG B;  3C1C B;  3AV1 B;  2F8N H;  1HQ3 C;  4X23 B;  3AZN C;  4XZQ D;  2HIO C;  5B40 D;  4QLC D;  2CV5 A;  1P3I B;  3NQU A;  4Z5T C;  5AV5 B;  3AZI A;  5AY8 C;  4UUZ A;  4NE5 A;  3AZI D;  2NZD B;  1M18 D;  4XUJ B;  2YFV A;  3W96 B;  3AFA B;  1P3O C;  1A7W A;  4Z2M H;  5B0Y C;  2IO5 B;  4XUJ A;  1AOI B;  5E5A B;  3KXB D;  2LY8 A;  5BNX B;  1ZLA B;  4J8X B;  3REI B;  3WTP E;  1P3K A;  4H9Q A;  2HUE C;  4JJN B;  1P3K D;  1HQ3 B;  5BNX A;  1P3F C;  1ZLA A;  4J8X A;  1N1J A;  3REI A;  1R4V A;  5G49 B;  5AV8 C;  5GT0 D;  3MGR A;  2F8N B;  4Z5T B;  5DNM C;  3REK B;  3UTB D;  4LD9 C;  4JJN A;  4H9O B;  4CAY B;  3MGR D;  3AZF C;  5B2I C;  5F99 A;  4WU8 D;  2F8N A;  3REK A;  5AVC C;  5F99 D;  4HGA C;  3R45 B;  1S32 B;  3AZJ D;  1P3O B;  5GXQ A;  5B0Y B;  3MNN D;  3B6G C;  5GXQ D;  1S32 A;  4ZUX A;  3LJA B;  2HUE B;  3AV2 A;  4H9P B;  5BS7 C;  4KUD D;  4ZUX D;  4Z66 A;  3VH6 W;  3UT9 C;  1P3F B;  3AV2 D;  5B31 A;  1M19 C;  4Z66 D;  5CPK D;  5DNM B;  3LJA A;  4LD9 B;  1KX4 A;  5B31 D;  5AV9 A;  5AV6 D;  1P3A A;  1KX4 D;  5BO0 B;  5B2I B;  5AV9 D;  3REL D;  2BYM A;  5B1L A;  1F66 B;  4KGC D;  5GSU C;  1P3A D;  4J8U C;  1EQZ C;  5AVC B;  5B1L D;  4HGA B;  5KDM B;  1P3G D;  3AN2 D;  1P3B A;  3MVD C;  3AYW C;  1F66 A;  1P3B D;  4WZS B;  1P3L D;  3REH D;  3VH6 T;  1TAF B;  3NQJ B;  5DNN C;  1M1A A;  5BT1 D;  3LZ0 A;  5CP6 A;  1B6W A;  1M19 B;  5B32 C;  1M1A D;  4R8P B;  3LZ0 D;  5CP6 D;  1KX5 A;  1KX3 C;  5B24 D;  5B2J D;  1KX5 D;  3AZM D;  5CPJ D;  5GSU B;  5GT3 C;  4R8P A;  3X1U D;  4J8U B;  1EQZ B;  3AZK D;  3X1V C;  3KUY C;  3AZH C;  4DRA A;  3UTA C;  3X1T C;  1P34 A;  3MGS D;  3AZL C;  3MVD B;  3AYW B;  3WTP D;  1P34 D;  3W99 D;  3KWQ B;  3MGP C;  4H9N B;  3V9R A;  5C3I C;  5B40 C;  2YFW B;  5B33 C;  1BFM A;  3AZG C;  2BYK B;  1P3P A;  5DNN B;  3KWQ A;  3LEL C;  4H9N A;  3WA9 A;  1P3P D;  2YFW A;  1M18 C;  1U35 C;  5B32 B;  1ID3 A;  3WA9 D;  3WAA C;  3C1B D;  1KX3 B;  5JA4 B;  1ID3 D;  1BH8 A;  5BNV B;  3KXB C;  5AVB B;  5GT3 B;  3X1S C;  3B6F C;  5JA4 A;  3KUY B;  1KU5 A;  3UTA B;  3AZH B;  3X1T B;  3TU4 B;  3AZL B;  2CV5 D;  5JRG A;  3C1C A;  3AV1 A;  4X23 A;  3MGP B;  5AVB A;  5C3I B;  5B40 B;  4Z2M G;  5B33 B;  5JRG D;  3AV1 D;  5GT0 C;  1P3I A;  5AV5 A;  4X23 D;  5B31 G;  3AZG B;  3TU4 A;  3AZL A;  3UTB C;  5AV5 D;  3LEL B;  2NZD A;  4WU8 C;  1U35 B;  2NZD D;  4E45 A;  3W96 A;  4E44 A;  4XUJ D;  3AFA A;  3WAA B;  3AZJ C;  3AFA D;  3O62 B;  1AOI A;  5E5A A;  4G92 C;  3AZN B;  3MNN C;  2HIO B;  5E5A D;  3X1S B;  3B6F B;  4H9S A;  1ZLA D;  4J8X D;  3REI D;  3O62 A;  5AY8 B;  4WV4 B;  4KUD C;  1HQ3 A;  3AZN A;  2HIO A;  4JJN D;  5G49 A;  5FUG B;  4J8V C;  4Z5T A;  5CPK C;  1Q9C A;  4H9O A;  5AY8 A;  3UTB B;  2F8N D;  4CAY A;  4Z5T D;  4YM6 C;  5AV6 C;  3REK D;  3REL C;  4WU8 B;  4KGC C;  3MGQ C;  3R45 A;  1P3O A;  1H3O B;  1P3G C;  5B0Y A;  1S32 D;  1P3O D;  2PYO C;  4G92 B;  2RVQ D;  2ARO C;  5B0Y D;  3MNN B;  1JFI B;  1TZY C;  1P3L C;  5AV8 B;  3AZE C;  3REH C;  4YS3 C;  4KHA B;  4H9P A;  5B1M C;  3AZF B;  3LJA D;  1P3F A;  5AV8 A;  4NE3 A;  5B0Z C;  4J8V B;  1P3F D;  5DNM A;  4LD9 A;  3WKJ C;  1ULY A;  1P3M C;  3AZF A;  4YM6 B;  5B24 C;  4LD9 D;  5BO0 A;  5B2J C;  5B2I A;  3AZM C;  5CPJ C;  3MGQ B;  3B6G B;  5AVC A;  4NE6 A;  5B2I D;  3X1U C;  3A6N C;  3REJ C;  3AZK C;  3KSY A;  1F66 D;  5KDM A;  3MGS C;  3LZ1 C;  5AVC D;  3WTP C;  3W99 C;  4J8W C;  2FJ7 C;  2PYO B;  4EO5 C;  5CPI C;  3B6G A;  2ARO B;  4M6B A;  3VH5 A;  3UT9 B;  1TZY B;  3AZE B;  3REH B;  4YS3 B;  1TAF A;  3NQJ A;  4WU9 C;  5BS7 A;  5B1M B;  3UT9 A;  2NQB C;  1M19 A;  5B0Z B;  3WKJ B;  1P3M B;  3C1B C;  4R8P D;  5B24 B;  3W97 C;  4H9R B;  3W98 C;  4G91 C;  3AZM B;  5GSU A;  4XZQ C;  4J8U A;  4AWL C;  4QLC C;  1EQZ A;  3X1U B;  3REJ B;  4ZBJ C;  3A6N B;  3AZK B;  3B0B A;  5GSU D;  3MVD A;  4J8U D;  1EQZ D;  3LZ1 B;  2CV5 C;  3AYW A;  4H9R A;  3VH5 T;  3AZI C;  4J8W B;  2FJ7 B;  4EO5 B;  3MVD D;  5CPI B;  3AYW D;  3REJ A;  3KWQ D;  2F8N G;  2CWE A;  2BYK A;  5DNN A;  4WU9 B;  5DNN D;  2NQB B;  5B32 A;  4XUJ C; 
#chains in the Genus database with same CATH topology
 1HTA A;  3X1V B;  1KX3 A;  4CSR B;  1KX3 D;  3W97 B;  3W98 B;  1P3K C;  4G91 B;  5BNV A;  5GT3 A;  4XZQ B;  4AWL B;  4QLC B;  3C1C D;  3X1V A;  4ZBJ B;  3KUY A;  3AZH A;  3B0C T;  5AVB D;  5GT3 D;  3UTA A;  3X1T A;  4CSR A;  2J8P A;  4J8X C;  3P5J B;  3REI C;  1P3I D;  3MGR C;  3UTA D;  3X1T D;  3MGP A;  3TU4 D;  3AZI B;  3AZL D;  5B40 A;  5B33 A;  4JJN C;  1M18 B;  4UUZ B;  3MGP D;  3AZG A;  5B33 D;  5F99 C;  1BH9 B;  3LEL A;  3W96 D;  3AZG D;  2YFV B;  3REK C;  2Y2G A;  1M18 A;  5CHL B;  1U35 A;  3LEL D;  4WNN B;  3KXB B;  5GXQ C;  3WAA A;  1AOI D;  1U35 D;  1BH9 A;  3H0L C;  3WAA D;  1S32 C;  4WNN A;  1P3K B;  4ZUX C;  3KXB A;  2RVQ C;  4H9Q B;  3O62 D;  3AV2 C;  3X1S A;  3B6F A;  5GT0 B;  1HQ3 D;  3AZN D;  4Z66 C;  2HIO D;  3H0R C;  3X1S D;  1N1J B;  5B31 C;  2JSS A;  3EG5 B;  3B6F D;  3MGR B;  3EPH A;  3LJA C;  5AY8 D;  1KX4 C;  5AV9 C;  5FUG A;  5GT0 A;  3AL0 C;  1P3A C;  3UTB A;  5F99 B;  5B1L C;  3AZJ B;  3AN2 C;  4WU8 A;  1P3B C;  3H0M C;  5GXQ B;  1F66 C;  1H3O A;  2L5A A;  3AZJ A;  3IP4 C;  1B67 A;  4KUD B;  4ZUX B;  3MNN A;  5BT1 C;  3EPL A;  1JFI A;  3AV2 B;  1M1A C;  4Z66 B;  5CPK B;  2F8N K;  4KHA A;  3LZ0 C;  5CP6 C;  5AV8 D;  5B31 B;  4KUD A;  4DRB A;  5DNM D;  1WWI A;  5AV6 B;  1KX4 B;  1KX5 C;  5AV9 B;  3REL B;  4J8V A;  3AZF D;  4KGC B;  3VH6 A;  5CPK A;  1P3A B;  5B32 G;  4J8V D;  2BYM B;  5B1L B;  4YM6 A;  1P3G B;  5AV6 A;  3AN2 B;  4R8P C;  1P34 C;  3REL A;  2JE5 A;  4YM6 D;  4KGC A;  3MGQ A;  1P3B B;  3VH5 W;  1P3L B;  3MGQ D;  1P3G A;  3AN2 A;  3B6G D;  2PYO A;  2ARO A;  1P3P C;  1TZY A;  3KWQ C;  1P3L A;  2PYO D;  3AZE A;  3REH A;  2ARO D;  3UT9 D;  4YS3 A;  1M1A B;  3WA9 C;  2DQN C;  3LZ0 B;  1M19 D;  1TZY D;  5B1M A;  5CP6 B;  3AZE D;  1ID3 C;  4YS3 D;  5B2J B;  5B1M D;  1KX5 B;  5B0Z A;  5CPJ B;  3WKJ A;  1F1E A;  1P3M A;  5B0Z D;  4NFT A;  2VQR A;  5B24 A;  3MGS B;  3B0D C;  3WKJ D;  5B2J A;  1P3M D;  3B0C W;  3WTP B;  3AZM A;  1P34 B;  3W99 B;  5CPJ A;  3X1U A;  5JRG C;  3A6N A;  3C1C C;  3AZK A;  3AV1 C;  4X23 C;  5AVB C;  3MGS A;  3V9R B;  3LZ1 A;  3REJ D;  1WWS A;  3A6N D;  1P3I C;  3WTP A;  5AV5 C;  3W99 A;  4J8W A;  2FJ7 A;  3TU4 C;  5CPI A;  3LZ1 D;  3A1I A;  1P3P B;  4J8W D;  2FJ7 D;  2NZD C;  5CPI D;  2UWX A;  3WA9 B;  4WU9 A;  5B32 D;  3C1B B;  3W96 C;  1ID3 B;  4WU9 D;  3AFA C;  2NQB A;  2IO5 C;  2NQB D;  1BH8 B;  1AOI C;  5E5A C;  3C1B A;  1ZLA C;  3B0D B;  3EPK A;  2CV5 B;  3X1V D;  3W97 A;  3KUY D;  3AZH D;  4H9S C;  3NQU B;  2JCH A;  3W98 A;  4XZQ A;  3O62 C;  4QLC A;  3W97 D;  3W98 D;  5JRG B;  3C1C B;  3AV1 B;  2F8N H;  1HQ3 C;  2BG1 A;  4X23 B;  3AZN C;  2HIO C;  5B40 D;  4XZQ D;  4QLC D;  2CV5 A;  1P3I B;  3NQU A;  4Z5T C;  5AV5 B;  3AZI A;  5AY8 C;  4UUZ A;  4NE5 A;  3AZI D;  2NZD B;  2XD5 A;  1M18 D;  4XUJ B;  2YFV A;  3W96 B;  2Y2O A;  3AFA B;  1P3O C;  1A7W A;  4Z2M H;  5B0Y C;  2IO5 B;  4XUJ A;  1AOI B;  5E5A B;  3KXB D;  2LY8 A;  5BNX B;  1ZLA B;  4J8X B;  3REI B;  3WTP E;  1P3K A;  4H9Q A;  2HUE C;  4JJN B;  1P3K D;  1HQ3 B;  5BNX A;  1P3F C;  2ZY3 A;  4J8X A;  1ZLA A;  1N1J A;  3REI A;  1R4V A;  5G49 B;  5AV8 C;  2Y2Q A;  5GT0 D;  3MGR A;  2F8N B;  4Z5T B;  5DNM C;  3REK B;  3UTB D;  4LD9 C;  4JJN A;  4H9O B;  4CAY B;  3MGR D;  3AZF C;  5B2I C;  5F99 A;  4WU8 D;  2F8N A;  3REK A;  5AVC C;  5F99 D;  4HGA C;  3R45 B;  1S32 B;  3AZJ D;  2F2A C;  1P3O B;  5GXQ A;  5B0Y B;  3MNN D;  3B6G C;  5GXQ D;  1S32 A;  4ZUX A;  3LJA B;  2HUE B;  3AV2 A;  4H9P B;  5BS7 C;  4KUD D;  4ZUX D;  4Z66 A;  3VH6 W;  3UT9 C;  1P3F B;  3AV2 D;  5B31 A;  1M19 C;  4Z66 D;  5CPK D;  5DNM B;  3LJA A;  4LD9 B;  1KX4 A;  5B31 D;  5AV9 A;  5AV6 D;  1P3A A;  1KX4 D;  5BO0 B;  5B2I B;  5AV9 D;  3REL D;  2BYM A;  5B1L A;  1F66 B;  4KGC D;  5GSU C;  1P3A D;  4J8U C;  1EQZ C;  5AVC B;  5B1L D;  4HGA B;  5KDM B;  1P3G D;  3AN2 D;  1P3B A;  2ZY2 A;  3MVD C;  3AYW C;  1F66 A;  1P3B D;  4WZS B;  1P3L D;  3REH D;  3VH6 T;  1TAF B;  3NQJ B;  5DNN C;  1M1A A;  5BT1 D;  3LZ0 A;  5CP6 A;  1B6W A;  1M19 B;  5B32 C;  1M1A D;  4R8P B;  3LZ0 D;  5CP6 D;  1KX5 A;  1KX3 C;  5B24 D;  5B2J D;  1KX5 D;  3AZM D;  5CPJ D;  5GSU B;  5GT3 C;  4R8P A;  3X1U D;  4J8U B;  1EQZ B;  3AZK D;  3X1V C;  3KUY C;  3AZH C;  4DRA A;  3UTA C;  3X1T C;  1P34 A;  3MGS D;  3AZL C;  2Y2J A;  3MVD B;  3AYW B;  3WTP D;  1P34 D;  3W99 D;  3KWQ B;  3MGP C;  4H9N B;  3V9R A;  5C3I C;  5B40 C;  2YFW B;  5B33 C;  2Y2P A;  1BFM A;  3AZG C;  2BYK B;  1P3P A;  5DNN B;  3KWQ A;  3LEL C;  2Y2N A;  4H9N A;  3WA9 A;  1P3P D;  2YFW A;  1M18 C;  1U35 C;  5B32 B;  1ID3 A;  3WA9 D;  3WAA C;  3C1B D;  1KX3 B;  5JA4 B;  1ID3 D;  1BH8 A;  5BNV B;  3KXB C;  5AVB B;  5GT3 B;  3X1S C;  3B6F C;  5JA4 A;  3KUY B;  1KU5 A;  3UTA B;  3AZH B;  3X1T B;  3TU4 B;  3AZL B;  2CV5 D;  5JRG A;  3C1C A;  3AV1 A;  4X23 A;  3MGP B;  5AVB A;  5C3I B;  5B40 B;  4Z2M G;  5B33 B;  5JRG D;  3AV1 D;  5GT0 C;  1P3I A;  5AV5 A;  4X23 D;  5B31 G;  1PZR A;  3TU4 A;  3AZG B;  3AZL A;  3UTB C;  5AV5 D;  3LEL B;  2NZD A;  4WU8 C;  1U35 B;  2NZD D;  4E45 A;  2DF4 C;  3W96 A;  4E44 A;  2Y2K A;  4XUJ D;  3AFA A;  3WAA B;  3AZJ C;  2XD1 A;  3AFA D;  3O62 B;  1AOI A;  5E5A A;  4G92 C;  3FDD A;  3AZN B;  3MNN C;  2HIO B;  2FFF B;  5E5A D;  3X1S B;  3B6F B;  4H9S A;  1ZLA D;  4J8X D;  3REI D;  3O62 A;  5AY8 B;  4WV4 B;  4KUD C;  1HQ3 A;  3AZN A;  2Y2H A;  2HIO A;  4JJN D;  5G49 A;  5FUG B;  4J8V C;  4Z5T A;  5CPK C;  1Q9C A;  2Y2I A;  4H9O A;  5AY8 A;  3UTB B;  4CAY A;  2F8N D;  4Z5T D;  4YM6 C;  3EPJ A;  5AV6 C;  3REK D;  3REL C;  4WU8 B;  4KGC C;  3MGQ C;  2G5I C;  3R45 A;  1P3O A;  1H3O B;  1P3G C;  5B0Y A;  4WJ3 C;  1S32 D;  1P3O D;  3F6T A;  2PYO C;  4G92 B;  2RVQ D;  2ARO C;  5B0Y D;  3MNN B;  1JFI B;  1TZY C;  1P3L C;  5AV8 B;  3AZE C;  3REH C;  4YS3 C;  2W8S A;  4KHA B;  1T3U A;  4H9P A;  5B1M C;  4UPK A;  3AZF B;  2Y2L A;  3LJA D;  1P3F A;  5AV8 A;  4NE3 A;  5B0Z C;  4J8V B;  2ZM5 A;  1P3F D;  5DNM A;  4LD9 A;  3WKJ C;  1Z2C B;  1ULY A;  1P3M C;  3AZF A;  4YM6 B;  5B24 C;  4LD9 D;  5BO0 A;  5B2J C;  5B2I A;  3AZM C;  5CPJ C;  3MGQ B;  3B6G B;  5AVC A;  4NE6 A;  5B2I D;  3X1U C;  3A6N C;  3REJ C;  3AZK C;  3KSY A;  1F66 D;  5KDM A;  3MGS C;  3LZ1 C;  5AVC D;  3WTP C;  3W99 C;  4J8W C;  2FJ7 C;  2PYO B;  4EO5 C;  5CPI C;  3B6G A;  1W2E A;  2ARO B;  4M6B A;  3VH5 A;  3UT9 B;  1TZY B;  3AZE B;  3REH B;  4YS3 B;  1TAF A;  3NQJ A;  4DQY B;  4WU9 C;  5BS7 A;  5B1M B;  3UT9 A;  2NQB C;  1M19 A;  2ZY4 A;  5B0Z B;  3WKJ B;  2Y2M A;  1P3M B;  3C1B C;  4R8P D;  5B24 B;  2ZY5 A;  3A1K A;  3W97 C;  4H9R B;  3W98 C;  2G5H C;  4G91 C;  3AZM B;  5GSU A;  4XZQ C;  2RIQ A;  4J8U A;  4AWL C;  4QLC C;  1EQZ A;  3X1U B;  3REJ B;  4ZBJ C;  3A6N B;  3AZK B;  3B0B A;  5GSU D;  3MVD A;  4J8U D;  1EQZ D;  3LZ1 B;  2CV5 C;  3AYW A;  4H9R A;  3VH5 T;  3AZI C;  4J8W B;  2FJ7 B;  4EO5 B;  3MVD D;  5CPI B;  3AYW D;  3KFU G;  3REJ A;  3KWQ D;  2F8N G;  2CWE A;  2BYK A;  5DNN A;  4WU9 B;  5DNN D;  2NQB B;  5B32 A;  4XUJ C; 
#chains in the Genus database with same CATH homology
 1HTA A;  3X1V B;  1KX3 A;  4CSR B;  1KX3 D;  3W97 B;  3W98 B;  1P3K C;  4G91 B;  5BNV A;  5GT3 A;  4XZQ B;  4AWL B;  4QLC B;  3C1C D;  3X1V A;  4ZBJ B;  3KUY A;  3AZH A;  3B0C T;  5AVB D;  5GT3 D;  3UTA A;  3X1T A;  4CSR A;  2J8P A;  4J8X C;  3P5J B;  3REI C;  1P3I D;  3MGR C;  3UTA D;  3X1T D;  3MGP A;  3TU4 D;  3AZI B;  3AZL D;  5B40 A;  5B33 A;  4JJN C;  1M18 B;  4UUZ B;  3MGP D;  3AZG A;  5B33 D;  5F99 C;  1BH9 B;  3LEL A;  3W96 D;  3AZG D;  2YFV B;  3REK C;  2Y2G A;  1M18 A;  5CHL B;  1U35 A;  3LEL D;  4WNN B;  3KXB B;  5GXQ C;  3WAA A;  1AOI D;  1U35 D;  1BH9 A;  3H0L C;  3WAA D;  1S32 C;  4WNN A;  1P3K B;  4ZUX C;  3KXB A;  2RVQ C;  4H9Q B;  3O62 D;  3AV2 C;  3X1S A;  3B6F A;  5GT0 B;  1HQ3 D;  3AZN D;  4Z66 C;  2HIO D;  3H0R C;  3X1S D;  1N1J B;  5B31 C;  2JSS A;  3EG5 B;  3B6F D;  3MGR B;  3EPH A;  3LJA C;  5AY8 D;  1KX4 C;  5AV9 C;  5FUG A;  5GT0 A;  3AL0 C;  1P3A C;  3UTB A;  5F99 B;  5B1L C;  3AZJ B;  3AN2 C;  4WU8 A;  1P3B C;  3H0M C;  5GXQ B;  1F66 C;  1H3O A;  2L5A A;  3AZJ A;  3IP4 C;  1B67 A;  4KUD B;  4ZUX B;  3MNN A;  5BT1 C;  3EPL A;  1JFI A;  3AV2 B;  1M1A C;  4Z66 B;  5CPK B;  2F8N K;  4KHA A;  3LZ0 C;  5CP6 C;  5AV8 D;  5B31 B;  4KUD A;  4DRB A;  5DNM D;  1WWI A;  5AV6 B;  1KX4 B;  1KX5 C;  5AV9 B;  3REL B;  4J8V A;  3AZF D;  4KGC B;  3VH6 A;  5CPK A;  1P3A B;  5B32 G;  4J8V D;  2BYM B;  5B1L B;  4YM6 A;  1P3G B;  5AV6 A;  3AN2 B;  4R8P C;  1P34 C;  3REL A;  2JE5 A;  4YM6 D;  4KGC A;  3MGQ A;  1P3B B;  3VH5 W;  1P3L B;  3MGQ D;  1P3G A;  3AN2 A;  3B6G D;  2PYO A;  2ARO A;  1P3P C;  1TZY A;  3KWQ C;  1P3L A;  2PYO D;  3AZE A;  3REH A;  2ARO D;  3UT9 D;  4YS3 A;  1M1A B;  3WA9 C;  2DQN C;  3LZ0 B;  1M19 D;  1TZY D;  5B1M A;  5CP6 B;  3AZE D;  1ID3 C;  4YS3 D;  5B2J B;  5B1M D;  1KX5 B;  5B0Z A;  5CPJ B;  3WKJ A;  1F1E A;  1P3M A;  5B0Z D;  4NFT A;  2VQR A;  5B24 A;  3MGS B;  3B0D C;  3WKJ D;  5B2J A;  1P3M D;  3B0C W;  3WTP B;  3AZM A;  1P34 B;  3W99 B;  5CPJ A;  3X1U A;  5JRG C;  3A6N A;  3C1C C;  3AZK A;  3AV1 C;  4X23 C;  5AVB C;  3MGS A;  3V9R B;  3LZ1 A;  3REJ D;  1WWS A;  3A6N D;  1P3I C;  3WTP A;  5AV5 C;  3W99 A;  4J8W A;  2FJ7 A;  3TU4 C;  5CPI A;  3LZ1 D;  3A1I A;  1P3P B;  4J8W D;  2FJ7 D;  2NZD C;  5CPI D;  2UWX A;  3WA9 B;  4WU9 A;  5B32 D;  3C1B B;  3W96 C;  1ID3 B;  4WU9 D;  3AFA C;  2NQB A;  2IO5 C;  2NQB D;  1BH8 B;  1AOI C;  5E5A C;  3C1B A;  1ZLA C;  3B0D B;  3EPK A;  2CV5 B;  3X1V D;  3W97 A;  3KUY D;  3AZH D;  4H9S C;  3NQU B;  2JCH A;  3W98 A;  4XZQ A;  3O62 C;  4QLC A;  3W97 D;  3W98 D;  5JRG B;  3C1C B;  3AV1 B;  2F8N H;  1HQ3 C;  2BG1 A;  4X23 B;  3AZN C;  2HIO C;  5B40 D;  4XZQ D;  4QLC D;  2CV5 A;  1P3I B;  3NQU A;  4Z5T C;  5AV5 B;  3AZI A;  5AY8 C;  4UUZ A;  4NE5 A;  3AZI D;  2NZD B;  2XD5 A;  1M18 D;  4XUJ B;  2YFV A;  3W96 B;  2Y2O A;  3AFA B;  1P3O C;  1A7W A;  4Z2M H;  5B0Y C;  2IO5 B;  4XUJ A;  1AOI B;  5E5A B;  3KXB D;  2LY8 A;  5BNX B;  1ZLA B;  4J8X B;  3REI B;  3WTP E;  1P3K A;  4H9Q A;  2HUE C;  4JJN B;  1P3K D;  1HQ3 B;  5BNX A;  1P3F C;  2ZY3 A;  4J8X A;  1ZLA A;  1N1J A;  3REI A;  1R4V A;  5G49 B;  5AV8 C;  2Y2Q A;  5GT0 D;  3MGR A;  2F8N B;  4Z5T B;  5DNM C;  3REK B;  3UTB D;  4LD9 C;  4JJN A;  4H9O B;  4CAY B;  3MGR D;  3AZF C;  5B2I C;  5F99 A;  4WU8 D;  2F8N A;  3REK A;  5AVC C;  5F99 D;  4HGA C;  3R45 B;  1S32 B;  3AZJ D;  2F2A C;  1P3O B;  5GXQ A;  5B0Y B;  3MNN D;  3B6G C;  5GXQ D;  1S32 A;  4ZUX A;  3LJA B;  2HUE B;  3AV2 A;  4H9P B;  5BS7 C;  4KUD D;  4ZUX D;  4Z66 A;  3VH6 W;  3UT9 C;  1P3F B;  3AV2 D;  5B31 A;  1M19 C;  4Z66 D;  5CPK D;  5DNM B;  3LJA A;  4LD9 B;  1KX4 A;  5B31 D;  5AV9 A;  5AV6 D;  1P3A A;  1KX4 D;  5BO0 B;  5B2I B;  5AV9 D;  3REL D;  2BYM A;  5B1L A;  1F66 B;  4KGC D;  5GSU C;  1P3A D;  4J8U C;  1EQZ C;  5AVC B;  5B1L D;  4HGA B;  5KDM B;  1P3G D;  3AN2 D;  1P3B A;  2ZY2 A;  3MVD C;  3AYW C;  1F66 A;  1P3B D;  4WZS B;  1P3L D;  3REH D;  3VH6 T;  1TAF B;  3NQJ B;  5DNN C;  1M1A A;  5BT1 D;  3LZ0 A;  5CP6 A;  1B6W A;  1M19 B;  5B32 C;  1M1A D;  4R8P B;  3LZ0 D;  5CP6 D;  1KX5 A;  1KX3 C;  5B24 D;  5B2J D;  1KX5 D;  3AZM D;  5CPJ D;  5GSU B;  5GT3 C;  4R8P A;  3X1U D;  4J8U B;  1EQZ B;  3AZK D;  3X1V C;  3KUY C;  3AZH C;  4DRA A;  3UTA C;  3X1T C;  1P34 A;  3MGS D;  3AZL C;  2Y2J A;  3MVD B;  3AYW B;  3WTP D;  1P34 D;  3W99 D;  3KWQ B;  3MGP C;  4H9N B;  3V9R A;  5C3I C;  5B40 C;  2YFW B;  5B33 C;  2Y2P A;  1BFM A;  3AZG C;  2BYK B;  1P3P A;  5DNN B;  3KWQ A;  3LEL C;  2Y2N A;  4H9N A;  3WA9 A;  1P3P D;  2YFW A;  1M18 C;  1U35 C;  5B32 B;  1ID3 A;  3WA9 D;  3WAA C;  3C1B D;  1KX3 B;  5JA4 B;  1ID3 D;  1BH8 A;  5BNV B;  3KXB C;  5AVB B;  5GT3 B;  3X1S C;  3B6F C;  5JA4 A;  3KUY B;  1KU5 A;  3UTA B;  3AZH B;  3X1T B;  3TU4 B;  3AZL B;  2CV5 D;  5JRG A;  3C1C A;  3AV1 A;  4X23 A;  3MGP B;  5AVB A;  5C3I B;  5B40 B;  4Z2M G;  5B33 B;  5JRG D;  3AV1 D;  5GT0 C;  1P3I A;  5AV5 A;  4X23 D;  5B31 G;  1PZR A;  3TU4 A;  3AZG B;  3AZL A;  3UTB C;  5AV5 D;  3LEL B;  2NZD A;  4WU8 C;  1U35 B;  2NZD D;  4E45 A;  2DF4 C;  3W96 A;  4E44 A;  2Y2K A;  4XUJ D;  3AFA A;  3WAA B;  3AZJ C;  2XD1 A;  3AFA D;  3O62 B;  1AOI A;  5E5A A;  4G92 C;  3FDD A;  3AZN B;  3MNN C;  2HIO B;  2FFF B;  5E5A D;  3X1S B;  3B6F B;  4H9S A;  1ZLA D;  4J8X D;  3REI D;  3O62 A;  5AY8 B;  4WV4 B;  4KUD C;  1HQ3 A;  3AZN A;  2Y2H A;  2HIO A;  4JJN D;  5G49 A;  5FUG B;  4J8V C;  4Z5T A;  5CPK C;  1Q9C A;  2Y2I A;  4H9O A;  5AY8 A;  3UTB B;  4CAY A;  2F8N D;  4Z5T D;  4YM6 C;  3EPJ A;  5AV6 C;  3REK D;  3REL C;  4WU8 B;  4KGC C;  3MGQ C;  2G5I C;  3R45 A;  1P3O A;  1H3O B;  1P3G C;  5B0Y A;  4WJ3 C;  1S32 D;  1P3O D;  3F6T A;  2PYO C;  4G92 B;  2RVQ D;  2ARO C;  5B0Y D;  3MNN B;  1JFI B;  1TZY C;  1P3L C;  5AV8 B;  3AZE C;  3REH C;  4YS3 C;  2W8S A;  4KHA B;  1T3U A;  4H9P A;  5B1M C;  4UPK A;  3AZF B;  2Y2L A;  3LJA D;  1P3F A;  5AV8 A;  4NE3 A;  5B0Z C;  4J8V B;  2ZM5 A;  1P3F D;  5DNM A;  4LD9 A;  3WKJ C;  1Z2C B;  1ULY A;  1P3M C;  3AZF A;  4YM6 B;  5B24 C;  4LD9 D;  5BO0 A;  5B2J C;  5B2I A;  3AZM C;  5CPJ C;  3MGQ B;  3B6G B;  5AVC A;  4NE6 A;  5B2I D;  3X1U C;  3A6N C;  3REJ C;  3AZK C;  3KSY A;  1F66 D;  5KDM A;  3MGS C;  3LZ1 C;  5AVC D;  3WTP C;  3W99 C;  4J8W C;  2FJ7 C;  2PYO B;  4EO5 C;  5CPI C;  3B6G A;  1W2E A;  2ARO B;  4M6B A;  3VH5 A;  3UT9 B;  1TZY B;  3AZE B;  3REH B;  4YS3 B;  1TAF A;  3NQJ A;  4DQY B;  4WU9 C;  5BS7 A;  5B1M B;  3UT9 A;  2NQB C;  1M19 A;  2ZY4 A;  5B0Z B;  3WKJ B;  2Y2M A;  1P3M B;  3C1B C;  4R8P D;  5B24 B;  2ZY5 A;  3A1K A;  3W97 C;  4H9R B;  3W98 C;  2G5H C;  4G91 C;  3AZM B;  5GSU A;  4XZQ C;  2RIQ A;  4J8U A;  4AWL C;  4QLC C;  1EQZ A;  3X1U B;  3REJ B;  4ZBJ C;  3A6N B;  3AZK B;  3B0B A;  5GSU D;  3MVD A;  4J8U D;  1EQZ D;  3LZ1 B;  2CV5 C;  3AYW A;  4H9R A;  3VH5 T;  3AZI C;  4J8W B;  2FJ7 B;  4EO5 B;  3MVD D;  5CPI B;  3AYW D;  3KFU G;  3REJ A;  3KWQ D;  2F8N G;  2CWE A;  2BYK A;  5DNN A;  4WU9 B;  5DNN D;  2NQB B;  5B32 A;  4XUJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...