2F8ND

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nD00
3X1SB 4G92C 1ZLAD 3WKJB 1P3OD 3REHA 3AZHD 1F66C 3W98A 3AV1B 3MGPD 3B0DC 5CPKD 5B2JC 3V9RB 4X23A 3LELA 3AZIC 2PYOC 4XUJB 4R8PC 1P3LC 4H9SC 5GSUC 5B0ZA 1KX3C 5B1MA 5AV8D 1P3KC 5B1LA 4YM6A 3W96C 3NQJA 5GXQD 3MGRA 5B0YC 4KHAB 5AVCC 5JRGB 5B31C 1N1JA 3X1VC 4EO5C 1HTAA 3AYWD 3B6GB 4H9OB 3W97B 5JA4B 4Z2MG 3UTAB 4KGCD 1ZLAA 1KX4A 1Q9CA 3AZMC 5AV9B 5KDMA 3UT9C 1P3GB 3W99B 3B6FA 5AV6D 3MGPA 3UTBB 5B1MC 4AWLB 4J8XA 3AZKC 3AZLC 3MGRC 4G91C 5DNND 3AFAC 5CP6D 3WAAB 4WU8B 5B32G 3MNND 4NE6A 2NQBB 1BFMA 1P3MC 1TAFA 5CHLB 2YFVB 1ZLAC 5DNMD 1P3OC 3AZHC 1TZYD 4WNNA 1EQZA 4WV4B 5GT3A 3MGPC 4KGCA 4KUDD 5BT1D 5CPKC 3RELA 4G92B 5BS7A 5AV8C 5B40D 4NE5A 5GXQC 3LZ0A 3MGSD 4QLCD 5DNNA 5F99D 2PYOB 3AYWC 3C1BB 3MNNA 1P3LB 5GSUB 1P3KB 4NE3A 4Z66D 3X1TA 4KGCC 5AVCB 5B31B 1TZYA 4EO5B 3AZGB 5AV6C 5BS7C 3O62B 1P3BA 4KUDA 2NZDB 1U35D 1S32D 1P3PD 1ID3A 3X1SA 3LJAD 3AZMB 5DNNC 5CP6C 3REJD 3MNNC 3WTPB 4XUJA 3MGSA 1P3IA 1P3FA 4J8WD 1M19D 5DNMC 3AZKB 3AZLB 1ULYA 3WA9D 4DRBA 1TZYC 3AFAB 3AZEB 4LD9D 4KUDC 3AN2D 1HQ3B 5BT1C 2YFWA 1P3MB 3MVDB 4J8VB 2F8NK 2HIOB 3KWQA 5CPIA 1P3OB 5JA4A 5B40C 5B24A 3AV2D 3AZHB 4J8UD 1WWIA 5B33B 3MGSC 3MGQA 5CPKB 4QLCC 5F99C 1KX5B 5AV5C 4H9RB 3REHD 3W98D 2AROA 3AZJB 5AV8B 4Z66C 4X23D 3LELD 5GXQB 1F1EA 1B67A 5CPJA 2IO5C 5B0ZD 3AZNA 3AYWB 5B1LD 4YM6D 1U35C 1S32C 2YFVA 1P3PC 3KXBB 3VH5W 3KUYD 3VH6T 3LJAC 4ZUXA 3REJC 3AV2A 1BH9A 5B2IB 4E45A 1M1AB 5B32D 1KX4D 3TU4B 2FJ7D 4J8WC 1M19C 2CV5D 3B6FD 3WA9C 5C3IB 5BNVA 4LD9C 5CP6B 4JJND 3AN2C 4J8XD 1M18B 3C1BA 5E5AB 1JFIB 4H9PB 5DNMB 3AV2C 3KUYA 1P34B 4J8UC 2BYKA 1WWSA 3REIB 5AY8B 3O62A 3AZFD 3REHC 4YS3D 1EQZD 3W98C 5B32A 5GT3D 1AOIB 5B40B 3A6NA 2FJ7A 4X23C 4ZBJB 3LELC 2F8NG 2CV5A 3RELD 4Z5TB 1B6WA 5B0ZC 4QLCB 1H3OB 1P3AB 5F99B 4JJNA 5B1LC 5AV5B 3WTPE 4YM6C 5G49B 1BH8A 5B31G 3LZ0D 3KUYC 3X1UD 4Z66B 4CAYB 4CSRB 3REKD 3AZEA 5FUGB 5BO0B 5B32C 3X1TD 1U35B 1KX4C 4J8VA 1S32B 1P3PB 2FJ7C 3AZFA 4WU9B 5GT0B 2CV5C 4YS3A 3LJAB 3B6FC 3LZ1D 5BNXB 4XZQA 1P3BD 3NQUB 3C1CA 4JJNC 3REJB 1ID3D 3X1SD 5AVBB 4J8XC 3VH6A 4H9RA 4UUZA 1M19B 3AZJA 1F66B 3WA9B 3B0DB 3X1UA 4XUJD 1P3ID 4LD9B 5B2JB 3AZIB 1P3FD 3R45B 3AN2B 4R8PB 3REKA 2F8NB 1KX3B 3AZFC 4H9NA 4YS3C 1EQZC 4H9QA 5GT3C 3W96B 5JRGD 5B0YB 2F8NH 4J8UB 3X1VB 3RELC 3LZ1A 3KWQD 5CPID 4M6BA 2BYMA 5B24D 3REHB 3UTAD 3WKJA 3W98B 3LZ0C 3X1UC 3MGQD 3UT9B 4X23B 3LELB 3AV1A 3REKC 2AROD 3V9RA 5B1MB 4YM6B 3X1TC 3NQJB 5E5AA 3MGRB 5CPJD 3WAAD 4WU8D 4G91B 3AZND 2L5AA 4KHAA 3LZ1C 5JRGA 1P34A 1P3BC 1ID3C 3B6GA 3X1SC 4H9OA 3W97A 5AY8A 1ZLAB 2CWEA 4ZUXD 5KDMB 3UTAA 3B6FB 3MGPB 5AV9A 4XUJC 1P3IC 1P3GA 1P3FC 3W99A 3UTBA 4J8XB 1KU5A 5JRGC 1R4VA 3C1BD 3WAAA 1TAFB 4WU8A 2NQBA 5FUGA 3KWQC 5CPIC 5B24C 3UTAC 3VH5T 4WNNB 1EQZB 4KGCB 4WU9A 3MGQC 3AZGD 3O62D 2NZDD 3RELB 5AV6B 4AWLC 2AROC 3A6ND 5CPJC 3WAAC 4WU8C 1F66A 5DNNB 3AZNC 3KSYA 3WTPD 3MNNB 3AZIA 2PYOA 3R45A 4R8PA 4HGAC 2F8NA 3B0CW 1P3LA 4H9SA 5GSUA 3X1TB 2LY8A 1P3KA 4ZUXC 3AZED 1TZYB 1HQ3D 5AVCA 4KUDB 5B31A 3MVDD 3X1VA 4J8VD 1ID3B 3AZGA 2NZDA 2HIOD 4E44A 4XZQD 3C1CD 5B33D 2RVQD 3AZMA 3UT9A 1KX5D 3MGSB 3C1BC 1P3IB 1P3FB 2HUEC 3WTPA 3AZJD 3AZKA 3AZLA 3AFAA 2IO5B 2YFWB 3AZGC 3O62C 2NZDC 1HQ3A 3KWQB 5CPIB 3KXBD 1P3MA 3MVDA 3A6NC 5B24B 2HIOA 1P3OA 3MGQB 5B2ID 3AZHA 5B33A 1M1AD 3WTPC 3WKJD 4WZSB 5CPKA 2AROB 3TU4D 1KX5A 3VH5A 4J8WB 3AV1D 5AV8A 5CPJB 3AZEC 4NFTA 3AZNB 1HQ3C 5GXQA 1M18D 3MVDC 5E5AD 4J8VC 3AYWA 2HIOC 4HGAB 3KXBA 4XZQC 4ZUXB 1P34D 3C1CC 5B33C 3AV2B 1BH9B 3B6GD 2RVQC 3B0BA 3W97D 3REID 1KX5C 5AY8D 5B2IA 5AV6A 1M1AA 3AZJC 1AOID 3TU4A 5AV9D 5BNVB 3W99D 1P3GD 4Z5TD 3UTBD 1P3AD 5CP6A 5B0ZB 5AV5D 5B1LB 2HUEB 1M18A 3KXBC 4Z2MH 1JFIA 4H9PA 3KUYB 5DNMA 1A7WA 1N1JB 2NQBD 2BYKB 5B2IC 1M1AC 3WKJC 3TU4C 5B32B 3REIA 1KX4B 4WU9D 3A6NB 5GT0D 2FJ7B 3AV1C 1AOIA 5C3IC 2CV5B 5B40A 5AVBD 4JJNB 4Z5TA 1M18C 4QLCA 1H3OA 5E5AC 5F99A 1BH8B 1P3AA 5AV5A 1F66D 5G49A 4Z66A 1P34C 4CAYA 4CSRA 5B2JD 3AZID 2PYOD 3B6GC 4R8PD 2F8ND 1P3LD 3REIC 3W97C 5GSUD 5AY8C 1KX3D 1P3KD 5BO0A 4J8UA 3AZFB 3W96D 1U35A 1AOIC 4YS3B 1S32A 1P3PA 5B0YD 5GT3B 5AV9C 5AVCD 4XZQB 4ZBJC 5B31D 5GT0A 3W99C 3C1CB 3X1VD 4DRAA 3LJAA 1P3GC 4Z5TC 3UTBC 5BNXA 3NQUA 1P3AC 3REJA 4UUZB 5AVBA 3AZMD 3LZ0B 4J8WA 3UT9D 1M19A 2JSSA 3X1UB 2NQBC 3WA9A 5B1MD 3REKB 4LD9A 5B2JA 3AN2A 4H9NB 3AZKD 3AZLD 4H9QB 3MGRD 3B0CT 1KX3A 3VH6W 4WU9C 5GT0C 3AFAD 3W96A 5B0YA 3LZ1B 1P3BB 1P3MD 5AVBC 2BYMB
chains in the Genus database with same CATH superfamily
2XD1A 3X1SB 4G92C 1ZLAD 3WKJB 1P3OD 3REHA 3AZHD 1F66C 3W98A 3AV1B 3MGPD 3B0DC 5CPKD 2JE5A 5B2JC 3V9RB 4X23A 3LELA 3AZIC 2PYOC 4XUJB 4R8PC 1P3LC 4H9SC 5GSUC 5B0ZA 1KX3C 5B1MA 5AV8D 1P3KC 5B1LA 4YM6A 3W96C 3NQJA 5GXQD 3MGRA 1W2EA 5B0YC 4KHAB 5AVCC 5JRGB 5B31C 1N1JA 3X1VC 4EO5C 1HTAA 3AYWD 3B6GB 4H9OB 3W97B 5JA4B 4Z2MG 3UTAB 4KGCD 1ZLAA 1KX4A 1Q9CA 3AZMC 5AV9B 5KDMA 3UT9C 1P3GB 3W99B 3B6FA 2W8SA 5AV6D 3MGPA 3UTBB 5B1MC 4AWLB 4J8XA 3AZKC 3AZLC 3MGRC 3FDDA 4G91C 5DNND 5CP6D 3AFAC 3WAAB 4WU8B 5B32G 2Y2LA 4NE6A 3MNND 2NQBB 1BFMA 1P3MC 1TAFA 2UWXA 2YFVB 5CHLB 1ZLAC 5DNMD 1P3OC 3AZHC 1TZYD 4WNNA 1EQZA 4WV4B 5GT3A 3MGPC 4KGCA 4KUDD 5BT1D 5CPKC 3RELA 4G92B 5BS7A 5AV8C 5B40D 4NE5A 5GXQC 3LZ0A 3MGSD 4QLCD 5DNNA 5F99D 2PYOB 3AYWC 3C1BB 3MNNA 1P3LB 5GSUB 1P3KB 4NE3A 4Z66D 3X1TA 4KGCC 5AVCB 5B31B 1TZYA 4EO5B 3AZGB 5AV6C 2FFFB 5BS7C 3O62B 1P3BA 4KUDA 2NZDB 1U35D 1S32D 1P3PD 1ID3A 3X1SA 3LJAD 3AZMB 5DNNC 5CP6C 3REJD 3MNNC 3WTPB 4XUJA 3MGSA 1P3IA 1P3FA 4J8WD 1M19D 5DNMC 3AZKB 3AZLB 1ULYA 3WA9D 4DRBA 1TZYC 3AFAB 3AZEB 4LD9D 4KUDC 3AN2D 1HQ3B 5BT1C 2YFWA 1P3MB 3MVDB 4J8VB 2F8NK 2HIOB 3KWQA 5CPIA 1P3OB 3AL0C 5JA4A 5B40C 5B24A 3AV2D 2ZY4A 3AZHB 4J8UD 1WWIA 5B33B 3MGSC 3MGQA 5CPKB 4QLCC 5F99C 1KX5B 2Y2MA 5AV5C 4H9RB 3REHD 3W98D 2AROA 1T3UA 3AZJB 5AV8B 4Z66C 4X23D 3LELD 2Y2NA 5GXQB 1F1EA 1B67A 5CPJA 2IO5C 5B0ZD 3AZNA 3AYWB 5B1LD 4YM6D 1U35C 1S32C 2YFVA 1P3PC 3KXBB 3VH5W 3KUYD 3VH6T 3LJAC 4ZUXA 3REJC 3AV2A 1BH9A 5B2IB 4E45A 1M1AB 5B32D 1KX4D 3TU4B 2FJ7D 4J8WC 1M19C 2CV5D 3B6FD 3WA9C 5C3IB 5BNVA 4LD9C 5CP6B 4JJND 3AN2C 4J8XD 3H0RC 1M18B 3C1BA 5E5AB 1JFIB 4H9PB 5DNMB 3AV2C 3KUYA 1P34B 4J8UC 3A1KA 2BYKA 1WWSA 3REIB 5AY8B 3O62A 3AZFD 3REHC 4YS3D 1EQZD 3W98C 5B32A 5GT3D 1AOIB 5B40B 3A6NA 2FJ7A 4X23C 4ZBJB 3LELC 2F8NG 2CV5A 3RELD 4Z5TB 1B6WA 5B0ZC 4QLCB 1H3OB 1P3AB 5F99B 4JJNA 5B1LC 5AV5B 3WTPE 4YM6C 5G49B 1BH8A 5B31G 3LZ0D 3KUYC 3X1UD 4Z66B 4CAYB 4CSRB 3REKD 3AZEA 5FUGB 5BO0B 5B32C 3X1TD 1U35B 1KX4C 4J8VA 1S32B 1P3PB 2FJ7C 3AZFA 4WU9B 5GT0B 2CV5C 4YS3A 3LJAB 3B6FC 3LZ1D 5BNXB 4XZQA 1P3BD 3NQUB 3C1CA 4JJNC 3REJB 1ID3D 3X1SD 5AVBB 4J8XC 2ZY3A 3VH6A 2Y2QA 4H9RA 4UUZA 1M19B 3AZJA 1F66B 3WA9B 3B0DB 3X1UA 4XUJD 1P3ID 4LD9B 5B2JB 3AZIB 1P3FD 3EPHA 4WJ3C 3R45B 3AN2B 4R8PB 2Y2OA 2ZM5A 3REKA 2F8NB 1KX3B 3AZFC 4H9NA 1PZRA 2DQNC 4YS3C 4H9QA 1EQZC 3KFUG 5GT3C 3W96B 5JRGD 5B0YB 2F8NH 4J8UB 3X1VB 3RELC 3LZ1A 3KWQD 5CPID 4M6BA 2BYMA 5B24D 3REHB 3UTAD 3WKJA 3W98B 2G5IC 3LZ0C 3P5JB 2F2AC 3X1UC 3MGQD 3UT9B 4X23B 3LELB 3AV1A 3REKC 2AROD 3V9RA 5B1MB 2Y2JA 2ZY5A 4YM6B 3X1TC 3NQJB 5E5AA 3MGRB 3EPJA 5CPJD 3WAAD 4WU8D 4G91B 3AZND 2L5AA 4KHAA 3LZ1C 5JRGA 1P34A 1P3BC 1ID3C 3B6GA 3X1SC 4H9OA 3W97A 5AY8A 1ZLAB 2CWEA 4ZUXD 5KDMB 3UTAA 3B6FB 3MGPB 5AV9A 4XUJC 1P3IC 1P3GA 1P3FC 3W99A 3UTBA 4J8XB 2Y2PA 1KU5A 3EG5B 5JRGC 1R4VA 3C1BD 3A1IA 1TAFB 3H0MC 4WU8A 3WAAA 2NQBA 5FUGA 3KWQC 5CPIC 5B24C 3UTAC 3VH5T 4WNNB 1EQZB 4KGCB 4WU9A 3MGQC 4UPKA 3AZGD 3O62D 2NZDD 3RELB 5AV6B 4AWLC 2AROC 3A6ND 5CPJC 3WAAC 4WU8C 1F66A 5DNNB 3AZNC 3KSYA 3WTPD 3MNNB 3AZIA 2PYOA 3R45A 4R8PA 4HGAC 2F8NA 3B0CW 1P3LA 4H9SA 5GSUA 3X1TB 2LY8A 1P3KA 4ZUXC 3AZED 1TZYB 1HQ3D 5AVCA 4KUDB 5B31A 3MVDD 3X1VA 4J8VD 1ID3B 3AZGA 2NZDA 4DQYB 2HIOD 4E44A 4XZQD 2G5HC 3C1CD 3H0LC 5B33D 2BG1A 2RVQD 3AZMA 3UT9A 1KX5D 3MGSB 3C1BC 3EPLA 1P3IB 1P3FB 2HUEC 3WTPA 2JCHA 3AZJD 3AZKA 3AZLA 3EPKA 3AFAA 2IO5B 2YFWB 2DF4C 3O62C 3AZGC 2NZDC 1HQ3A 3KWQB 5CPIB 3KXBD 1P3MA 3MVDA 3A6NC 5B24B 2HIOA 1P3OA 2Y2GA 2Y2KA 5B2ID 3MGQB 3AZHA 5B33A 1M1AD 3WTPC 3WKJD 4WZSB 5CPKA 2AROB 3TU4D 1KX5A 3VH5A 4J8WB 3AV1D 5AV8A 5CPJB 3AZEC 4NFTA 3AZNB 1HQ3C 5GXQA 1M18D 3MVDC 5E5AD 4J8VC 3AYWA 2HIOC 2J8PA 4HGAB 3KXBA 4XZQC 4ZUXB 1P34D 3C1CC 5B33C 3AV2B 1BH9B 3B6GD 2RVQC 3B0BA 3W97D 3REID 1KX5C 5AY8D 5B2IA 5AV6A 1M1AA 3AZJC 1AOID 3TU4A 2XD5A 5AV9D 3IP4C 5BNVB 3W99D 1P3GD 4Z5TD 3UTBD 2VQRA 1P3AD 5CP6A 5B0ZB 5AV5D 5B1LB 2HUEB 1M18A 3KXBC 4Z2MH 1JFIA 4H9PA 2Y2IA 3KUYB 5DNMA 1A7WA 1N1JB 2NQBD 2BYKB 5B2IC 1M1AC 2Y2HA 3WKJC 3TU4C 5B32B 3REIA 1KX4B 4WU9D 3A6NB 5GT0D 2FJ7B 3AV1C 1AOIA 5C3IC 2CV5B 5B40A 5AVBD 4JJNB 4Z5TA 1M18C 4QLCA 1H3OA 2RIQA 5E5AC 1BH8B 5F99A 1P3AA 5AV5A 1F66D 5G49A 4Z66A 1P34C 4CAYA 4CSRA 5B2JD 3AZID 2PYOD 3B6GC 4R8PD 2F8ND 1P3LD 3REIC 3W97C 5GSUD 5AY8C 1KX3D 1P3KD 5BO0A 4J8UA 1Z2CB 3AZFB 3W96D 1U35A 1AOIC 4YS3B 1S32A 1P3PA 5B0YD 5GT3B 5AV9C 5AVCD 4XZQB 4ZBJC 5B31D 5GT0A 3W99C 3C1CB 3X1VD 4DRAA 3LJAA 1P3GC 4Z5TC 3UTBC 5BNXA 3NQUA 1P3AC 3REJA 4UUZB 5AVBA 3AZMD 3LZ0B 4J8WA 3UT9D 1M19A 2JSSA 3X1UB 2NQBC 3WA9A 5B1MD 3REKB 4LD9A 5B2JA 3AN2A 4H9NB 3AZKD 3AZLD 4H9QB 2ZY2A 3B0CT 3MGRD 1KX3A 3VH6W 4WU9C 5GT0C 3F6TA 3AFAD 3W96A 5B0YA 3LZ1B 1P3BB 1P3MD 5AVBC 2BYMB
chains in the Genus database with same CATH topology
2XD1A 3X1SB 4G92C 1ZLAD 3WKJB 1P3OD 3REHA 3AZHD 1F66C 3W98A 3AV1B 3MGPD 3B0DC 5CPKD 2JE5A 5B2JC 3V9RB 4X23A 3LELA 3AZIC 2PYOC 4XUJB 4R8PC 1P3LC 4H9SC 5GSUC 5B0ZA 1KX3C 5B1MA 5AV8D 1P3KC 5B1LA 4YM6A 3W96C 3NQJA 5GXQD 3MGRA 1W2EA 5B0YC 4KHAB 5AVCC 5JRGB 5B31C 1N1JA 3X1VC 4EO5C 1HTAA 3AYWD 3B6GB 4H9OB 3W97B 5JA4B 4Z2MG 3UTAB 4KGCD 1ZLAA 1KX4A 1Q9CA 3AZMC 5AV9B 5KDMA 3UT9C 1P3GB 3W99B 3B6FA 2W8SA 5AV6D 3MGPA 3UTBB 5B1MC 4AWLB 4J8XA 3AZKC 3AZLC 3MGRC 3FDDA 4G91C 5DNND 5CP6D 3AFAC 3WAAB 4WU8B 5B32G 2Y2LA 4NE6A 3MNND 2NQBB 1BFMA 1P3MC 1TAFA 2UWXA 2YFVB 5CHLB 1ZLAC 5DNMD 1P3OC 3AZHC 1TZYD 4WNNA 1EQZA 4WV4B 5GT3A 3MGPC 4KGCA 4KUDD 5BT1D 5CPKC 3RELA 4G92B 5BS7A 5AV8C 5B40D 4NE5A 5GXQC 3LZ0A 3MGSD 4QLCD 5DNNA 5F99D 2PYOB 3AYWC 3C1BB 3MNNA 1P3LB 5GSUB 1P3KB 4NE3A 4Z66D 3X1TA 4KGCC 5AVCB 5B31B 1TZYA 4EO5B 3AZGB 5AV6C 2FFFB 5BS7C 3O62B 1P3BA 4KUDA 2NZDB 1U35D 1S32D 1P3PD 1ID3A 3X1SA 3LJAD 3AZMB 5DNNC 5CP6C 3REJD 3MNNC 3WTPB 4XUJA 3MGSA 1P3IA 1P3FA 4J8WD 1M19D 5DNMC 3AZKB 3AZLB 1ULYA 3WA9D 4DRBA 1TZYC 3AFAB 3AZEB 4LD9D 4KUDC 3AN2D 1HQ3B 5BT1C 2YFWA 1P3MB 3MVDB 4J8VB 2F8NK 2HIOB 3KWQA 5CPIA 1P3OB 3AL0C 5JA4A 5B40C 5B24A 3AV2D 2ZY4A 3AZHB 4J8UD 1WWIA 5B33B 3MGSC 3MGQA 5CPKB 4QLCC 5F99C 1KX5B 2Y2MA 5AV5C 4H9RB 3REHD 3W98D 2AROA 1T3UA 3AZJB 5AV8B 4Z66C 4X23D 3LELD 2Y2NA 5GXQB 1F1EA 1B67A 5CPJA 2IO5C 5B0ZD 3AZNA 3AYWB 5B1LD 4YM6D 1U35C 1S32C 2YFVA 1P3PC 3KXBB 3VH5W 3KUYD 3VH6T 3LJAC 4ZUXA 3REJC 3AV2A 1BH9A 5B2IB 4E45A 1M1AB 5B32D 1KX4D 3TU4B 2FJ7D 4J8WC 1M19C 2CV5D 3B6FD 3WA9C 5C3IB 5BNVA 4LD9C 5CP6B 4JJND 3AN2C 4J8XD 3H0RC 1M18B 3C1BA 5E5AB 1JFIB 4H9PB 5DNMB 3AV2C 3KUYA 1P34B 4J8UC 3A1KA 2BYKA 1WWSA 3REIB 5AY8B 3O62A 3AZFD 3REHC 4YS3D 1EQZD 3W98C 5B32A 5GT3D 1AOIB 5B40B 3A6NA 2FJ7A 4X23C 4ZBJB 3LELC 2F8NG 2CV5A 3RELD 4Z5TB 1B6WA 5B0ZC 4QLCB 1H3OB 1P3AB 5F99B 4JJNA 5B1LC 5AV5B 3WTPE 4YM6C 5G49B 1BH8A 5B31G 3LZ0D 3KUYC 3X1UD 4Z66B 4CAYB 4CSRB 3REKD 3AZEA 5FUGB 5BO0B 5B32C 3X1TD 1U35B 1KX4C 4J8VA 1S32B 1P3PB 2FJ7C 3AZFA 4WU9B 5GT0B 2CV5C 4YS3A 3LJAB 3B6FC 3LZ1D 5BNXB 4XZQA 1P3BD 3NQUB 3C1CA 4JJNC 3REJB 1ID3D 3X1SD 5AVBB 4J8XC 2ZY3A 3VH6A 2Y2QA 4H9RA 4UUZA 1M19B 3AZJA 1F66B 3WA9B 3B0DB 3X1UA 4XUJD 1P3ID 4LD9B 5B2JB 3AZIB 1P3FD 3EPHA 4WJ3C 3R45B 3AN2B 4R8PB 2Y2OA 2ZM5A 3REKA 2F8NB 1KX3B 3AZFC 4H9NA 1PZRA 2DQNC 4YS3C 4H9QA 1EQZC 3KFUG 5GT3C 3W96B 5JRGD 5B0YB 2F8NH 4J8UB 3X1VB 3RELC 3LZ1A 3KWQD 5CPID 4M6BA 2BYMA 5B24D 3REHB 3UTAD 3WKJA 3W98B 2G5IC 3LZ0C 3P5JB 2F2AC 3X1UC 3MGQD 3UT9B 4X23B 3LELB 3AV1A 3REKC 2AROD 3V9RA 5B1MB 2Y2JA 2ZY5A 4YM6B 3X1TC 3NQJB 5E5AA 3MGRB 3EPJA 5CPJD 3WAAD 4WU8D 4G91B 3AZND 2L5AA 4KHAA 3LZ1C 5JRGA 1P34A 1P3BC 1ID3C 3B6GA 3X1SC 4H9OA 3W97A 5AY8A 1ZLAB 2CWEA 4ZUXD 5KDMB 3UTAA 3B6FB 3MGPB 5AV9A 4XUJC 1P3IC 1P3GA 1P3FC 3W99A 3UTBA 4J8XB 2Y2PA 1KU5A 3EG5B 5JRGC 1R4VA 3C1BD 3A1IA 1TAFB 3H0MC 4WU8A 3WAAA 2NQBA 5FUGA 3KWQC 5CPIC 5B24C 3UTAC 3VH5T 4WNNB 1EQZB 4KGCB 4WU9A 3MGQC 4UPKA 3AZGD 3O62D 2NZDD 3RELB 5AV6B 4AWLC 2AROC 3A6ND 5CPJC 3WAAC 4WU8C 1F66A 5DNNB 3AZNC 3KSYA 3WTPD 3MNNB 3AZIA 2PYOA 3R45A 4R8PA 4HGAC 2F8NA 3B0CW 1P3LA 4H9SA 5GSUA 3X1TB 2LY8A 1P3KA 4ZUXC 3AZED 1TZYB 1HQ3D 5AVCA 4KUDB 5B31A 3MVDD 3X1VA 4J8VD 1ID3B 3AZGA 2NZDA 4DQYB 2HIOD 4E44A 4XZQD 2G5HC 3C1CD 3H0LC 5B33D 2BG1A 2RVQD 3AZMA 3UT9A 1KX5D 3MGSB 3C1BC 3EPLA 1P3IB 1P3FB 2HUEC 3WTPA 2JCHA 3AZJD 3AZKA 3AZLA 3EPKA 3AFAA 2IO5B 2YFWB 2DF4C 3O62C 3AZGC 2NZDC 1HQ3A 3KWQB 5CPIB 3KXBD 1P3MA 3MVDA 3A6NC 5B24B 2HIOA 1P3OA 2Y2GA 2Y2KA 5B2ID 3MGQB 3AZHA 5B33A 1M1AD 3WTPC 3WKJD 4WZSB 5CPKA 2AROB 3TU4D 1KX5A 3VH5A 4J8WB 3AV1D 5AV8A 5CPJB 3AZEC 4NFTA 3AZNB 1HQ3C 5GXQA 1M18D 3MVDC 5E5AD 4J8VC 3AYWA 2HIOC 2J8PA 4HGAB 3KXBA 4XZQC 4ZUXB 1P34D 3C1CC 5B33C 3AV2B 1BH9B 3B6GD 2RVQC 3B0BA 3W97D 3REID 1KX5C 5AY8D 5B2IA 5AV6A 1M1AA 3AZJC 1AOID 3TU4A 2XD5A 5AV9D 3IP4C 5BNVB 3W99D 1P3GD 4Z5TD 3UTBD 2VQRA 1P3AD 5CP6A 5B0ZB 5AV5D 5B1LB 2HUEB 1M18A 3KXBC 4Z2MH 1JFIA 4H9PA 2Y2IA 3KUYB 5DNMA 1A7WA 1N1JB 2NQBD 2BYKB 5B2IC 1M1AC 2Y2HA 3WKJC 3TU4C 5B32B 3REIA 1KX4B 4WU9D 3A6NB 5GT0D 2FJ7B 3AV1C 1AOIA 5C3IC 2CV5B 5B40A 5AVBD 4JJNB 4Z5TA 1M18C 4QLCA 1H3OA 2RIQA 5E5AC 1BH8B 5F99A 1P3AA 5AV5A 1F66D 5G49A 4Z66A 1P34C 4CAYA 4CSRA 5B2JD 3AZID 2PYOD 3B6GC 4R8PD 2F8ND 1P3LD 3REIC 3W97C 5GSUD 5AY8C 1KX3D 1P3KD 5BO0A 4J8UA 1Z2CB 3AZFB 3W96D 1U35A 1AOIC 4YS3B 1S32A 1P3PA 5B0YD 5GT3B 5AV9C 5AVCD 4XZQB 4ZBJC 5B31D 5GT0A 3W99C 3C1CB 3X1VD 4DRAA 3LJAA 1P3GC 4Z5TC 3UTBC 5BNXA 3NQUA 1P3AC 3REJA 4UUZB 5AVBA 3AZMD 3LZ0B 4J8WA 3UT9D 1M19A 2JSSA 3X1UB 2NQBC 3WA9A 5B1MD 3REKB 4LD9A 5B2JA 3AN2A 4H9NB 3AZKD 3AZLD 4H9QB 2ZY2A 3B0CT 3MGRD 1KX3A 3VH6W 4WU9C 5GT0C 3F6TA 3AFAD 3W96A 5B0YA 3LZ1B 1P3BB 1P3MD 5AVBC 2BYMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S B;  4G92 C;  1ZLA D;  3WKJ B;  1P3O D;  3REH A;  3AZH D;  1F66 C;  3W98 A;  3AV1 B;  3MGP D;  3B0D C;  5CPK D;  5B2J C;  3V9R B;  4X23 A;  3LEL A;  3AZI C;  2PYO C;  4XUJ B;  4R8P C;  1P3L C;  4H9S C;  5GSU C;  5B0Z A;  1KX3 C;  5B1M A;  5AV8 D;  1P3K C;  5B1L A;  4YM6 A;  3W96 C;  3NQJ A;  5GXQ D;  3MGR A;  5B0Y C;  4KHA B;  5AVC C;  5JRG B;  5B31 C;  1N1J A;  3X1V C;  4EO5 C;  1HTA A;  3AYW D;  3B6G B;  4H9O B;  3W97 B;  5JA4 B;  4Z2M G;  3UTA B;  4KGC D;  1ZLA A;  1KX4 A;  1Q9C A;  3AZM C;  5AV9 B;  5KDM A;  3UT9 C;  1P3G B;  3W99 B;  3B6F A;  5AV6 D;  3MGP A;  3UTB B;  5B1M C;  4AWL B;  4J8X A;  3AZK C;  3AZL C;  3MGR C;  4G91 C;  5DNN D;  3AFA C;  5CP6 D;  3WAA B;  4WU8 B;  5B32 G;  3MNN D;  4NE6 A;  2NQB B;  1BFM A;  1P3M C;  1TAF A;  5CHL B;  2YFV B;  1ZLA C;  5DNM D;  1P3O C;  3AZH C;  1TZY D;  4WNN A;  1EQZ A;  4WV4 B;  5GT3 A;  3MGP C;  4KGC A;  4KUD D;  5BT1 D;  5CPK C;  3REL A;  4G92 B;  5BS7 A;  5AV8 C;  5B40 D;  4NE5 A;  5GXQ C;  3LZ0 A;  3MGS D;  4QLC D;  5DNN A;  5F99 D;  2PYO B;  3AYW C;  3C1B B;  3MNN A;  1P3L B;  5GSU B;  1P3K B;  4NE3 A;  4Z66 D;  3X1T A;  4KGC C;  5AVC B;  5B31 B;  1TZY A;  4EO5 B;  3AZG B;  5AV6 C;  5BS7 C;  3O62 B;  1P3B A;  4KUD A;  2NZD B;  1U35 D;  1S32 D;  1P3P D;  1ID3 A;  3X1S A;  3LJA D;  3AZM B;  5DNN C;  5CP6 C;  3REJ D;  3MNN C;  3WTP B;  4XUJ A;  3MGS A;  1P3I A;  1P3F A;  4J8W D;  1M19 D;  5DNM C;  3AZK B;  3AZL B;  1ULY A;  3WA9 D;  4DRB A;  1TZY C;  3AFA B;  3AZE B;  4LD9 D;  4KUD C;  3AN2 D;  1HQ3 B;  5BT1 C;  2YFW A;  1P3M B;  3MVD B;  4J8V B;  2F8N K;  2HIO B;  3KWQ A;  5CPI A;  1P3O B;  5JA4 A;  5B40 C;  5B24 A;  3AV2 D;  3AZH B;  4J8U D;  1WWI A;  5B33 B;  3MGS C;  3MGQ A;  5CPK B;  4QLC C;  5F99 C;  1KX5 B;  5AV5 C;  4H9R B;  3REH D;  3W98 D;  2ARO A;  3AZJ B;  5AV8 B;  4Z66 C;  4X23 D;  3LEL D;  5GXQ B;  1F1E A;  1B67 A;  5CPJ A;  2IO5 C;  5B0Z D;  3AZN A;  3AYW B;  5B1L D;  4YM6 D;  1U35 C;  1S32 C;  2YFV A;  1P3P C;  3KXB B;  3VH5 W;  3KUY D;  3VH6 T;  3LJA C;  4ZUX A;  3REJ C;  3AV2 A;  1BH9 A;  5B2I B;  4E45 A;  1M1A B;  5B32 D;  1KX4 D;  3TU4 B;  2FJ7 D;  4J8W C;  1M19 C;  2CV5 D;  3B6F D;  3WA9 C;  5C3I B;  5BNV A;  4LD9 C;  5CP6 B;  4JJN D;  3AN2 C;  4J8X D;  1M18 B;  3C1B A;  5E5A B;  1JFI B;  4H9P B;  5DNM B;  3AV2 C;  3KUY A;  1P34 B;  4J8U C;  2BYK A;  1WWS A;  3REI B;  5AY8 B;  3O62 A;  3AZF D;  3REH C;  4YS3 D;  1EQZ D;  3W98 C;  5B32 A;  5GT3 D;  1AOI B;  5B40 B;  3A6N A;  2FJ7 A;  4X23 C;  4ZBJ B;  3LEL C;  2F8N G;  2CV5 A;  3REL D;  4Z5T B;  1B6W A;  5B0Z C;  4QLC B;  1H3O B;  1P3A B;  5F99 B;  4JJN A;  5B1L C;  5AV5 B;  3WTP E;  4YM6 C;  5G49 B;  1BH8 A;  5B31 G;  3LZ0 D;  3KUY C;  3X1U D;  4Z66 B;  4CAY B;  4CSR B;  3REK D;  3AZE A;  5FUG B;  5BO0 B;  5B32 C;  3X1T D;  1U35 B;  1KX4 C;  4J8V A;  1S32 B;  1P3P B;  2FJ7 C;  3AZF A;  4WU9 B;  5GT0 B;  2CV5 C;  4YS3 A;  3LJA B;  3B6F C;  3LZ1 D;  5BNX B;  4XZQ A;  1P3B D;  3NQU B;  3C1C A;  4JJN C;  3REJ B;  1ID3 D;  3X1S D;  5AVB B;  4J8X C;  3VH6 A;  4H9R A;  4UUZ A;  1M19 B;  3AZJ A;  1F66 B;  3WA9 B;  3B0D B;  3X1U A;  4XUJ D;  1P3I D;  4LD9 B;  5B2J B;  3AZI B;  1P3F D;  3R45 B;  3AN2 B;  4R8P B;  3REK A;  2F8N B;  1KX3 B;  3AZF C;  4H9N A;  4YS3 C;  1EQZ C;  4H9Q A;  5GT3 C;  3W96 B;  5JRG D;  5B0Y B;  2F8N H;  4J8U B;  3X1V B;  3REL C;  3LZ1 A;  3KWQ D;  5CPI D;  4M6B A;  2BYM A;  5B24 D;  3REH B;  3UTA D;  3WKJ A;  3W98 B;  3LZ0 C;  3X1U C;  3MGQ D;  3UT9 B;  4X23 B;  3LEL B;  3AV1 A;  3REK C;  2ARO D;  3V9R A;  5B1M B;  4YM6 B;  3X1T C;  3NQJ B;  5E5A A;  3MGR B;  5CPJ D;  3WAA D;  4WU8 D;  4G91 B;  3AZN D;  2L5A A;  4KHA A;  3LZ1 C;  5JRG A;  1P34 A;  1P3B C;  1ID3 C;  3B6G A;  3X1S C;  4H9O A;  3W97 A;  5AY8 A;  1ZLA B;  2CWE A;  4ZUX D;  5KDM B;  3UTA A;  3B6F B;  3MGP B;  5AV9 A;  4XUJ C;  1P3I C;  1P3G A;  1P3F C;  3W99 A;  3UTB A;  4J8X B;  1KU5 A;  5JRG C;  1R4V A;  3C1B D;  3WAA A;  1TAF B;  4WU8 A;  2NQB A;  5FUG A;  3KWQ C;  5CPI C;  5B24 C;  3UTA C;  3VH5 T;  4WNN B;  1EQZ B;  4KGC B;  4WU9 A;  3MGQ C;  3AZG D;  3O62 D;  2NZD D;  3REL B;  5AV6 B;  4AWL C;  2ARO C;  3A6N D;  5CPJ C;  3WAA C;  4WU8 C;  1F66 A;  5DNN B;  3AZN C;  3KSY A;  3WTP D;  3MNN B;  3AZI A;  2PYO A;  3R45 A;  4R8P A;  4HGA C;  2F8N A;  3B0C W;  1P3L A;  4H9S A;  5GSU A;  3X1T B;  2LY8 A;  1P3K A;  4ZUX C;  3AZE D;  1TZY B;  1HQ3 D;  5AVC A;  4KUD B;  5B31 A;  3MVD D;  3X1V A;  4J8V D;  1ID3 B;  3AZG A;  2NZD A;  2HIO D;  4E44 A;  4XZQ D;  3C1C D;  5B33 D;  2RVQ D;  3AZM A;  3UT9 A;  1KX5 D;  3MGS B;  3C1B C;  1P3I B;  1P3F B;  2HUE C;  3WTP A;  3AZJ D;  3AZK A;  3AZL A;  3AFA A;  2IO5 B;  2YFW B;  3AZG C;  3O62 C;  2NZD C;  1HQ3 A;  3KWQ B;  5CPI B;  3KXB D;  1P3M A;  3MVD A;  3A6N C;  5B24 B;  2HIO A;  1P3O A;  3MGQ B;  5B2I D;  3AZH A;  5B33 A;  1M1A D;  3WTP C;  3WKJ D;  4WZS B;  5CPK A;  2ARO B;  3TU4 D;  1KX5 A;  3VH5 A;  4J8W B;  3AV1 D;  5AV8 A;  5CPJ B;  3AZE C;  4NFT A;  3AZN B;  1HQ3 C;  5GXQ A;  1M18 D;  3MVD C;  5E5A D;  4J8V C;  3AYW A;  2HIO C;  4HGA B;  3KXB A;  4XZQ C;  4ZUX B;  1P34 D;  3C1C C;  5B33 C;  3AV2 B;  1BH9 B;  3B6G D;  2RVQ C;  3B0B A;  3W97 D;  3REI D;  1KX5 C;  5AY8 D;  5B2I A;  5AV6 A;  1M1A A;  3AZJ C;  1AOI D;  3TU4 A;  5AV9 D;  5BNV B;  3W99 D;  1P3G D;  4Z5T D;  3UTB D;  1P3A D;  5CP6 A;  5B0Z B;  5AV5 D;  5B1L B;  2HUE B;  1M18 A;  3KXB C;  4Z2M H;  1JFI A;  4H9P A;  3KUY B;  5DNM A;  1A7W A;  1N1J B;  2NQB D;  2BYK B;  5B2I C;  1M1A C;  3WKJ C;  3TU4 C;  5B32 B;  3REI A;  1KX4 B;  4WU9 D;  3A6N B;  5GT0 D;  2FJ7 B;  3AV1 C;  1AOI A;  5C3I C;  2CV5 B;  5B40 A;  5AVB D;  4JJN B;  4Z5T A;  1M18 C;  4QLC A;  1H3O A;  5E5A C;  5F99 A;  1BH8 B;  1P3A A;  5AV5 A;  1F66 D;  5G49 A;  4Z66 A;  1P34 C;  4CAY A;  4CSR A;  5B2J D;  3AZI D;  2PYO D;  3B6G C;  4R8P D;  2F8N D;  1P3L D;  3REI C;  3W97 C;  5GSU D;  5AY8 C;  1KX3 D;  1P3K D;  5BO0 A;  4J8U A;  3AZF B;  3W96 D;  1U35 A;  1AOI C;  4YS3 B;  1S32 A;  1P3P A;  5B0Y D;  5GT3 B;  5AV9 C;  5AVC D;  4XZQ B;  4ZBJ C;  5B31 D;  5GT0 A;  3W99 C;  3C1C B;  3X1V D;  4DRA A;  3LJA A;  1P3G C;  4Z5T C;  3UTB C;  5BNX A;  3NQU A;  1P3A C;  3REJ A;  4UUZ B;  5AVB A;  3AZM D;  3LZ0 B;  4J8W A;  3UT9 D;  1M19 A;  2JSS A;  3X1U B;  2NQB C;  3WA9 A;  5B1M D;  3REK B;  4LD9 A;  5B2J A;  3AN2 A;  4H9N B;  3AZK D;  3AZL D;  4H9Q B;  3MGR D;  3B0C T;  1KX3 A;  3VH6 W;  4WU9 C;  5GT0 C;  3AFA D;  3W96 A;  5B0Y A;  3LZ1 B;  1P3B B;  1P3M D;  5AVB C;  2BYM B; 
#chains in the Genus database with same CATH topology
 2XD1 A;  3X1S B;  4G92 C;  1ZLA D;  3WKJ B;  1P3O D;  3REH A;  3AZH D;  1F66 C;  3W98 A;  3AV1 B;  3MGP D;  3B0D C;  5CPK D;  2JE5 A;  5B2J C;  3V9R B;  4X23 A;  3LEL A;  3AZI C;  2PYO C;  4XUJ B;  4R8P C;  1P3L C;  4H9S C;  5GSU C;  5B0Z A;  1KX3 C;  5B1M A;  5AV8 D;  1P3K C;  5B1L A;  4YM6 A;  3W96 C;  3NQJ A;  5GXQ D;  3MGR A;  1W2E A;  5B0Y C;  4KHA B;  5AVC C;  5JRG B;  5B31 C;  1N1J A;  3X1V C;  4EO5 C;  1HTA A;  3AYW D;  3B6G B;  4H9O B;  3W97 B;  5JA4 B;  4Z2M G;  3UTA B;  4KGC D;  1ZLA A;  1KX4 A;  1Q9C A;  3AZM C;  5AV9 B;  5KDM A;  3UT9 C;  1P3G B;  3W99 B;  3B6F A;  2W8S A;  5AV6 D;  3MGP A;  3UTB B;  5B1M C;  4AWL B;  4J8X A;  3AZK C;  3AZL C;  3MGR C;  3FDD A;  4G91 C;  5DNN D;  5CP6 D;  3AFA C;  3WAA B;  4WU8 B;  5B32 G;  2Y2L A;  4NE6 A;  3MNN D;  2NQB B;  1BFM A;  1P3M C;  1TAF A;  2UWX A;  2YFV B;  5CHL B;  1ZLA C;  5DNM D;  1P3O C;  3AZH C;  1TZY D;  4WNN A;  1EQZ A;  4WV4 B;  5GT3 A;  3MGP C;  4KGC A;  4KUD D;  5BT1 D;  5CPK C;  3REL A;  4G92 B;  5BS7 A;  5AV8 C;  5B40 D;  4NE5 A;  5GXQ C;  3LZ0 A;  3MGS D;  4QLC D;  5DNN A;  5F99 D;  2PYO B;  3AYW C;  3C1B B;  3MNN A;  1P3L B;  5GSU B;  1P3K B;  4NE3 A;  4Z66 D;  3X1T A;  4KGC C;  5AVC B;  5B31 B;  1TZY A;  4EO5 B;  3AZG B;  5AV6 C;  2FFF B;  5BS7 C;  3O62 B;  1P3B A;  4KUD A;  2NZD B;  1U35 D;  1S32 D;  1P3P D;  1ID3 A;  3X1S A;  3LJA D;  3AZM B;  5DNN C;  5CP6 C;  3REJ D;  3MNN C;  3WTP B;  4XUJ A;  3MGS A;  1P3I A;  1P3F A;  4J8W D;  1M19 D;  5DNM C;  3AZK B;  3AZL B;  1ULY A;  3WA9 D;  4DRB A;  1TZY C;  3AFA B;  3AZE B;  4LD9 D;  4KUD C;  3AN2 D;  1HQ3 B;  5BT1 C;  2YFW A;  1P3M B;  3MVD B;  4J8V B;  2F8N K;  2HIO B;  3KWQ A;  5CPI A;  1P3O B;  3AL0 C;  5JA4 A;  5B40 C;  5B24 A;  3AV2 D;  2ZY4 A;  3AZH B;  4J8U D;  1WWI A;  5B33 B;  3MGS C;  3MGQ A;  5CPK B;  4QLC C;  5F99 C;  1KX5 B;  2Y2M A;  5AV5 C;  4H9R B;  3REH D;  3W98 D;  2ARO A;  1T3U A;  3AZJ B;  5AV8 B;  4Z66 C;  4X23 D;  3LEL D;  2Y2N A;  5GXQ B;  1F1E A;  1B67 A;  5CPJ A;  2IO5 C;  5B0Z D;  3AZN A;  3AYW B;  5B1L D;  4YM6 D;  1U35 C;  1S32 C;  2YFV A;  1P3P C;  3KXB B;  3VH5 W;  3KUY D;  3VH6 T;  3LJA C;  4ZUX A;  3REJ C;  3AV2 A;  1BH9 A;  5B2I B;  4E45 A;  1M1A B;  5B32 D;  1KX4 D;  3TU4 B;  2FJ7 D;  4J8W C;  1M19 C;  2CV5 D;  3B6F D;  3WA9 C;  5C3I B;  5BNV A;  4LD9 C;  5CP6 B;  4JJN D;  3AN2 C;  4J8X D;  3H0R C;  1M18 B;  3C1B A;  5E5A B;  1JFI B;  4H9P B;  5DNM B;  3AV2 C;  3KUY A;  1P34 B;  4J8U C;  3A1K A;  2BYK A;  1WWS A;  3REI B;  5AY8 B;  3O62 A;  3AZF D;  3REH C;  4YS3 D;  1EQZ D;  3W98 C;  5B32 A;  5GT3 D;  1AOI B;  5B40 B;  3A6N A;  2FJ7 A;  4X23 C;  4ZBJ B;  3LEL C;  2F8N G;  2CV5 A;  3REL D;  4Z5T B;  1B6W A;  5B0Z C;  4QLC B;  1H3O B;  1P3A B;  5F99 B;  4JJN A;  5B1L C;  5AV5 B;  3WTP E;  4YM6 C;  5G49 B;  1BH8 A;  5B31 G;  3LZ0 D;  3KUY C;  3X1U D;  4Z66 B;  4CAY B;  4CSR B;  3REK D;  3AZE A;  5FUG B;  5BO0 B;  5B32 C;  3X1T D;  1U35 B;  1KX4 C;  4J8V A;  1S32 B;  1P3P B;  2FJ7 C;  3AZF A;  4WU9 B;  5GT0 B;  2CV5 C;  4YS3 A;  3LJA B;  3B6F C;  3LZ1 D;  5BNX B;  4XZQ A;  1P3B D;  3NQU B;  3C1C A;  4JJN C;  3REJ B;  1ID3 D;  3X1S D;  5AVB B;  4J8X C;  2ZY3 A;  3VH6 A;  2Y2Q A;  4H9R A;  4UUZ A;  1M19 B;  3AZJ A;  1F66 B;  3WA9 B;  3B0D B;  3X1U A;  4XUJ D;  1P3I D;  4LD9 B;  5B2J B;  3AZI B;  1P3F D;  3EPH A;  4WJ3 C;  3R45 B;  3AN2 B;  4R8P B;  2Y2O A;  2ZM5 A;  3REK A;  2F8N B;  1KX3 B;  3AZF C;  4H9N A;  1PZR A;  2DQN C;  4YS3 C;  4H9Q A;  1EQZ C;  3KFU G;  5GT3 C;  3W96 B;  5JRG D;  5B0Y B;  2F8N H;  4J8U B;  3X1V B;  3REL C;  3LZ1 A;  3KWQ D;  5CPI D;  4M6B A;  2BYM A;  5B24 D;  3REH B;  3UTA D;  3WKJ A;  3W98 B;  2G5I C;  3LZ0 C;  3P5J B;  2F2A C;  3X1U C;  3MGQ D;  3UT9 B;  4X23 B;  3LEL B;  3AV1 A;  3REK C;  2ARO D;  3V9R A;  5B1M B;  2Y2J A;  2ZY5 A;  4YM6 B;  3X1T C;  3NQJ B;  5E5A A;  3MGR B;  3EPJ A;  5CPJ D;  3WAA D;  4WU8 D;  4G91 B;  3AZN D;  2L5A A;  4KHA A;  3LZ1 C;  5JRG A;  1P34 A;  1P3B C;  1ID3 C;  3B6G A;  3X1S C;  4H9O A;  3W97 A;  5AY8 A;  1ZLA B;  2CWE A;  4ZUX D;  5KDM B;  3UTA A;  3B6F B;  3MGP B;  5AV9 A;  4XUJ C;  1P3I C;  1P3G A;  1P3F C;  3W99 A;  3UTB A;  4J8X B;  2Y2P A;  1KU5 A;  3EG5 B;  5JRG C;  1R4V A;  3C1B D;  3A1I A;  1TAF B;  3H0M C;  4WU8 A;  3WAA A;  2NQB A;  5FUG A;  3KWQ C;  5CPI C;  5B24 C;  3UTA C;  3VH5 T;  4WNN B;  1EQZ B;  4KGC B;  4WU9 A;  3MGQ C;  4UPK A;  3AZG D;  3O62 D;  2NZD D;  3REL B;  5AV6 B;  4AWL C;  2ARO C;  3A6N D;  5CPJ C;  3WAA C;  4WU8 C;  1F66 A;  5DNN B;  3AZN C;  3KSY A;  3WTP D;  3MNN B;  3AZI A;  2PYO A;  3R45 A;  4R8P A;  4HGA C;  2F8N A;  3B0C W;  1P3L A;  4H9S A;  5GSU A;  3X1T B;  2LY8 A;  1P3K A;  4ZUX C;  3AZE D;  1TZY B;  1HQ3 D;  5AVC A;  4KUD B;  5B31 A;  3MVD D;  3X1V A;  4J8V D;  1ID3 B;  3AZG A;  2NZD A;  4DQY B;  2HIO D;  4E44 A;  4XZQ D;  2G5H C;  3C1C D;  3H0L C;  5B33 D;  2BG1 A;  2RVQ D;  3AZM A;  3UT9 A;  1KX5 D;  3MGS B;  3C1B C;  3EPL A;  1P3I B;  1P3F B;  2HUE C;  3WTP A;  2JCH A;  3AZJ D;  3AZK A;  3AZL A;  3EPK A;  3AFA A;  2IO5 B;  2YFW B;  2DF4 C;  3O62 C;  3AZG C;  2NZD C;  1HQ3 A;  3KWQ B;  5CPI B;  3KXB D;  1P3M A;  3MVD A;  3A6N C;  5B24 B;  2HIO A;  1P3O A;  2Y2G A;  2Y2K A;  5B2I D;  3MGQ B;  3AZH A;  5B33 A;  1M1A D;  3WTP C;  3WKJ D;  4WZS B;  5CPK A;  2ARO B;  3TU4 D;  1KX5 A;  3VH5 A;  4J8W B;  3AV1 D;  5AV8 A;  5CPJ B;  3AZE C;  4NFT A;  3AZN B;  1HQ3 C;  5GXQ A;  1M18 D;  3MVD C;  5E5A D;  4J8V C;  3AYW A;  2HIO C;  2J8P A;  4HGA B;  3KXB A;  4XZQ C;  4ZUX B;  1P34 D;  3C1C C;  5B33 C;  3AV2 B;  1BH9 B;  3B6G D;  2RVQ C;  3B0B A;  3W97 D;  3REI D;  1KX5 C;  5AY8 D;  5B2I A;  5AV6 A;  1M1A A;  3AZJ C;  1AOI D;  3TU4 A;  2XD5 A;  5AV9 D;  3IP4 C;  5BNV B;  3W99 D;  1P3G D;  4Z5T D;  3UTB D;  2VQR A;  1P3A D;  5CP6 A;  5B0Z B;  5AV5 D;  5B1L B;  2HUE B;  1M18 A;  3KXB C;  4Z2M H;  1JFI A;  4H9P A;  2Y2I A;  3KUY B;  5DNM A;  1A7W A;  1N1J B;  2NQB D;  2BYK B;  5B2I C;  1M1A C;  2Y2H A;  3WKJ C;  3TU4 C;  5B32 B;  3REI A;  1KX4 B;  4WU9 D;  3A6N B;  5GT0 D;  2FJ7 B;  3AV1 C;  1AOI A;  5C3I C;  2CV5 B;  5B40 A;  5AVB D;  4JJN B;  4Z5T A;  1M18 C;  4QLC A;  1H3O A;  2RIQ A;  5E5A C;  1BH8 B;  5F99 A;  1P3A A;  5AV5 A;  1F66 D;  5G49 A;  4Z66 A;  1P34 C;  4CAY A;  4CSR A;  5B2J D;  3AZI D;  2PYO D;  3B6G C;  4R8P D;  2F8N D;  1P3L D;  3REI C;  3W97 C;  5GSU D;  5AY8 C;  1KX3 D;  1P3K D;  5BO0 A;  4J8U A;  1Z2C B;  3AZF B;  3W96 D;  1U35 A;  1AOI C;  4YS3 B;  1S32 A;  1P3P A;  5B0Y D;  5GT3 B;  5AV9 C;  5AVC D;  4XZQ B;  4ZBJ C;  5B31 D;  5GT0 A;  3W99 C;  3C1C B;  3X1V D;  4DRA A;  3LJA A;  1P3G C;  4Z5T C;  3UTB C;  5BNX A;  3NQU A;  1P3A C;  3REJ A;  4UUZ B;  5AVB A;  3AZM D;  3LZ0 B;  4J8W A;  3UT9 D;  1M19 A;  2JSS A;  3X1U B;  2NQB C;  3WA9 A;  5B1M D;  3REK B;  4LD9 A;  5B2J A;  3AN2 A;  4H9N B;  3AZK D;  3AZL D;  4H9Q B;  2ZY2 A;  3B0C T;  3MGR D;  1KX3 A;  3VH6 W;  4WU9 C;  5GT0 C;  3F6T A;  3AFA D;  3W96 A;  5B0Y A;  3LZ1 B;  1P3B B;  1P3M D;  5AVB C;  2BYM B; 
#chains in the Genus database with same CATH homology
 2XD1 A;  3X1S B;  4G92 C;  1ZLA D;  3WKJ B;  1P3O D;  3REH A;  3AZH D;  1F66 C;  3W98 A;  3AV1 B;  3MGP D;  3B0D C;  5CPK D;  2JE5 A;  5B2J C;  3V9R B;  4X23 A;  3LEL A;  3AZI C;  2PYO C;  4XUJ B;  4R8P C;  1P3L C;  4H9S C;  5GSU C;  5B0Z A;  1KX3 C;  5B1M A;  5AV8 D;  1P3K C;  5B1L A;  4YM6 A;  3W96 C;  3NQJ A;  5GXQ D;  3MGR A;  1W2E A;  5B0Y C;  4KHA B;  5AVC C;  5JRG B;  5B31 C;  1N1J A;  3X1V C;  4EO5 C;  1HTA A;  3AYW D;  3B6G B;  4H9O B;  3W97 B;  5JA4 B;  4Z2M G;  3UTA B;  4KGC D;  1ZLA A;  1KX4 A;  1Q9C A;  3AZM C;  5AV9 B;  5KDM A;  3UT9 C;  1P3G B;  3W99 B;  3B6F A;  2W8S A;  5AV6 D;  3MGP A;  3UTB B;  5B1M C;  4AWL B;  4J8X A;  3AZK C;  3AZL C;  3MGR C;  3FDD A;  4G91 C;  5DNN D;  5CP6 D;  3AFA C;  3WAA B;  4WU8 B;  5B32 G;  2Y2L A;  4NE6 A;  3MNN D;  2NQB B;  1BFM A;  1P3M C;  1TAF A;  2UWX A;  2YFV B;  5CHL B;  1ZLA C;  5DNM D;  1P3O C;  3AZH C;  1TZY D;  4WNN A;  1EQZ A;  4WV4 B;  5GT3 A;  3MGP C;  4KGC A;  4KUD D;  5BT1 D;  5CPK C;  3REL A;  4G92 B;  5BS7 A;  5AV8 C;  5B40 D;  4NE5 A;  5GXQ C;  3LZ0 A;  3MGS D;  4QLC D;  5DNN A;  5F99 D;  2PYO B;  3AYW C;  3C1B B;  3MNN A;  1P3L B;  5GSU B;  1P3K B;  4NE3 A;  4Z66 D;  3X1T A;  4KGC C;  5AVC B;  5B31 B;  1TZY A;  4EO5 B;  3AZG B;  5AV6 C;  2FFF B;  5BS7 C;  3O62 B;  1P3B A;  4KUD A;  2NZD B;  1U35 D;  1S32 D;  1P3P D;  1ID3 A;  3X1S A;  3LJA D;  3AZM B;  5DNN C;  5CP6 C;  3REJ D;  3MNN C;  3WTP B;  4XUJ A;  3MGS A;  1P3I A;  1P3F A;  4J8W D;  1M19 D;  5DNM C;  3AZK B;  3AZL B;  1ULY A;  3WA9 D;  4DRB A;  1TZY C;  3AFA B;  3AZE B;  4LD9 D;  4KUD C;  3AN2 D;  1HQ3 B;  5BT1 C;  2YFW A;  1P3M B;  3MVD B;  4J8V B;  2F8N K;  2HIO B;  3KWQ A;  5CPI A;  1P3O B;  3AL0 C;  5JA4 A;  5B40 C;  5B24 A;  3AV2 D;  2ZY4 A;  3AZH B;  4J8U D;  1WWI A;  5B33 B;  3MGS C;  3MGQ A;  5CPK B;  4QLC C;  5F99 C;  1KX5 B;  2Y2M A;  5AV5 C;  4H9R B;  3REH D;  3W98 D;  2ARO A;  1T3U A;  3AZJ B;  5AV8 B;  4Z66 C;  4X23 D;  3LEL D;  2Y2N A;  5GXQ B;  1F1E A;  1B67 A;  5CPJ A;  2IO5 C;  5B0Z D;  3AZN A;  3AYW B;  5B1L D;  4YM6 D;  1U35 C;  1S32 C;  2YFV A;  1P3P C;  3KXB B;  3VH5 W;  3KUY D;  3VH6 T;  3LJA C;  4ZUX A;  3REJ C;  3AV2 A;  1BH9 A;  5B2I B;  4E45 A;  1M1A B;  5B32 D;  1KX4 D;  3TU4 B;  2FJ7 D;  4J8W C;  1M19 C;  2CV5 D;  3B6F D;  3WA9 C;  5C3I B;  5BNV A;  4LD9 C;  5CP6 B;  4JJN D;  3AN2 C;  4J8X D;  3H0R C;  1M18 B;  3C1B A;  5E5A B;  1JFI B;  4H9P B;  5DNM B;  3AV2 C;  3KUY A;  1P34 B;  4J8U C;  3A1K A;  2BYK A;  1WWS A;  3REI B;  5AY8 B;  3O62 A;  3AZF D;  3REH C;  4YS3 D;  1EQZ D;  3W98 C;  5B32 A;  5GT3 D;  1AOI B;  5B40 B;  3A6N A;  2FJ7 A;  4X23 C;  4ZBJ B;  3LEL C;  2F8N G;  2CV5 A;  3REL D;  4Z5T B;  1B6W A;  5B0Z C;  4QLC B;  1H3O B;  1P3A B;  5F99 B;  4JJN A;  5B1L C;  5AV5 B;  3WTP E;  4YM6 C;  5G49 B;  1BH8 A;  5B31 G;  3LZ0 D;  3KUY C;  3X1U D;  4Z66 B;  4CAY B;  4CSR B;  3REK D;  3AZE A;  5FUG B;  5BO0 B;  5B32 C;  3X1T D;  1U35 B;  1KX4 C;  4J8V A;  1S32 B;  1P3P B;  2FJ7 C;  3AZF A;  4WU9 B;  5GT0 B;  2CV5 C;  4YS3 A;  3LJA B;  3B6F C;  3LZ1 D;  5BNX B;  4XZQ A;  1P3B D;  3NQU B;  3C1C A;  4JJN C;  3REJ B;  1ID3 D;  3X1S D;  5AVB B;  4J8X C;  2ZY3 A;  3VH6 A;  2Y2Q A;  4H9R A;  4UUZ A;  1M19 B;  3AZJ A;  1F66 B;  3WA9 B;  3B0D B;  3X1U A;  4XUJ D;  1P3I D;  4LD9 B;  5B2J B;  3AZI B;  1P3F D;  3EPH A;  4WJ3 C;  3R45 B;  3AN2 B;  4R8P B;  2Y2O A;  2ZM5 A;  3REK A;  2F8N B;  1KX3 B;  3AZF C;  4H9N A;  1PZR A;  2DQN C;  4YS3 C;  4H9Q A;  1EQZ C;  3KFU G;  5GT3 C;  3W96 B;  5JRG D;  5B0Y B;  2F8N H;  4J8U B;  3X1V B;  3REL C;  3LZ1 A;  3KWQ D;  5CPI D;  4M6B A;  2BYM A;  5B24 D;  3REH B;  3UTA D;  3WKJ A;  3W98 B;  2G5I C;  3LZ0 C;  3P5J B;  2F2A C;  3X1U C;  3MGQ D;  3UT9 B;  4X23 B;  3LEL B;  3AV1 A;  3REK C;  2ARO D;  3V9R A;  5B1M B;  2Y2J A;  2ZY5 A;  4YM6 B;  3X1T C;  3NQJ B;  5E5A A;  3MGR B;  3EPJ A;  5CPJ D;  3WAA D;  4WU8 D;  4G91 B;  3AZN D;  2L5A A;  4KHA A;  3LZ1 C;  5JRG A;  1P34 A;  1P3B C;  1ID3 C;  3B6G A;  3X1S C;  4H9O A;  3W97 A;  5AY8 A;  1ZLA B;  2CWE A;  4ZUX D;  5KDM B;  3UTA A;  3B6F B;  3MGP B;  5AV9 A;  4XUJ C;  1P3I C;  1P3G A;  1P3F C;  3W99 A;  3UTB A;  4J8X B;  2Y2P A;  1KU5 A;  3EG5 B;  5JRG C;  1R4V A;  3C1B D;  3A1I A;  1TAF B;  3H0M C;  4WU8 A;  3WAA A;  2NQB A;  5FUG A;  3KWQ C;  5CPI C;  5B24 C;  3UTA C;  3VH5 T;  4WNN B;  1EQZ B;  4KGC B;  4WU9 A;  3MGQ C;  4UPK A;  3AZG D;  3O62 D;  2NZD D;  3REL B;  5AV6 B;  4AWL C;  2ARO C;  3A6N D;  5CPJ C;  3WAA C;  4WU8 C;  1F66 A;  5DNN B;  3AZN C;  3KSY A;  3WTP D;  3MNN B;  3AZI A;  2PYO A;  3R45 A;  4R8P A;  4HGA C;  2F8N A;  3B0C W;  1P3L A;  4H9S A;  5GSU A;  3X1T B;  2LY8 A;  1P3K A;  4ZUX C;  3AZE D;  1TZY B;  1HQ3 D;  5AVC A;  4KUD B;  5B31 A;  3MVD D;  3X1V A;  4J8V D;  1ID3 B;  3AZG A;  2NZD A;  4DQY B;  2HIO D;  4E44 A;  4XZQ D;  2G5H C;  3C1C D;  3H0L C;  5B33 D;  2BG1 A;  2RVQ D;  3AZM A;  3UT9 A;  1KX5 D;  3MGS B;  3C1B C;  3EPL A;  1P3I B;  1P3F B;  2HUE C;  3WTP A;  2JCH A;  3AZJ D;  3AZK A;  3AZL A;  3EPK A;  3AFA A;  2IO5 B;  2YFW B;  2DF4 C;  3O62 C;  3AZG C;  2NZD C;  1HQ3 A;  3KWQ B;  5CPI B;  3KXB D;  1P3M A;  3MVD A;  3A6N C;  5B24 B;  2HIO A;  1P3O A;  2Y2G A;  2Y2K A;  5B2I D;  3MGQ B;  3AZH A;  5B33 A;  1M1A D;  3WTP C;  3WKJ D;  4WZS B;  5CPK A;  2ARO B;  3TU4 D;  1KX5 A;  3VH5 A;  4J8W B;  3AV1 D;  5AV8 A;  5CPJ B;  3AZE C;  4NFT A;  3AZN B;  1HQ3 C;  5GXQ A;  1M18 D;  3MVD C;  5E5A D;  4J8V C;  3AYW A;  2HIO C;  2J8P A;  4HGA B;  3KXB A;  4XZQ C;  4ZUX B;  1P34 D;  3C1C C;  5B33 C;  3AV2 B;  1BH9 B;  3B6G D;  2RVQ C;  3B0B A;  3W97 D;  3REI D;  1KX5 C;  5AY8 D;  5B2I A;  5AV6 A;  1M1A A;  3AZJ C;  1AOI D;  3TU4 A;  2XD5 A;  5AV9 D;  3IP4 C;  5BNV B;  3W99 D;  1P3G D;  4Z5T D;  3UTB D;  2VQR A;  1P3A D;  5CP6 A;  5B0Z B;  5AV5 D;  5B1L B;  2HUE B;  1M18 A;  3KXB C;  4Z2M H;  1JFI A;  4H9P A;  2Y2I A;  3KUY B;  5DNM A;  1A7W A;  1N1J B;  2NQB D;  2BYK B;  5B2I C;  1M1A C;  2Y2H A;  3WKJ C;  3TU4 C;  5B32 B;  3REI A;  1KX4 B;  4WU9 D;  3A6N B;  5GT0 D;  2FJ7 B;  3AV1 C;  1AOI A;  5C3I C;  2CV5 B;  5B40 A;  5AVB D;  4JJN B;  4Z5T A;  1M18 C;  4QLC A;  1H3O A;  2RIQ A;  5E5A C;  1BH8 B;  5F99 A;  1P3A A;  5AV5 A;  1F66 D;  5G49 A;  4Z66 A;  1P34 C;  4CAY A;  4CSR A;  5B2J D;  3AZI D;  2PYO D;  3B6G C;  4R8P D;  2F8N D;  1P3L D;  3REI C;  3W97 C;  5GSU D;  5AY8 C;  1KX3 D;  1P3K D;  5BO0 A;  4J8U A;  1Z2C B;  3AZF B;  3W96 D;  1U35 A;  1AOI C;  4YS3 B;  1S32 A;  1P3P A;  5B0Y D;  5GT3 B;  5AV9 C;  5AVC D;  4XZQ B;  4ZBJ C;  5B31 D;  5GT0 A;  3W99 C;  3C1C B;  3X1V D;  4DRA A;  3LJA A;  1P3G C;  4Z5T C;  3UTB C;  5BNX A;  3NQU A;  1P3A C;  3REJ A;  4UUZ B;  5AVB A;  3AZM D;  3LZ0 B;  4J8W A;  3UT9 D;  1M19 A;  2JSS A;  3X1U B;  2NQB C;  3WA9 A;  5B1M D;  3REK B;  4LD9 A;  5B2J A;  3AN2 A;  4H9N B;  3AZK D;  3AZL D;  4H9Q B;  2ZY2 A;  3B0C T;  3MGR D;  1KX3 A;  3VH6 W;  4WU9 C;  5GT0 C;  3F6T A;  3AFA D;  3W96 A;  5B0Y A;  3LZ1 B;  1P3B B;  1P3M D;  5AVB C;  2BYM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...