3MGPB

Binding of cobalt ions to the nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpB00
5BS7C 3W96D 5AV8A 5CPIC 3AFAA 5B0YC 4H9SA 5AV5D 1F66D 3AZIA 3WTPB 5AY8D 3AZED 3AZHA 5JRGB 1F1EA 2RVQD 4J8UB 2JSSA 4CSRA 3KWQD 1BH8A 5B2IA 3REHC 3UTBA 2AROA 1P3IC 4E45A 1TZYB 2FJ7B 5B33C 5AVBC 2F8NK 3LZ0D 3A6ND 5C3IC 5B40D 3X1SC 2NQBC 3KUYC 3MVDB 4Z66B 3LELC 1P3BB 3REKD 4QLCB 4WU8C 3UTAD 3AZJB 3WAAC 3WTPA 1M18D 3B6GC 5CP6D 3AV1D 1HQ3C 5JRGA 1ZLAC 5B1MC 4J8UA 5B24B 1P3AB 3X1UC 4J8XB 4LD9C 2F8NH 3C1BC 1TZYA 3TU4C 3RELB 2FJ7A 5GT0C 1U35C 5AV9C 1N1JA 3VH6T 5B31C 1M19C 3VH5T 3MVDA 4WU9D 1P3BA 1P3FB 1BFMA 4QLCA 4KGCD 5GSUC 3AZJA 1P3PD 3B0CW 1P3MC 4JJNC 5AV5B 3LZ1C 4J8WC 5B24A 1P3AA 1AOID 3AZEB 3AZLD 4G91B 3KWQB 3RELA 3C1CC 5DNMD 3W98C 2PYOC 5B32D 4XZQB 5AV8D 3MGSB 4R8PC 3LZ0B 3A6NB 3AZID 1P3FA 4YS3D 1KX5C 3B6FD 5B2ID 3REKB 5AV5A 3W99B 4XUJA 3UTAB 4X23D 1M18B 3AZEA 3AV2D 2YFWB 3KXBC 3KWQA 2F8ND 3VH6A 5GXQC 3VH5A 4XZQA 3MGRD 3MGSA 3LZ0A 3WTPD 1HTAA 5JRGD 4WU9B 2HIOB 3VH6W 2BYKB 5KDMB 5BO0A 3REKA 5DNNA 5CPID 3W99A 3VH5W 3UTAA 1TZYD 1P3PB 4AWLB 1M18A 2FJ7D 5AV6C 4EO5C 2YFWA 3AZLB 3REHD 4YM6C 1KX3B 1WWSA 1P3BD 4QLCD 5AVBD 3X1TC 5B32B 1KX4C 2HIOA 3KUYD 2NQBD 2BYKA 5KDMA 4Z5TB 3O62B 5B0ZC 1P3PA 4YS3B 3B6FB 3RELD 1BH9B 3WAAD 5CPJC 3B6GD 1ZLAD 1HQ3D 5B1MD 3REJB 3MGQC 4X23B 3MNNB 3AV2B 3AZLA 3C1BD 4KHAB 1KX3A 2F8NB 1U35D 5AV9D 3WTPE 4NE6A 5B32A 3MGRB 1M19D 1ULYA 4XUJD 1P34C 4Z5TA 4NE5A 3O62A 4WZSB 3B0DB 5GSUD 4YS3A 3B6FA 4KUDC 1BH9A 4JJND 5GT3C 4H9PB 5CPIB 5B0YB 1P3KC 3REJA 4J8WD 4X23A 4XZQD 3MNNA 3MGSD 1N1JB 3AV2A 4G92C 3LJAC 4KHAA 1B67A 2F8NA 5CHLB 4ZUXA 3REHB 3W98D 4DRBA 3MGRA 2HUEC 5B33B 3W99D 5DNND 5AVBB 4R8PD 1P3OC 3AYWC 3REIC 3WKJC 5C3IB 2LY8A 3X1SB 2NQBB 3KUYB 1JFIB 5BS7A 5B31G 5CPIA 4H9PA 4Z66C 3V9RB 5B0YA 3MGPC 3NQUB 4WU8B 3WAAB 3B6GB 1ZLAB 1HQ3B 5B1MB 5AVCC 3AZKC 4LD9B 5GXQD 3REHA 1P3IA 3C1BB 2HIOD 4J8XC 2NZDC 5GT0B 1U35B 5AV9B 5B33A 5AVBA 4ZBJC 5B31B 1M19B 3X1SA 4XUJB 3KUYA 2NQBA 1JFIA 1P3LC 1A7WA 3LELA 3AZNC 3V9RA 1TAFB 5E5AC 3NQUA 5GSUB 4WU8A 1ID3C 1KX3D 1P3MB 5F99C 3WAAA 4JJNB 3B6GA 1ZLAA 1HQ3A 5B1MA 3W96C 3LZ1B 4J8WB 3AN2C 3X1UA 4LD9A 1F66C 3C1BA 3W97C 5AY8C 3TU4A 4YM6D 1M1AC 4Z5TD 5GT0A 1U35A 5AV9A 3C1CB 3X1VC 3O62D 3AZMC 3W98B 3NQJB 2PYOB 5BO0B 5B31A 1M19A 5DNNB 4R8PB 1EQZC 4J8VC 3REJD 2BYMB 3MNND 1TAFA 5B0ZD 3A6NC 5GSUA 5B40C 1P3MA 1KX5B 4JJNA 4ZUXD 5CPJD 2IO5C 3LZ1A 4J8WA 4NFTA 5CP6C 3AV1C 5GXQB 3C1CA 3AZGC 5CPKC 3W98A 4H9RB 3NQJA 2PYOA 2CWEA 3UT9C 4R8PA 5B0YD 2BYMA 1P34D 5B2JC 1S32C 1P3GC 1R4VA 1KX5A 3AZFC 4WU9C 5GT3D 1P3ID 1P3KD 5BNXB 5JA4B 4KGCC 5AV6B 5B33D 3KXBA 3LJAD 2CV5C 5GXQA 4DRAA 3X1SD 1AOIC 4H9RA 4YM6B 3WA9C 3LELD 3KSYA 3X1TB 4WU8D 1P3OD 3AYWD 1H3OB 5DNMC 3REID 5B1LC 5AV8C 3AFAC 3X1UD 4LD9D 4H9SC 5B0ZB 3AZIC 3MGPD 4WV4B 5BNXA 3TU4D 4HGAC 5JA4A 3AZHC 5GT0D 4ZUXB 5AV6A 5CPJB 5B2IC 3MGQB 3AZKD 3UTBC 5B31D 2AROC 4H9QB 3R45B 4YM6A 2NZDD 4H9NB 1Q9CA 3X1TA 1H3OA 1P3MD 1KX4A 1WWIA 4NE3A 3LZ1D 1P34B 1P3LD 3AZND 5B0ZA 3WTPC 1ID3D 5JRGC 5F99D 3C1CD 4J8UC 5GT3B 5CPJA 1P3IB 1P3KB 3MGQA 2PYOD 3AN2D 4H9QA 4WNNB 1TZYC 2FJ7C 3R45A 4G92B 3LJAB 3W97D 1M1AD 4H9NA 3X1VD 3AZMD 1KX5D 3LELB 2HUEB 3MVDC 1P3OB 1EQZD 4J8VD 3AYWB 5FUGB 3REIB 1P34A 1P3BC 4QLCC 3WKJB 2YFVB 3AZJC 2L5AA 5BNVB 3KXBD 3X1UB 4KUDA 5GT3A 5B24C 1P3AC 1P3KA 3MGPB 3TU4B 4WNNA 3RELC 3LJAA 5AVCB 3AZKB 5BT1C 4Z2MH 3AZGD 5CPKD 2NZDB 3B0BA 3UT9D 1P3OA 4ZBJB 3AYWA 5FUGA 3REIA 1P3FC 3WKJA 2YFVA 5AV6D 5B2JD 1S32D 5BNVA 1P3LB 5AV5C 1P3GD 3AZFD 4XUJC 3AZNB 4Z66A 4CAYB 5E5AB 3MGPA 3AZEC 1ID3B 5F99B 2RVQC 4G91C 1KU5A 3KWQC 3X1TD 3W96B 5AVCA 3AZKA 3AN2B 1F66B 2CV5D 1KX4D 4XZQC 3MGSC 5AY8B 4J8XA 3W97B 1M1AB 2NZDA 3WA9D 3LZ0C 3X1VB 3AZMB 5G49B 4UUZB 5B1LD 1EQZB 4J8VB 3MGQD 1P3LA 3REKC 3W99C 5DNNC 3AFAD 3AZNA 3UTAC 4CAYA 5E5AA 1M18C 3KXBB 1ID3A 5B40B 5F99A 3AZHD 2IO5B 3W96A 3AN2A 1F66A 3UTBD 2AROD 3W97A 5AY8A 5CP6B 3AV1B 1M1AA 3X1VA 3AZMA 5G49A 3AZGB 5CPKB 4KUDD 4UUZA 2HIOC 3UT9B 1EQZA 4J8VA 1P3PC 5B2JB 3A6NA 4AWLC 4EO5B 1S32B 5B40A 1P3GB 3AZFB 4J8UD 5B32G 3AZLC 4KGCB 1KX3C 5CP6A 3AV1A 4H9OB 2CV5B 3WKJD 1KX4B 5B32C 3AZGA 5CPKA 1AOIB 3WA9B 3MVDD 4Z66D 3UT9A 4Z5TC 5DNMB 3O62C 5B1LB 4Z2MG 5B2JA 4YS3C 3B6FC 3AZJD 1S32A 2F8NG 4M6BA 5AV8B 5AVCD 1P3GA 3AFAB 3AZFA 3REJC 4WU9A 4X23C 5B24D 3MNNC 3AZIB 1P3AD 3AV2C 4J8XD 3AZHB 4HGAB 4KGCA 4CSRB 4E44A 1BH8B 5B2IB 4ZUXC 4H9OA 3UTBB 2CV5A 2AROB 1B6WA 5BT1D 3MGRC 1AOIA 3WA9A 3B0CT 5E5AD 4KUDB 5DNMA 1P3FD 5B1LA 3B0DC
chains in the Genus database with same CATH superfamily
2Y2LA 5BS7C 3W96D 5AV8A 5CPIC 3AFAA 5B0YC 4H9SA 5AV5D 1F66D 3AZIA 3WTPB 5AY8D 3AZED 3AZHA 5JRGB 1F1EA 2RVQD 4J8UB 2JSSA 4CSRA 3KWQD 1BH8A 5B2IA 3REHC 3EPKA 3UTBA 2AROA 1P3IC 4E45A 1TZYB 2FJ7B 5B33C 5AVBC 2F8NK 3LZ0D 3A6ND 5C3IC 5B40D 3X1SC 2NQBC 3KUYC 3MVDB 4Z66B 3LELC 1P3BB 3REKD 4QLCB 2Y2KA 4WU8C 3UTAD 3AZJB 3WAAC 3WTPA 1M18D 3B6GC 5CP6D 3AV1D 1HQ3C 5JRGA 1ZLAC 5B1MC 4J8UA 5B24B 1P3AB 3X1UC 4J8XB 4LD9C 2F8NH 3C1BC 1TZYA 3TU4C 3RELB 2FJ7A 5GT0C 1U35C 5AV9C 1N1JA 2Y2IA 3VH6T 2XD1A 3H0RC 5B31C 1M19C 3VH5T 3MVDA 4WU9D 1P3BA 1P3FB 1BFMA 4QLCA 4KGCD 5GSUC 3AZJA 1P3PD 3B0CW 1P3MC 4JJNC 5AV5B 3LZ1C 4J8WC 5B24A 1P3AA 1AOID 3AZEB 3AZLD 4G91B 3KWQB 3RELA 3C1CC 5DNMD 3W98C 2PYOC 3A1KA 4XZQB 5B32D 5AV8D 3MGSB 4R8PC 2ZY2A 3LZ0B 3A6NB 3AZID 1P3FA 4YS3D 1KX5C 3B6FD 5B2ID 1T3UA 3REKB 5AV5A 3W99B 4XUJA 3UTAB 4X23D 1M18B 3AZEA 3AV2D 2YFWB 3KXBC 3KWQA 2F8ND 3VH6A 5GXQC 3VH5A 4XZQA 3MGRD 3MGSA 2F2AC 3LZ0A 3WTPD 1HTAA 5JRGD 4WU9B 2HIOB 3VH6W 2BYKB 5KDMB 5BO0A 3REKA 5DNNA 5CPID 3W99A 3VH5W 3UTAA 1TZYD 1P3PB 4AWLB 1M18A 2FJ7D 3IP4C 5AV6C 4EO5C 2YFWA 3AZLB 3REHD 4YM6C 1KX3B 1WWSA 1P3BD 4QLCD 5AVBD 3X1TC 5B32B 2Y2HA 1KX4C 2HIOA 3KUYD 2NQBD 2BYKA 5KDMA 4Z5TB 3O62B 5B0ZC 1P3PA 4YS3B 3B6FB 3RELD 1BH9B 3WAAD 5CPJC 3B6GD 1ZLAD 1HQ3D 5B1MD 3REJB 3MGQC 4X23B 3MNNB 3AV2B 3AZLA 3C1BD 4KHAB 1KX3A 2F8NB 2ZY3A 1U35D 5AV9D 3WTPE 4NE6A 5B32A 3MGRB 1M19D 1ULYA 4XUJD 1P34C 4Z5TA 2BG1A 4NE5A 2Y2QA 3O62A 4WZSB 3B0DB 5GSUD 3EPJA 4YS3A 3B6FA 1BH9A 4KUDC 4JJND 5GT3C 4H9PB 5CPIB 5B0YB 1P3KC 3REJA 4J8WD 4X23A 4XZQD 3MNNA 3P5JB 3AL0C 3MGSD 1N1JB 3AV2A 4G92C 3LJAC 4KHAA 1B67A 2F8NA 5CHLB 4ZUXA 3REHB 3W98D 3EG5B 4DRBA 3MGRA 2HUEC 5B33B 3W99D 5DNND 5AVBB 4R8PD 1P3OC 3AYWC 3REIC 3WKJC 5C3IB 2LY8A 3X1SB 2NQBB 3KUYB 1JFIB 5BS7A 5B31G 5CPIA 4H9PA 3V9RB 5B0YA 4Z66C 3MGPC 3NQUB 2DQNC 4WU8B 3WAAB 2Y2JA 1Z2CB 3B6GB 1ZLAB 1HQ3B 5B1MB 3F6TA 5AVCC 3AZKC 4LD9B 5GXQD 3REHA 1P3IA 3C1BB 2HIOD 4J8XC 2NZDC 5GT0B 1U35B 5AV9B 5B33A 5AVBA 2Y2PA 4ZBJC 5B31B 1M19B 3X1SA 4XUJB 3KUYA 2NQBA 1JFIA 1P3LC 1A7WA 3LELA 3AZNC 3V9RA 1TAFB 5E5AC 3KFUG 3NQUA 5GSUB 4WU8A 1ID3C 1KX3D 1W2EA 5F99C 1P3MB 3WAAA 4JJNB 3B6GA 1ZLAA 1HQ3A 5B1MA 3W96C 3LZ1B 4J8WB 3AN2C 3X1UA 4LD9A 1F66C 1PZRA 3C1BA 3W97C 5AY8C 3TU4A 4YM6D 1M1AC 4Z5TD 5GT0A 1U35A 5AV9A 3C1CB 3X1VC 3O62D 3AZMC 3W98B 3NQJB 2PYOB 5BO0B 5B31A 1M19A 5DNNB 4R8PB 2Y2OA 1EQZC 4J8VC 3REJD 2BYMB 3MNND 1TAFA 5B0ZD 3A6NC 5GSUA 5B40C 1P3MA 1KX5B 4JJNA 4ZUXD 5CPJD 2DF4C 2IO5C 3LZ1A 4J8WA 4NFTA 5CP6C 3AV1C 5GXQB 3C1CA 4DQYB 2W8SA 3AZGC 5CPKC 3W98A 4H9RB 3NQJA 2PYOA 2CWEA 3UT9C 4R8PA 5B0YD 2BYMA 1P34D 5B2JC 1S32C 1P3GC 1R4VA 1KX5A 3AZFC 4WU9C 2JCHA 5GT3D 1P3ID 1P3KD 5BNXB 5JA4B 4KGCC 5AV6B 5B33D 2RIQA 3KXBA 3LJAD 2CV5C 5GXQA 4DRAA 3X1SD 1AOIC 4H9RA 4YM6B 3WA9C 3LELD 3KSYA 3X1TB 2G5HC 4WU8D 1P3OD 3AYWD 1H3OB 5DNMC 3REID 5B1LC 2ZY4A 5AV8C 3AFAC 3X1UD 4LD9D 4H9SC 5B0ZB 3AZIC 3MGPD 4WV4B 5BNXA 3TU4D 4HGAC 5JA4A 3AZHC 5GT0D 4ZUXB 5AV6A 5CPJB 5B2IC 3MGQB 3AZKD 3UTBC 5B31D 2AROC 4H9QB 3R45B 4YM6A 2NZDD 4H9NB 1Q9CA 3X1TA 1H3OA 1P3MD 1KX4A 1WWIA 4NE3A 3LZ1D 1P34B 1P3LD 2ZM5A 3EPLA 3AZND 5B0ZA 3WTPC 1ID3D 5JRGC 5F99D 3C1CD 4J8UC 5GT3B 5CPJA 1P3IB 1P3KB 3MGQA 2PYOD 3AN2D 4H9QA 4WNNB 1TZYC 2FJ7C 3R45A 4G92B 3LJAB 3W97D 1M1AD 4H9NA 3X1VD 3AZMD 1KX5D 3LELB 2JE5A 2HUEB 3MVDC 1P3OB 1EQZD 4J8VD 3AYWB 5FUGB 3REIB 1P34A 1P3BC 4QLCC 3EPHA 3WKJB 2YFVB 2Y2MA 3AZJC 2L5AA 5BNVB 3KXBD 3X1UB 4KUDA 5GT3A 5B24C 1P3AC 1P3KA 3MGPB 3TU4B 4WNNA 3RELC 3LJAA 5AVCB 3AZKB 2G5IC 5BT1C 4Z2MH 3AZGD 5CPKD 2NZDB 3B0BA 3UT9D 1P3OA 4ZBJB 3AYWA 5FUGA 3REIA 1P3FC 3WKJA 2YFVA 5AV6D 5B2JD 1S32D 5BNVA 1P3LB 5AV5C 1P3GD 3AZFD 4XUJC 3AZNB 4Z66A 4CAYB 5E5AB 3MGPA 3AZEC 1ID3B 5F99B 2RVQC 4G91C 1KU5A 3KWQC 3X1TD 3W96B 5AVCA 3AZKA 3AN2B 1F66B 2CV5D 1KX4D 4XZQC 3MGSC 5AY8B 4J8XA 3W97B 2XD5A 1M1AB 2NZDA 3WA9D 3LZ0C 3X1VB 3AZMB 5G49B 4UUZB 5B1LD 1EQZB 4J8VB 3MGQD 1P3LA 3REKC 3W99C 5DNNC 3AFAD 3AZNA 3UTAC 4CAYA 5E5AA 1M18C 3KXBB 1ID3A 5B40B 5F99A 3AZHD 2IO5B 3W96A 3AN2A 1F66A 3UTBD 2AROD 3FDDA 3W97A 5AY8A 5CP6B 3AV1B 1M1AA 3X1VA 3AZMA 5G49A 3AZGB 5CPKB 4KUDD 4UUZA 2HIOC 3UT9B 2Y2NA 4J8VA 1EQZA 1P3PC 5B2JB 2VQRA 3H0LC 3A6NA 4EO5B 4AWLC 1S32B 5B40A 1P3GB 3AZFB 2UWXA 4J8UD 5B32G 3AZLC 4KGCB 3A1IA 2ZY5A 1KX3C 5CP6A 3AV1A 4H9OB 2CV5B 3WKJD 1KX4B 5B32C 3AZGA 5CPKA 1AOIB 3H0MC 3WA9B 3MVDD 4Z66D 3UT9A 4Z5TC 5DNMB 3O62C 5B1LB 4Z2MG 4WJ3C 5B2JA 4YS3C 3B6FC 3AZJD 1S32A 2F8NG 4M6BA 5AV8B 5AVCD 1P3GA 3AFAB 3AZFA 4UPKA 3REJC 4WU9A 4X23C 5B24D 3MNNC 3AZIB 1P3AD 3AV2C 4J8XD 3AZHB 4HGAB 2Y2GA 4KGCA 4CSRB 4E44A 1BH8B 5B2IB 4ZUXC 4H9OA 3UTBB 2CV5A 2AROB 2J8PA 1B6WA 5BT1D 3MGRC 1AOIA 3WA9A 3B0CT 5E5AD 2FFFB 4KUDB 5DNMA 1P3FD 5B1LA 3B0DC
chains in the Genus database with same CATH topology
2Y2LA 5BS7C 3W96D 5AV8A 5CPIC 3AFAA 5B0YC 4H9SA 5AV5D 1F66D 3AZIA 3WTPB 5AY8D 3AZED 3AZHA 5JRGB 1F1EA 2RVQD 4J8UB 2JSSA 4CSRA 3KWQD 1BH8A 5B2IA 3REHC 3EPKA 3UTBA 2AROA 1P3IC 4E45A 1TZYB 2FJ7B 5B33C 5AVBC 2F8NK 3LZ0D 3A6ND 5C3IC 5B40D 3X1SC 2NQBC 3KUYC 3MVDB 4Z66B 3LELC 1P3BB 3REKD 4QLCB 2Y2KA 4WU8C 3UTAD 3AZJB 3WAAC 3WTPA 1M18D 3B6GC 5CP6D 3AV1D 1HQ3C 5JRGA 1ZLAC 5B1MC 4J8UA 5B24B 1P3AB 3X1UC 4J8XB 4LD9C 2F8NH 3C1BC 1TZYA 3TU4C 3RELB 2FJ7A 5GT0C 1U35C 5AV9C 1N1JA 2Y2IA 3VH6T 2XD1A 3H0RC 5B31C 1M19C 3VH5T 3MVDA 4WU9D 1P3BA 1P3FB 1BFMA 4QLCA 4KGCD 5GSUC 3AZJA 1P3PD 3B0CW 1P3MC 4JJNC 5AV5B 3LZ1C 4J8WC 5B24A 1P3AA 1AOID 3AZEB 3AZLD 4G91B 3KWQB 3RELA 3C1CC 5DNMD 3W98C 2PYOC 3A1KA 4XZQB 5B32D 5AV8D 3MGSB 4R8PC 2ZY2A 3LZ0B 3A6NB 3AZID 1P3FA 4YS3D 1KX5C 3B6FD 5B2ID 1T3UA 3REKB 5AV5A 3W99B 4XUJA 3UTAB 4X23D 1M18B 3AZEA 3AV2D 2YFWB 3KXBC 3KWQA 2F8ND 3VH6A 5GXQC 3VH5A 4XZQA 3MGRD 3MGSA 2F2AC 3LZ0A 3WTPD 1HTAA 5JRGD 4WU9B 2HIOB 3VH6W 2BYKB 5KDMB 5BO0A 3REKA 5DNNA 5CPID 3W99A 3VH5W 3UTAA 1TZYD 1P3PB 4AWLB 1M18A 2FJ7D 3IP4C 5AV6C 4EO5C 2YFWA 3AZLB 3REHD 4YM6C 1KX3B 1WWSA 1P3BD 4QLCD 5AVBD 3X1TC 5B32B 2Y2HA 1KX4C 2HIOA 3KUYD 2NQBD 2BYKA 5KDMA 4Z5TB 3O62B 5B0ZC 1P3PA 4YS3B 3B6FB 3RELD 1BH9B 3WAAD 5CPJC 3B6GD 1ZLAD 1HQ3D 5B1MD 3REJB 3MGQC 4X23B 3MNNB 3AV2B 3AZLA 3C1BD 4KHAB 1KX3A 2F8NB 2ZY3A 1U35D 5AV9D 3WTPE 4NE6A 5B32A 3MGRB 1M19D 1ULYA 4XUJD 1P34C 4Z5TA 2BG1A 4NE5A 2Y2QA 3O62A 4WZSB 3B0DB 5GSUD 3EPJA 4YS3A 3B6FA 1BH9A 4KUDC 4JJND 5GT3C 4H9PB 5CPIB 5B0YB 1P3KC 3REJA 4J8WD 4X23A 4XZQD 3MNNA 3P5JB 3AL0C 3MGSD 1N1JB 3AV2A 4G92C 3LJAC 4KHAA 1B67A 2F8NA 5CHLB 4ZUXA 3REHB 3W98D 3EG5B 4DRBA 3MGRA 2HUEC 5B33B 3W99D 5DNND 5AVBB 4R8PD 1P3OC 3AYWC 3REIC 3WKJC 5C3IB 2LY8A 3X1SB 2NQBB 3KUYB 1JFIB 5BS7A 5B31G 5CPIA 4H9PA 3V9RB 5B0YA 4Z66C 3MGPC 3NQUB 2DQNC 4WU8B 3WAAB 2Y2JA 1Z2CB 3B6GB 1ZLAB 1HQ3B 5B1MB 3F6TA 5AVCC 3AZKC 4LD9B 5GXQD 3REHA 1P3IA 3C1BB 2HIOD 4J8XC 2NZDC 5GT0B 1U35B 5AV9B 5B33A 5AVBA 2Y2PA 4ZBJC 5B31B 1M19B 3X1SA 4XUJB 3KUYA 2NQBA 1JFIA 1P3LC 1A7WA 3LELA 3AZNC 3V9RA 1TAFB 5E5AC 3KFUG 3NQUA 5GSUB 4WU8A 1ID3C 1KX3D 1W2EA 5F99C 1P3MB 3WAAA 4JJNB 3B6GA 1ZLAA 1HQ3A 5B1MA 3W96C 3LZ1B 4J8WB 3AN2C 3X1UA 4LD9A 1F66C 1PZRA 3C1BA 3W97C 5AY8C 3TU4A 4YM6D 1M1AC 4Z5TD 5GT0A 1U35A 5AV9A 3C1CB 3X1VC 3O62D 3AZMC 3W98B 3NQJB 2PYOB 5BO0B 5B31A 1M19A 5DNNB 4R8PB 2Y2OA 1EQZC 4J8VC 3REJD 2BYMB 3MNND 1TAFA 5B0ZD 3A6NC 5GSUA 5B40C 1P3MA 1KX5B 4JJNA 4ZUXD 5CPJD 2DF4C 2IO5C 3LZ1A 4J8WA 4NFTA 5CP6C 3AV1C 5GXQB 3C1CA 4DQYB 2W8SA 3AZGC 5CPKC 3W98A 4H9RB 3NQJA 2PYOA 2CWEA 3UT9C 4R8PA 5B0YD 2BYMA 1P34D 5B2JC 1S32C 1P3GC 1R4VA 1KX5A 3AZFC 4WU9C 2JCHA 5GT3D 1P3ID 1P3KD 5BNXB 5JA4B 4KGCC 5AV6B 5B33D 2RIQA 3KXBA 3LJAD 2CV5C 5GXQA 4DRAA 3X1SD 1AOIC 4H9RA 4YM6B 3WA9C 3LELD 3KSYA 3X1TB 2G5HC 4WU8D 1P3OD 3AYWD 1H3OB 5DNMC 3REID 5B1LC 2ZY4A 5AV8C 3AFAC 3X1UD 4LD9D 4H9SC 5B0ZB 3AZIC 3MGPD 4WV4B 5BNXA 3TU4D 4HGAC 5JA4A 3AZHC 5GT0D 4ZUXB 5AV6A 5CPJB 5B2IC 3MGQB 3AZKD 3UTBC 5B31D 2AROC 4H9QB 3R45B 4YM6A 2NZDD 4H9NB 1Q9CA 3X1TA 1H3OA 1P3MD 1KX4A 1WWIA 4NE3A 3LZ1D 1P34B 1P3LD 2ZM5A 3EPLA 3AZND 5B0ZA 3WTPC 1ID3D 5JRGC 5F99D 3C1CD 4J8UC 5GT3B 5CPJA 1P3IB 1P3KB 3MGQA 2PYOD 3AN2D 4H9QA 4WNNB 1TZYC 2FJ7C 3R45A 4G92B 3LJAB 3W97D 1M1AD 4H9NA 3X1VD 3AZMD 1KX5D 3LELB 2JE5A 2HUEB 3MVDC 1P3OB 1EQZD 4J8VD 3AYWB 5FUGB 3REIB 1P34A 1P3BC 4QLCC 3EPHA 3WKJB 2YFVB 2Y2MA 3AZJC 2L5AA 5BNVB 3KXBD 3X1UB 4KUDA 5GT3A 5B24C 1P3AC 1P3KA 3MGPB 3TU4B 4WNNA 3RELC 3LJAA 5AVCB 3AZKB 2G5IC 5BT1C 4Z2MH 3AZGD 5CPKD 2NZDB 3B0BA 3UT9D 1P3OA 4ZBJB 3AYWA 5FUGA 3REIA 1P3FC 3WKJA 2YFVA 5AV6D 5B2JD 1S32D 5BNVA 1P3LB 5AV5C 1P3GD 3AZFD 4XUJC 3AZNB 4Z66A 4CAYB 5E5AB 3MGPA 3AZEC 1ID3B 5F99B 2RVQC 4G91C 1KU5A 3KWQC 3X1TD 3W96B 5AVCA 3AZKA 3AN2B 1F66B 2CV5D 1KX4D 4XZQC 3MGSC 5AY8B 4J8XA 3W97B 2XD5A 1M1AB 2NZDA 3WA9D 3LZ0C 3X1VB 3AZMB 5G49B 4UUZB 5B1LD 1EQZB 4J8VB 3MGQD 1P3LA 3REKC 3W99C 5DNNC 3AFAD 3AZNA 3UTAC 4CAYA 5E5AA 1M18C 3KXBB 1ID3A 5B40B 5F99A 3AZHD 2IO5B 3W96A 3AN2A 1F66A 3UTBD 2AROD 3FDDA 3W97A 5AY8A 5CP6B 3AV1B 1M1AA 3X1VA 3AZMA 5G49A 3AZGB 5CPKB 4KUDD 4UUZA 2HIOC 3UT9B 2Y2NA 4J8VA 1EQZA 1P3PC 5B2JB 2VQRA 3H0LC 3A6NA 4EO5B 4AWLC 1S32B 5B40A 1P3GB 3AZFB 2UWXA 4J8UD 5B32G 3AZLC 4KGCB 3A1IA 2ZY5A 1KX3C 5CP6A 3AV1A 4H9OB 2CV5B 3WKJD 1KX4B 5B32C 3AZGA 5CPKA 1AOIB 3H0MC 3WA9B 3MVDD 4Z66D 3UT9A 4Z5TC 5DNMB 3O62C 5B1LB 4Z2MG 4WJ3C 5B2JA 4YS3C 3B6FC 3AZJD 1S32A 2F8NG 4M6BA 5AV8B 5AVCD 1P3GA 3AFAB 3AZFA 4UPKA 3REJC 4WU9A 4X23C 5B24D 3MNNC 3AZIB 1P3AD 3AV2C 4J8XD 3AZHB 4HGAB 2Y2GA 4KGCA 4CSRB 4E44A 1BH8B 5B2IB 4ZUXC 4H9OA 3UTBB 2CV5A 2AROB 2J8PA 1B6WA 5BT1D 3MGRC 1AOIA 3WA9A 3B0CT 5E5AD 2FFFB 4KUDB 5DNMA 1P3FD 5B1LA 3B0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS7 C;  3W96 D;  5AV8 A;  5CPI C;  3AFA A;  5B0Y C;  4H9S A;  5AV5 D;  1F66 D;  3AZI A;  3WTP B;  5AY8 D;  3AZE D;  3AZH A;  5JRG B;  1F1E A;  2RVQ D;  4J8U B;  2JSS A;  4CSR A;  3KWQ D;  1BH8 A;  5B2I A;  3REH C;  3UTB A;  2ARO A;  1P3I C;  4E45 A;  1TZY B;  2FJ7 B;  5B33 C;  5AVB C;  2F8N K;  3LZ0 D;  3A6N D;  5C3I C;  5B40 D;  3X1S C;  2NQB C;  3KUY C;  3MVD B;  4Z66 B;  3LEL C;  1P3B B;  3REK D;  4QLC B;  4WU8 C;  3UTA D;  3AZJ B;  3WAA C;  3WTP A;  1M18 D;  3B6G C;  5CP6 D;  3AV1 D;  1HQ3 C;  5JRG A;  1ZLA C;  5B1M C;  4J8U A;  5B24 B;  1P3A B;  3X1U C;  4J8X B;  4LD9 C;  2F8N H;  3C1B C;  1TZY A;  3TU4 C;  3REL B;  2FJ7 A;  5GT0 C;  1U35 C;  5AV9 C;  1N1J A;  3VH6 T;  5B31 C;  1M19 C;  3VH5 T;  3MVD A;  4WU9 D;  1P3B A;  1P3F B;  1BFM A;  4QLC A;  4KGC D;  5GSU C;  3AZJ A;  1P3P D;  3B0C W;  1P3M C;  4JJN C;  5AV5 B;  3LZ1 C;  4J8W C;  5B24 A;  1P3A A;  1AOI D;  3AZE B;  3AZL D;  4G91 B;  3KWQ B;  3REL A;  3C1C C;  5DNM D;  3W98 C;  2PYO C;  5B32 D;  4XZQ B;  5AV8 D;  3MGS B;  4R8P C;  3LZ0 B;  3A6N B;  3AZI D;  1P3F A;  4YS3 D;  1KX5 C;  3B6F D;  5B2I D;  3REK B;  5AV5 A;  3W99 B;  4XUJ A;  3UTA B;  4X23 D;  1M18 B;  3AZE A;  3AV2 D;  2YFW B;  3KXB C;  3KWQ A;  2F8N D;  3VH6 A;  5GXQ C;  3VH5 A;  4XZQ A;  3MGR D;  3MGS A;  3LZ0 A;  3WTP D;  1HTA A;  5JRG D;  4WU9 B;  2HIO B;  3VH6 W;  2BYK B;  5KDM B;  5BO0 A;  3REK A;  5DNN A;  5CPI D;  3W99 A;  3VH5 W;  3UTA A;  1TZY D;  1P3P B;  4AWL B;  1M18 A;  2FJ7 D;  5AV6 C;  4EO5 C;  2YFW A;  3AZL B;  3REH D;  4YM6 C;  1KX3 B;  1WWS A;  1P3B D;  4QLC D;  5AVB D;  3X1T C;  5B32 B;  1KX4 C;  2HIO A;  3KUY D;  2NQB D;  2BYK A;  5KDM A;  4Z5T B;  3O62 B;  5B0Z C;  1P3P A;  4YS3 B;  3B6F B;  3REL D;  1BH9 B;  3WAA D;  5CPJ C;  3B6G D;  1ZLA D;  1HQ3 D;  5B1M D;  3REJ B;  3MGQ C;  4X23 B;  3MNN B;  3AV2 B;  3AZL A;  3C1B D;  4KHA B;  1KX3 A;  2F8N B;  1U35 D;  5AV9 D;  3WTP E;  4NE6 A;  5B32 A;  3MGR B;  1M19 D;  1ULY A;  4XUJ D;  1P34 C;  4Z5T A;  4NE5 A;  3O62 A;  4WZS B;  3B0D B;  5GSU D;  4YS3 A;  3B6F A;  4KUD C;  1BH9 A;  4JJN D;  5GT3 C;  4H9P B;  5CPI B;  5B0Y B;  1P3K C;  3REJ A;  4J8W D;  4X23 A;  4XZQ D;  3MNN A;  3MGS D;  1N1J B;  3AV2 A;  4G92 C;  3LJA C;  4KHA A;  1B67 A;  2F8N A;  5CHL B;  4ZUX A;  3REH B;  3W98 D;  4DRB A;  3MGR A;  2HUE C;  5B33 B;  3W99 D;  5DNN D;  5AVB B;  4R8P D;  1P3O C;  3AYW C;  3REI C;  3WKJ C;  5C3I B;  2LY8 A;  3X1S B;  2NQB B;  3KUY B;  1JFI B;  5BS7 A;  5B31 G;  5CPI A;  4H9P A;  4Z66 C;  3V9R B;  5B0Y A;  3MGP C;  3NQU B;  4WU8 B;  3WAA B;  3B6G B;  1ZLA B;  1HQ3 B;  5B1M B;  5AVC C;  3AZK C;  4LD9 B;  5GXQ D;  3REH A;  1P3I A;  3C1B B;  2HIO D;  4J8X C;  2NZD C;  5GT0 B;  1U35 B;  5AV9 B;  5B33 A;  5AVB A;  4ZBJ C;  5B31 B;  1M19 B;  3X1S A;  4XUJ B;  3KUY A;  2NQB A;  1JFI A;  1P3L C;  1A7W A;  3LEL A;  3AZN C;  3V9R A;  1TAF B;  5E5A C;  3NQU A;  5GSU B;  4WU8 A;  1ID3 C;  1KX3 D;  1P3M B;  5F99 C;  3WAA A;  4JJN B;  3B6G A;  1ZLA A;  1HQ3 A;  5B1M A;  3W96 C;  3LZ1 B;  4J8W B;  3AN2 C;  3X1U A;  4LD9 A;  1F66 C;  3C1B A;  3W97 C;  5AY8 C;  3TU4 A;  4YM6 D;  1M1A C;  4Z5T D;  5GT0 A;  1U35 A;  5AV9 A;  3C1C B;  3X1V C;  3O62 D;  3AZM C;  3W98 B;  3NQJ B;  2PYO B;  5BO0 B;  5B31 A;  1M19 A;  5DNN B;  4R8P B;  1EQZ C;  4J8V C;  3REJ D;  2BYM B;  3MNN D;  1TAF A;  5B0Z D;  3A6N C;  5GSU A;  5B40 C;  1P3M A;  1KX5 B;  4JJN A;  4ZUX D;  5CPJ D;  2IO5 C;  3LZ1 A;  4J8W A;  4NFT A;  5CP6 C;  3AV1 C;  5GXQ B;  3C1C A;  3AZG C;  5CPK C;  3W98 A;  4H9R B;  3NQJ A;  2PYO A;  2CWE A;  3UT9 C;  4R8P A;  5B0Y D;  2BYM A;  1P34 D;  5B2J C;  1S32 C;  1P3G C;  1R4V A;  1KX5 A;  3AZF C;  4WU9 C;  5GT3 D;  1P3I D;  1P3K D;  5BNX B;  5JA4 B;  4KGC C;  5AV6 B;  5B33 D;  3KXB A;  3LJA D;  2CV5 C;  5GXQ A;  4DRA A;  3X1S D;  1AOI C;  4H9R A;  4YM6 B;  3WA9 C;  3LEL D;  3KSY A;  3X1T B;  4WU8 D;  1P3O D;  3AYW D;  1H3O B;  5DNM C;  3REI D;  5B1L C;  5AV8 C;  3AFA C;  3X1U D;  4LD9 D;  4H9S C;  5B0Z B;  3AZI C;  3MGP D;  4WV4 B;  5BNX A;  3TU4 D;  4HGA C;  5JA4 A;  3AZH C;  5GT0 D;  4ZUX B;  5AV6 A;  5CPJ B;  5B2I C;  3MGQ B;  3AZK D;  3UTB C;  5B31 D;  2ARO C;  4H9Q B;  3R45 B;  4YM6 A;  2NZD D;  4H9N B;  1Q9C A;  3X1T A;  1H3O A;  1P3M D;  1KX4 A;  1WWI A;  4NE3 A;  3LZ1 D;  1P34 B;  1P3L D;  3AZN D;  5B0Z A;  3WTP C;  1ID3 D;  5JRG C;  5F99 D;  3C1C D;  4J8U C;  5GT3 B;  5CPJ A;  1P3I B;  1P3K B;  3MGQ A;  2PYO D;  3AN2 D;  4H9Q A;  4WNN B;  1TZY C;  2FJ7 C;  3R45 A;  4G92 B;  3LJA B;  3W97 D;  1M1A D;  4H9N A;  3X1V D;  3AZM D;  1KX5 D;  3LEL B;  2HUE B;  3MVD C;  1P3O B;  1EQZ D;  4J8V D;  3AYW B;  5FUG B;  3REI B;  1P34 A;  1P3B C;  4QLC C;  3WKJ B;  2YFV B;  3AZJ C;  2L5A A;  5BNV B;  3KXB D;  3X1U B;  4KUD A;  5GT3 A;  5B24 C;  1P3A C;  1P3K A;  3MGP B;  3TU4 B;  4WNN A;  3REL C;  3LJA A;  5AVC B;  3AZK B;  5BT1 C;  4Z2M H;  3AZG D;  5CPK D;  2NZD B;  3B0B A;  3UT9 D;  1P3O A;  4ZBJ B;  3AYW A;  5FUG A;  3REI A;  1P3F C;  3WKJ A;  2YFV A;  5AV6 D;  5B2J D;  1S32 D;  5BNV A;  1P3L B;  5AV5 C;  1P3G D;  3AZF D;  4XUJ C;  3AZN B;  4Z66 A;  4CAY B;  5E5A B;  3MGP A;  3AZE C;  1ID3 B;  5F99 B;  2RVQ C;  4G91 C;  1KU5 A;  3KWQ C;  3X1T D;  3W96 B;  5AVC A;  3AZK A;  3AN2 B;  1F66 B;  2CV5 D;  1KX4 D;  4XZQ C;  3MGS C;  5AY8 B;  4J8X A;  3W97 B;  1M1A B;  2NZD A;  3WA9 D;  3LZ0 C;  3X1V B;  3AZM B;  5G49 B;  4UUZ B;  5B1L D;  1EQZ B;  4J8V B;  3MGQ D;  1P3L A;  3REK C;  3W99 C;  5DNN C;  3AFA D;  3AZN A;  3UTA C;  4CAY A;  5E5A A;  1M18 C;  3KXB B;  1ID3 A;  5B40 B;  5F99 A;  3AZH D;  2IO5 B;  3W96 A;  3AN2 A;  1F66 A;  3UTB D;  2ARO D;  3W97 A;  5AY8 A;  5CP6 B;  3AV1 B;  1M1A A;  3X1V A;  3AZM A;  5G49 A;  3AZG B;  5CPK B;  4KUD D;  4UUZ A;  2HIO C;  3UT9 B;  1EQZ A;  4J8V A;  1P3P C;  5B2J B;  3A6N A;  4AWL C;  4EO5 B;  1S32 B;  5B40 A;  1P3G B;  3AZF B;  4J8U D;  5B32 G;  3AZL C;  4KGC B;  1KX3 C;  5CP6 A;  3AV1 A;  4H9O B;  2CV5 B;  3WKJ D;  1KX4 B;  5B32 C;  3AZG A;  5CPK A;  1AOI B;  3WA9 B;  3MVD D;  4Z66 D;  3UT9 A;  4Z5T C;  5DNM B;  3O62 C;  5B1L B;  4Z2M G;  5B2J A;  4YS3 C;  3B6F C;  3AZJ D;  1S32 A;  2F8N G;  4M6B A;  5AV8 B;  5AVC D;  1P3G A;  3AFA B;  3AZF A;  3REJ C;  4WU9 A;  4X23 C;  5B24 D;  3MNN C;  3AZI B;  1P3A D;  3AV2 C;  4J8X D;  3AZH B;  4HGA B;  4KGC A;  4CSR B;  4E44 A;  1BH8 B;  5B2I B;  4ZUX C;  4H9O A;  3UTB B;  2CV5 A;  2ARO B;  1B6W A;  5BT1 D;  3MGR C;  1AOI A;  3WA9 A;  3B0C T;  5E5A D;  4KUD B;  5DNM A;  1P3F D;  5B1L A;  3B0D C; 
#chains in the Genus database with same CATH topology
 2Y2L A;  5BS7 C;  3W96 D;  5AV8 A;  5CPI C;  3AFA A;  5B0Y C;  4H9S A;  5AV5 D;  1F66 D;  3AZI A;  3WTP B;  5AY8 D;  3AZE D;  3AZH A;  5JRG B;  1F1E A;  2RVQ D;  4J8U B;  2JSS A;  4CSR A;  3KWQ D;  1BH8 A;  5B2I A;  3REH C;  3EPK A;  3UTB A;  2ARO A;  1P3I C;  4E45 A;  1TZY B;  2FJ7 B;  5B33 C;  5AVB C;  2F8N K;  3LZ0 D;  3A6N D;  5C3I C;  5B40 D;  3X1S C;  2NQB C;  3KUY C;  3MVD B;  4Z66 B;  3LEL C;  1P3B B;  3REK D;  4QLC B;  2Y2K A;  4WU8 C;  3UTA D;  3AZJ B;  3WAA C;  3WTP A;  1M18 D;  3B6G C;  5CP6 D;  3AV1 D;  1HQ3 C;  5JRG A;  1ZLA C;  5B1M C;  4J8U A;  5B24 B;  1P3A B;  3X1U C;  4J8X B;  4LD9 C;  2F8N H;  3C1B C;  1TZY A;  3TU4 C;  3REL B;  2FJ7 A;  5GT0 C;  1U35 C;  5AV9 C;  1N1J A;  2Y2I A;  3VH6 T;  2XD1 A;  3H0R C;  5B31 C;  1M19 C;  3VH5 T;  3MVD A;  4WU9 D;  1P3B A;  1P3F B;  1BFM A;  4QLC A;  4KGC D;  5GSU C;  3AZJ A;  1P3P D;  3B0C W;  1P3M C;  4JJN C;  5AV5 B;  3LZ1 C;  4J8W C;  5B24 A;  1P3A A;  1AOI D;  3AZE B;  3AZL D;  4G91 B;  3KWQ B;  3REL A;  3C1C C;  5DNM D;  3W98 C;  2PYO C;  3A1K A;  4XZQ B;  5B32 D;  5AV8 D;  3MGS B;  4R8P C;  2ZY2 A;  3LZ0 B;  3A6N B;  3AZI D;  1P3F A;  4YS3 D;  1KX5 C;  3B6F D;  5B2I D;  1T3U A;  3REK B;  5AV5 A;  3W99 B;  4XUJ A;  3UTA B;  4X23 D;  1M18 B;  3AZE A;  3AV2 D;  2YFW B;  3KXB C;  3KWQ A;  2F8N D;  3VH6 A;  5GXQ C;  3VH5 A;  4XZQ A;  3MGR D;  3MGS A;  2F2A C;  3LZ0 A;  3WTP D;  1HTA A;  5JRG D;  4WU9 B;  2HIO B;  3VH6 W;  2BYK B;  5KDM B;  5BO0 A;  3REK A;  5DNN A;  5CPI D;  3W99 A;  3VH5 W;  3UTA A;  1TZY D;  1P3P B;  4AWL B;  1M18 A;  2FJ7 D;  3IP4 C;  5AV6 C;  4EO5 C;  2YFW A;  3AZL B;  3REH D;  4YM6 C;  1KX3 B;  1WWS A;  1P3B D;  4QLC D;  5AVB D;  3X1T C;  5B32 B;  2Y2H A;  1KX4 C;  2HIO A;  3KUY D;  2NQB D;  2BYK A;  5KDM A;  4Z5T B;  3O62 B;  5B0Z C;  1P3P A;  4YS3 B;  3B6F B;  3REL D;  1BH9 B;  3WAA D;  5CPJ C;  3B6G D;  1ZLA D;  1HQ3 D;  5B1M D;  3REJ B;  3MGQ C;  4X23 B;  3MNN B;  3AV2 B;  3AZL A;  3C1B D;  4KHA B;  1KX3 A;  2F8N B;  2ZY3 A;  1U35 D;  5AV9 D;  3WTP E;  4NE6 A;  5B32 A;  3MGR B;  1M19 D;  1ULY A;  4XUJ D;  1P34 C;  4Z5T A;  2BG1 A;  4NE5 A;  2Y2Q A;  3O62 A;  4WZS B;  3B0D B;  5GSU D;  3EPJ A;  4YS3 A;  3B6F A;  1BH9 A;  4KUD C;  4JJN D;  5GT3 C;  4H9P B;  5CPI B;  5B0Y B;  1P3K C;  3REJ A;  4J8W D;  4X23 A;  4XZQ D;  3MNN A;  3P5J B;  3AL0 C;  3MGS D;  1N1J B;  3AV2 A;  4G92 C;  3LJA C;  4KHA A;  1B67 A;  2F8N A;  5CHL B;  4ZUX A;  3REH B;  3W98 D;  3EG5 B;  4DRB A;  3MGR A;  2HUE C;  5B33 B;  3W99 D;  5DNN D;  5AVB B;  4R8P D;  1P3O C;  3AYW C;  3REI C;  3WKJ C;  5C3I B;  2LY8 A;  3X1S B;  2NQB B;  3KUY B;  1JFI B;  5BS7 A;  5B31 G;  5CPI A;  4H9P A;  3V9R B;  5B0Y A;  4Z66 C;  3MGP C;  3NQU B;  2DQN C;  4WU8 B;  3WAA B;  2Y2J A;  1Z2C B;  3B6G B;  1ZLA B;  1HQ3 B;  5B1M B;  3F6T A;  5AVC C;  3AZK C;  4LD9 B;  5GXQ D;  3REH A;  1P3I A;  3C1B B;  2HIO D;  4J8X C;  2NZD C;  5GT0 B;  1U35 B;  5AV9 B;  5B33 A;  5AVB A;  2Y2P A;  4ZBJ C;  5B31 B;  1M19 B;  3X1S A;  4XUJ B;  3KUY A;  2NQB A;  1JFI A;  1P3L C;  1A7W A;  3LEL A;  3AZN C;  3V9R A;  1TAF B;  5E5A C;  3KFU G;  3NQU A;  5GSU B;  4WU8 A;  1ID3 C;  1KX3 D;  1W2E A;  5F99 C;  1P3M B;  3WAA A;  4JJN B;  3B6G A;  1ZLA A;  1HQ3 A;  5B1M A;  3W96 C;  3LZ1 B;  4J8W B;  3AN2 C;  3X1U A;  4LD9 A;  1F66 C;  1PZR A;  3C1B A;  3W97 C;  5AY8 C;  3TU4 A;  4YM6 D;  1M1A C;  4Z5T D;  5GT0 A;  1U35 A;  5AV9 A;  3C1C B;  3X1V C;  3O62 D;  3AZM C;  3W98 B;  3NQJ B;  2PYO B;  5BO0 B;  5B31 A;  1M19 A;  5DNN B;  4R8P B;  2Y2O A;  1EQZ C;  4J8V C;  3REJ D;  2BYM B;  3MNN D;  1TAF A;  5B0Z D;  3A6N C;  5GSU A;  5B40 C;  1P3M A;  1KX5 B;  4JJN A;  4ZUX D;  5CPJ D;  2DF4 C;  2IO5 C;  3LZ1 A;  4J8W A;  4NFT A;  5CP6 C;  3AV1 C;  5GXQ B;  3C1C A;  4DQY B;  2W8S A;  3AZG C;  5CPK C;  3W98 A;  4H9R B;  3NQJ A;  2PYO A;  2CWE A;  3UT9 C;  4R8P A;  5B0Y D;  2BYM A;  1P34 D;  5B2J C;  1S32 C;  1P3G C;  1R4V A;  1KX5 A;  3AZF C;  4WU9 C;  2JCH A;  5GT3 D;  1P3I D;  1P3K D;  5BNX B;  5JA4 B;  4KGC C;  5AV6 B;  5B33 D;  2RIQ A;  3KXB A;  3LJA D;  2CV5 C;  5GXQ A;  4DRA A;  3X1S D;  1AOI C;  4H9R A;  4YM6 B;  3WA9 C;  3LEL D;  3KSY A;  3X1T B;  2G5H C;  4WU8 D;  1P3O D;  3AYW D;  1H3O B;  5DNM C;  3REI D;  5B1L C;  2ZY4 A;  5AV8 C;  3AFA C;  3X1U D;  4LD9 D;  4H9S C;  5B0Z B;  3AZI C;  3MGP D;  4WV4 B;  5BNX A;  3TU4 D;  4HGA C;  5JA4 A;  3AZH C;  5GT0 D;  4ZUX B;  5AV6 A;  5CPJ B;  5B2I C;  3MGQ B;  3AZK D;  3UTB C;  5B31 D;  2ARO C;  4H9Q B;  3R45 B;  4YM6 A;  2NZD D;  4H9N B;  1Q9C A;  3X1T A;  1H3O A;  1P3M D;  1KX4 A;  1WWI A;  4NE3 A;  3LZ1 D;  1P34 B;  1P3L D;  2ZM5 A;  3EPL A;  3AZN D;  5B0Z A;  3WTP C;  1ID3 D;  5JRG C;  5F99 D;  3C1C D;  4J8U C;  5GT3 B;  5CPJ A;  1P3I B;  1P3K B;  3MGQ A;  2PYO D;  3AN2 D;  4H9Q A;  4WNN B;  1TZY C;  2FJ7 C;  3R45 A;  4G92 B;  3LJA B;  3W97 D;  1M1A D;  4H9N A;  3X1V D;  3AZM D;  1KX5 D;  3LEL B;  2JE5 A;  2HUE B;  3MVD C;  1P3O B;  1EQZ D;  4J8V D;  3AYW B;  5FUG B;  3REI B;  1P34 A;  1P3B C;  4QLC C;  3EPH A;  3WKJ B;  2YFV B;  2Y2M A;  3AZJ C;  2L5A A;  5BNV B;  3KXB D;  3X1U B;  4KUD A;  5GT3 A;  5B24 C;  1P3A C;  1P3K A;  3MGP B;  3TU4 B;  4WNN A;  3REL C;  3LJA A;  5AVC B;  3AZK B;  2G5I C;  5BT1 C;  4Z2M H;  3AZG D;  5CPK D;  2NZD B;  3B0B A;  3UT9 D;  1P3O A;  4ZBJ B;  3AYW A;  5FUG A;  3REI A;  1P3F C;  3WKJ A;  2YFV A;  5AV6 D;  5B2J D;  1S32 D;  5BNV A;  1P3L B;  5AV5 C;  1P3G D;  3AZF D;  4XUJ C;  3AZN B;  4Z66 A;  4CAY B;  5E5A B;  3MGP A;  3AZE C;  1ID3 B;  5F99 B;  2RVQ C;  4G91 C;  1KU5 A;  3KWQ C;  3X1T D;  3W96 B;  5AVC A;  3AZK A;  3AN2 B;  1F66 B;  2CV5 D;  1KX4 D;  4XZQ C;  3MGS C;  5AY8 B;  4J8X A;  3W97 B;  2XD5 A;  1M1A B;  2NZD A;  3WA9 D;  3LZ0 C;  3X1V B;  3AZM B;  5G49 B;  4UUZ B;  5B1L D;  1EQZ B;  4J8V B;  3MGQ D;  1P3L A;  3REK C;  3W99 C;  5DNN C;  3AFA D;  3AZN A;  3UTA C;  4CAY A;  5E5A A;  1M18 C;  3KXB B;  1ID3 A;  5B40 B;  5F99 A;  3AZH D;  2IO5 B;  3W96 A;  3AN2 A;  1F66 A;  3UTB D;  2ARO D;  3FDD A;  3W97 A;  5AY8 A;  5CP6 B;  3AV1 B;  1M1A A;  3X1V A;  3AZM A;  5G49 A;  3AZG B;  5CPK B;  4KUD D;  4UUZ A;  2HIO C;  3UT9 B;  2Y2N A;  4J8V A;  1EQZ A;  1P3P C;  5B2J B;  2VQR A;  3H0L C;  3A6N A;  4EO5 B;  4AWL C;  1S32 B;  5B40 A;  1P3G B;  3AZF B;  2UWX A;  4J8U D;  5B32 G;  3AZL C;  4KGC B;  3A1I A;  2ZY5 A;  1KX3 C;  5CP6 A;  3AV1 A;  4H9O B;  2CV5 B;  3WKJ D;  1KX4 B;  5B32 C;  3AZG A;  5CPK A;  1AOI B;  3H0M C;  3WA9 B;  3MVD D;  4Z66 D;  3UT9 A;  4Z5T C;  5DNM B;  3O62 C;  5B1L B;  4Z2M G;  4WJ3 C;  5B2J A;  4YS3 C;  3B6F C;  3AZJ D;  1S32 A;  2F8N G;  4M6B A;  5AV8 B;  5AVC D;  1P3G A;  3AFA B;  3AZF A;  4UPK A;  3REJ C;  4WU9 A;  4X23 C;  5B24 D;  3MNN C;  3AZI B;  1P3A D;  3AV2 C;  4J8X D;  3AZH B;  4HGA B;  2Y2G A;  4KGC A;  4CSR B;  4E44 A;  1BH8 B;  5B2I B;  4ZUX C;  4H9O A;  3UTB B;  2CV5 A;  2ARO B;  2J8P A;  1B6W A;  5BT1 D;  3MGR C;  1AOI A;  3WA9 A;  3B0C T;  5E5A D;  2FFF B;  4KUD B;  5DNM A;  1P3F D;  5B1L A;  3B0D C; 
#chains in the Genus database with same CATH homology
 2Y2L A;  5BS7 C;  3W96 D;  5AV8 A;  5CPI C;  3AFA A;  5B0Y C;  4H9S A;  5AV5 D;  1F66 D;  3AZI A;  3WTP B;  5AY8 D;  3AZE D;  3AZH A;  5JRG B;  1F1E A;  2RVQ D;  4J8U B;  2JSS A;  4CSR A;  3KWQ D;  1BH8 A;  5B2I A;  3REH C;  3EPK A;  3UTB A;  2ARO A;  1P3I C;  4E45 A;  1TZY B;  2FJ7 B;  5B33 C;  5AVB C;  2F8N K;  3LZ0 D;  3A6N D;  5C3I C;  5B40 D;  3X1S C;  2NQB C;  3KUY C;  3MVD B;  4Z66 B;  3LEL C;  1P3B B;  3REK D;  4QLC B;  2Y2K A;  4WU8 C;  3UTA D;  3AZJ B;  3WAA C;  3WTP A;  1M18 D;  3B6G C;  5CP6 D;  3AV1 D;  1HQ3 C;  5JRG A;  1ZLA C;  5B1M C;  4J8U A;  5B24 B;  1P3A B;  3X1U C;  4J8X B;  4LD9 C;  2F8N H;  3C1B C;  1TZY A;  3TU4 C;  3REL B;  2FJ7 A;  5GT0 C;  1U35 C;  5AV9 C;  1N1J A;  2Y2I A;  3VH6 T;  2XD1 A;  3H0R C;  5B31 C;  1M19 C;  3VH5 T;  3MVD A;  4WU9 D;  1P3B A;  1P3F B;  1BFM A;  4QLC A;  4KGC D;  5GSU C;  3AZJ A;  1P3P D;  3B0C W;  1P3M C;  4JJN C;  5AV5 B;  3LZ1 C;  4J8W C;  5B24 A;  1P3A A;  1AOI D;  3AZE B;  3AZL D;  4G91 B;  3KWQ B;  3REL A;  3C1C C;  5DNM D;  3W98 C;  2PYO C;  3A1K A;  4XZQ B;  5B32 D;  5AV8 D;  3MGS B;  4R8P C;  2ZY2 A;  3LZ0 B;  3A6N B;  3AZI D;  1P3F A;  4YS3 D;  1KX5 C;  3B6F D;  5B2I D;  1T3U A;  3REK B;  5AV5 A;  3W99 B;  4XUJ A;  3UTA B;  4X23 D;  1M18 B;  3AZE A;  3AV2 D;  2YFW B;  3KXB C;  3KWQ A;  2F8N D;  3VH6 A;  5GXQ C;  3VH5 A;  4XZQ A;  3MGR D;  3MGS A;  2F2A C;  3LZ0 A;  3WTP D;  1HTA A;  5JRG D;  4WU9 B;  2HIO B;  3VH6 W;  2BYK B;  5KDM B;  5BO0 A;  3REK A;  5DNN A;  5CPI D;  3W99 A;  3VH5 W;  3UTA A;  1TZY D;  1P3P B;  4AWL B;  1M18 A;  2FJ7 D;  3IP4 C;  5AV6 C;  4EO5 C;  2YFW A;  3AZL B;  3REH D;  4YM6 C;  1KX3 B;  1WWS A;  1P3B D;  4QLC D;  5AVB D;  3X1T C;  5B32 B;  2Y2H A;  1KX4 C;  2HIO A;  3KUY D;  2NQB D;  2BYK A;  5KDM A;  4Z5T B;  3O62 B;  5B0Z C;  1P3P A;  4YS3 B;  3B6F B;  3REL D;  1BH9 B;  3WAA D;  5CPJ C;  3B6G D;  1ZLA D;  1HQ3 D;  5B1M D;  3REJ B;  3MGQ C;  4X23 B;  3MNN B;  3AV2 B;  3AZL A;  3C1B D;  4KHA B;  1KX3 A;  2F8N B;  2ZY3 A;  1U35 D;  5AV9 D;  3WTP E;  4NE6 A;  5B32 A;  3MGR B;  1M19 D;  1ULY A;  4XUJ D;  1P34 C;  4Z5T A;  2BG1 A;  4NE5 A;  2Y2Q A;  3O62 A;  4WZS B;  3B0D B;  5GSU D;  3EPJ A;  4YS3 A;  3B6F A;  1BH9 A;  4KUD C;  4JJN D;  5GT3 C;  4H9P B;  5CPI B;  5B0Y B;  1P3K C;  3REJ A;  4J8W D;  4X23 A;  4XZQ D;  3MNN A;  3P5J B;  3AL0 C;  3MGS D;  1N1J B;  3AV2 A;  4G92 C;  3LJA C;  4KHA A;  1B67 A;  2F8N A;  5CHL B;  4ZUX A;  3REH B;  3W98 D;  3EG5 B;  4DRB A;  3MGR A;  2HUE C;  5B33 B;  3W99 D;  5DNN D;  5AVB B;  4R8P D;  1P3O C;  3AYW C;  3REI C;  3WKJ C;  5C3I B;  2LY8 A;  3X1S B;  2NQB B;  3KUY B;  1JFI B;  5BS7 A;  5B31 G;  5CPI A;  4H9P A;  3V9R B;  5B0Y A;  4Z66 C;  3MGP C;  3NQU B;  2DQN C;  4WU8 B;  3WAA B;  2Y2J A;  1Z2C B;  3B6G B;  1ZLA B;  1HQ3 B;  5B1M B;  3F6T A;  5AVC C;  3AZK C;  4LD9 B;  5GXQ D;  3REH A;  1P3I A;  3C1B B;  2HIO D;  4J8X C;  2NZD C;  5GT0 B;  1U35 B;  5AV9 B;  5B33 A;  5AVB A;  2Y2P A;  4ZBJ C;  5B31 B;  1M19 B;  3X1S A;  4XUJ B;  3KUY A;  2NQB A;  1JFI A;  1P3L C;  1A7W A;  3LEL A;  3AZN C;  3V9R A;  1TAF B;  5E5A C;  3KFU G;  3NQU A;  5GSU B;  4WU8 A;  1ID3 C;  1KX3 D;  1W2E A;  5F99 C;  1P3M B;  3WAA A;  4JJN B;  3B6G A;  1ZLA A;  1HQ3 A;  5B1M A;  3W96 C;  3LZ1 B;  4J8W B;  3AN2 C;  3X1U A;  4LD9 A;  1F66 C;  1PZR A;  3C1B A;  3W97 C;  5AY8 C;  3TU4 A;  4YM6 D;  1M1A C;  4Z5T D;  5GT0 A;  1U35 A;  5AV9 A;  3C1C B;  3X1V C;  3O62 D;  3AZM C;  3W98 B;  3NQJ B;  2PYO B;  5BO0 B;  5B31 A;  1M19 A;  5DNN B;  4R8P B;  2Y2O A;  1EQZ C;  4J8V C;  3REJ D;  2BYM B;  3MNN D;  1TAF A;  5B0Z D;  3A6N C;  5GSU A;  5B40 C;  1P3M A;  1KX5 B;  4JJN A;  4ZUX D;  5CPJ D;  2DF4 C;  2IO5 C;  3LZ1 A;  4J8W A;  4NFT A;  5CP6 C;  3AV1 C;  5GXQ B;  3C1C A;  4DQY B;  2W8S A;  3AZG C;  5CPK C;  3W98 A;  4H9R B;  3NQJ A;  2PYO A;  2CWE A;  3UT9 C;  4R8P A;  5B0Y D;  2BYM A;  1P34 D;  5B2J C;  1S32 C;  1P3G C;  1R4V A;  1KX5 A;  3AZF C;  4WU9 C;  2JCH A;  5GT3 D;  1P3I D;  1P3K D;  5BNX B;  5JA4 B;  4KGC C;  5AV6 B;  5B33 D;  2RIQ A;  3KXB A;  3LJA D;  2CV5 C;  5GXQ A;  4DRA A;  3X1S D;  1AOI C;  4H9R A;  4YM6 B;  3WA9 C;  3LEL D;  3KSY A;  3X1T B;  2G5H C;  4WU8 D;  1P3O D;  3AYW D;  1H3O B;  5DNM C;  3REI D;  5B1L C;  2ZY4 A;  5AV8 C;  3AFA C;  3X1U D;  4LD9 D;  4H9S C;  5B0Z B;  3AZI C;  3MGP D;  4WV4 B;  5BNX A;  3TU4 D;  4HGA C;  5JA4 A;  3AZH C;  5GT0 D;  4ZUX B;  5AV6 A;  5CPJ B;  5B2I C;  3MGQ B;  3AZK D;  3UTB C;  5B31 D;  2ARO C;  4H9Q B;  3R45 B;  4YM6 A;  2NZD D;  4H9N B;  1Q9C A;  3X1T A;  1H3O A;  1P3M D;  1KX4 A;  1WWI A;  4NE3 A;  3LZ1 D;  1P34 B;  1P3L D;  2ZM5 A;  3EPL A;  3AZN D;  5B0Z A;  3WTP C;  1ID3 D;  5JRG C;  5F99 D;  3C1C D;  4J8U C;  5GT3 B;  5CPJ A;  1P3I B;  1P3K B;  3MGQ A;  2PYO D;  3AN2 D;  4H9Q A;  4WNN B;  1TZY C;  2FJ7 C;  3R45 A;  4G92 B;  3LJA B;  3W97 D;  1M1A D;  4H9N A;  3X1V D;  3AZM D;  1KX5 D;  3LEL B;  2JE5 A;  2HUE B;  3MVD C;  1P3O B;  1EQZ D;  4J8V D;  3AYW B;  5FUG B;  3REI B;  1P34 A;  1P3B C;  4QLC C;  3EPH A;  3WKJ B;  2YFV B;  2Y2M A;  3AZJ C;  2L5A A;  5BNV B;  3KXB D;  3X1U B;  4KUD A;  5GT3 A;  5B24 C;  1P3A C;  1P3K A;  3MGP B;  3TU4 B;  4WNN A;  3REL C;  3LJA A;  5AVC B;  3AZK B;  2G5I C;  5BT1 C;  4Z2M H;  3AZG D;  5CPK D;  2NZD B;  3B0B A;  3UT9 D;  1P3O A;  4ZBJ B;  3AYW A;  5FUG A;  3REI A;  1P3F C;  3WKJ A;  2YFV A;  5AV6 D;  5B2J D;  1S32 D;  5BNV A;  1P3L B;  5AV5 C;  1P3G D;  3AZF D;  4XUJ C;  3AZN B;  4Z66 A;  4CAY B;  5E5A B;  3MGP A;  3AZE C;  1ID3 B;  5F99 B;  2RVQ C;  4G91 C;  1KU5 A;  3KWQ C;  3X1T D;  3W96 B;  5AVC A;  3AZK A;  3AN2 B;  1F66 B;  2CV5 D;  1KX4 D;  4XZQ C;  3MGS C;  5AY8 B;  4J8X A;  3W97 B;  2XD5 A;  1M1A B;  2NZD A;  3WA9 D;  3LZ0 C;  3X1V B;  3AZM B;  5G49 B;  4UUZ B;  5B1L D;  1EQZ B;  4J8V B;  3MGQ D;  1P3L A;  3REK C;  3W99 C;  5DNN C;  3AFA D;  3AZN A;  3UTA C;  4CAY A;  5E5A A;  1M18 C;  3KXB B;  1ID3 A;  5B40 B;  5F99 A;  3AZH D;  2IO5 B;  3W96 A;  3AN2 A;  1F66 A;  3UTB D;  2ARO D;  3FDD A;  3W97 A;  5AY8 A;  5CP6 B;  3AV1 B;  1M1A A;  3X1V A;  3AZM A;  5G49 A;  3AZG B;  5CPK B;  4KUD D;  4UUZ A;  2HIO C;  3UT9 B;  2Y2N A;  4J8V A;  1EQZ A;  1P3P C;  5B2J B;  2VQR A;  3H0L C;  3A6N A;  4EO5 B;  4AWL C;  1S32 B;  5B40 A;  1P3G B;  3AZF B;  2UWX A;  4J8U D;  5B32 G;  3AZL C;  4KGC B;  3A1I A;  2ZY5 A;  1KX3 C;  5CP6 A;  3AV1 A;  4H9O B;  2CV5 B;  3WKJ D;  1KX4 B;  5B32 C;  3AZG A;  5CPK A;  1AOI B;  3H0M C;  3WA9 B;  3MVD D;  4Z66 D;  3UT9 A;  4Z5T C;  5DNM B;  3O62 C;  5B1L B;  4Z2M G;  4WJ3 C;  5B2J A;  4YS3 C;  3B6F C;  3AZJ D;  1S32 A;  2F8N G;  4M6B A;  5AV8 B;  5AVC D;  1P3G A;  3AFA B;  3AZF A;  4UPK A;  3REJ C;  4WU9 A;  4X23 C;  5B24 D;  3MNN C;  3AZI B;  1P3A D;  3AV2 C;  4J8X D;  3AZH B;  4HGA B;  2Y2G A;  4KGC A;  4CSR B;  4E44 A;  1BH8 B;  5B2I B;  4ZUX C;  4H9O A;  3UTB B;  2CV5 A;  2ARO B;  2J8P A;  1B6W A;  5BT1 D;  3MGR C;  1AOI A;  3WA9 A;  3B0C T;  5E5A D;  2FFF B;  4KUD B;  5DNM A;  1P3F D;  5B1L A;  3B0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...