2F8ND

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nD00
5CPIC 3X1SA 1HQ3B 3AZMC 3MGQD 5B0ZB 3X1VD 1ID3B 5B33D 4J8WC 3UTBB 5CPIB 4CAYB 1KX5A 5B31B 3LZ1A 1EQZB 5JA4A 5B2JB 2NZDA 5E5AB 1P3FC 3WTPB 4J8XA 5AVCD 2NZDB 4H9RA 3VH6T 1TAFB 1EQZC 5F99D 3AZNC 4H9SC 2YFVA 3MGSB 5GT0D 4LD9B 3AZID 5GT3D 3AZND 1H3OB 1TZYC 3AZFA 5B1MB 3AZFB 3MGQB 3B6GD 4Z5TD 5GSUB 3B0CT 1BH8B 1M19C 2RVQC 5BO0B 3UTAD 5JRGD 2NQBA 1Q9CA 4XUJD 1U35D 2FJ7B 5JRGC 4WU8A 5AV5D 2NZDC 1M19D 5B32B 1F66D 1M1AB 4XUJB 4HGAB 3KWQA 4DRBA 3LZ0A 1S32A 1P3GC 5CPIA 3VH6A 5B2JD 1P3OA 3MGRA 1EQZD 3B6GB 3WA9C 5KDMB 4YS3A 1P3LC 4J8UC 3REJB 5CP6D 3W96D 3W99B 1M18B 4NE3A 3AZMA 4J8UA 1P3FD 3UTBA 4G92B 5B31A 3LZ1B 5BS7A 3W97A 5AY8A 1HQ3A 4M6BA 5E5AD 3W99D 4H9SA 2CWEA 3AZHD 3WAAD 1KX4D 5GT3C 4J8VA 5B0YD 1M18C 3W98B 3REIA 4E45A 1P3KC 1EQZA 5B2JA 3R45A 3NQUA 2LY8A 3LZ0D 4Z2MH 5B2JC 5GXQD 1AOID 4WU9B 3TU4C 5CPJD 5B1MD 4WNNA 4NFTA 3VH5T 2AROC 4WU8D 1BH9A 3AFAC 4JJNA 3LZ0B 3KXBA 5B31G 1S32B 1H3OA 1HQ3C 5B1MA 1U35B 2F8NB 3V9RA 1WWIA 4H9QA 3A6ND 1P3KA 3B6FB 1ID3A 1KU5A 1P3MD 5CHLB 3WAAC 4DRAA 5E5AA 5AV8D 3AYWD 5CPKC 2PYOA 3WAAA 2PYOB 5B24C 3REJA 2F8NH 5AY8D 3W97D 1KX3B 4YM6B 3WKJD 5B0ZD 3WTPC 5CPJC 4LD9A 3X1UB 5DNMD 4H9OB 1KX5D 4J8UD 1P34A 4H9OA 1TAFA 4YS3D 3W98C 3W96A 2F8NK 3MGQA 5AY8C 3C1BA 3W97C 3MGRD 3RELA 5AVCB 1P3MA 4WV4B 1ID3C 1ZLAD 4JJNB 5B40C 1N1JB 3C1CD 3KXBB 2IO5C 5C3IB 1P3LA 3AV1D 4UUZB 5BO0A 2HUEB 1P3GB 3AZGD 4XUJA 5B24B 3O62C 3AZJC 5B24A 3R45B 3REJC 4KUDB 3AZIB 3UTAB 5CP6C 1AOIA 3B6GA 5KDMA 4XZQA 3AZFD 2HUEC 5BNVA 3B0BA 3O62B 3KUYD 5AV8C 3MVDA 3REID 4HGAC 3AYWC 3AZNA 3AZJB 5CPKD 2CV5B 4J8VD 1M18A 4KGCB 3WA9B 3AV1B 4KHAB 3REHC 4ZBJC 4Z66A 5B1LC 4ZUXD 3REHD 3AZHC 3MGPA 5B33C 5AY8B 3W97B 3MGQC 5B32C 3X1VB 4H9NB 3WAAB 4WU8C 3REKA 1ZLAB 3X1VA 4H9NA 5B40D 2F8NG 3RELB 1P3GA 5GXQC 1BH9B 3X1TD 3MGSA 5B2IC 3MNNA 2HIOA 1P3PC 3MNNB 4KUDA 4EO5B 5CPKA 3KUYA 3AN2C 1B6WA 3MGSC 1P3AA 5DNMC 5B0ZC 5B2IB 4H9QB 3TU4B 4UUZA 1P3BC 3UTBC 5GXQB 3AN2B 1BFMA 4R8PC 5AV6A 2CV5A 3MVDB 3UT9A 3UT9D 4R8PA 3LELA 1ZLAC 1U35C 5GT3B 3B0DC 3X1SB 3AZKB 4XZQB 3KSYA 5BNXB 1P3KB 3B6FA 3MGSD 3X1TA 1P3AD 1M1AA 4Z5TB 1P3LD 3X1TB 1P3PD 4KGCA 4WU9C 1B67A 3X1UA 1P3GD 5GT0B 3AZIC 5BNVB 5DNNC 3REKD 5BT1D 3LZ1D 3C1CB 5DNNA 4E44A 5AV5C 4J8UB 3AV2D 4ZUXB 5AV6C 1AOIC 3WKJA 4ZUXA 5AV9C 5AVBA 1P3IC 3X1SD 3REJD 1KX3D 3WKJB 3W96B 3O62D 3LJAB 3KUYB 3C1BB 3UTAC 3AZJD 5BS7C 4Z66D 1M1AC 4XZQC 2PYOD 1BH8A 4Z5TC 3C1CC 1P3PA 3MVDD 2JSSA 5CP6B 1N1JA 4YM6D 5AV6B 4KGCC 1ID3D 5GT0C 2IO5B 4R8PD 2BYMB 5G49A 4WZSB 1P3ID 1KX3C 3AZKD 5BNXA 4WNNB 2YFVB 1KX5C 4J8WB 5B1MC 3TU4D 4J8WA 2F8ND 3VH6W 5AVCC 5GSUC 3KXBD 3AZKC 3MGPC 1AOIB 5B24D 5BT1C 3AZGC 3AV1A 3X1TC 1P3IB 5GSUA 3WKJC 4KUDD 5GXQA 1ZLAA 4YM6C 4WU9D 3AZNB 3AZGB 3WA9A 5C3IC 3MGPB 4WU8B 3A6NC 3MVDC 3AZEB 3NQJA 3AZEA 4Z66B 3RELD 1P34D 1F1EA 3LJAD 3AZHA 5DNMA 4XUJC 4LD9D 5B1LB 1ULYA 3REHB 5DNMB 3B0DB 3X1SC 3MGPD 4CAYA 1HQ3D 3REHA 1KX5B 4J8VB 3AZLD 3REIB 3UTBD 4J8VC 3LJAA 3AZLC 1R4VA 4CSRB 4QLCD 5AV8A 3AYWA 3AZMB 1P3MB 1TZYA 3AZFC 1P3OC 3AN2A 4EO5C 1S32C 5AVBB 4XZQD 4G91C 1KX4C 1JFIB 3A6NA 1P3KD 4X23B 2L5AA 3MNNC 5B0YC 4AWLB 2NQBB 5G49B 5B32D 4JJND 3W99C 3UT9B 3AZGA 3AV1C 3LZ1C 2AROD 4G91B 5B31C 3UTAA 5B32A 3VH5W 3AFAB 3AZKA 1P3IA 4Z5TA 4H9PA 5AV5B 3AZHB 3C1BC 3AN2D 3AV2B 4NE6A 1HTAA 3MGRB 4YS3C 3W98D 4YM6A 5CPJB 3KUYC 3C1BD 4QLCC 5GT0A 3V9RB 5B0YA 1KX4B 3WTPD 1P3BB 1KX4A 4QLCA 1P3BA 5B31D 3W99A 5B0ZA 5AVCA 3AZMD 1P3FA 2BYKB 2NZDD 1P3PB 5CP6A 3AZLB 5B40B 4JJNC 3NQJB 1P3BD 2RVQD 3LJAC 3AZLA 5F99B 1P3MC 3WTPA 5B33A 5AV9B 3REKB 1P3OD 3W98A 2BYMA 1S32D 3AZED 3B6FC 3WA9D 4X23C 2FJ7C 3KWQD 1TZYB 3X1UC 1P34B 3REIC 5FUGA 1F66A 5F99C 2HIOB 4WU9A 2AROB 1M19A 1F66B 3A6NB 2AROA 3AZEC 1M19B 3B6FD 3WTPE 5GSUD 2YFWB 5AV5A 3TU4A 5JRGA 2YFWA 2NQBD 3LELC 5JRGB 1P34C 1U35A 4J8XC 4J8WD 2F8NA 5CPJA 4LD9C 3X1VC 4R8PB 5B32G 5GT3A 3B0CW 1TZYD 4NE5A 5E5AC 1P3FB 3MNND 3AZIA 4KUDC 2PYOC 4Z66C 5JA4B 2HIOC 5B2ID 5F99A 4J8XD 5B33B 5B1LA 5AV9D 4Z2MG 3AV2A 3O62A 3AZJA 4CSRA 1KX3A 5AV8B 3AYWB 5AVBD 2CV5C 1WWSA 2BYKA 4ZBJB 3REKC 4J8XB 5DNND 4KHAA 4G92C 4QLCB 3VH5A 3X1UD 1P3AB 5B1LD 4ZUXC 5AV9A 3KWQC 2FJ7D 4KGCD 3LZ0C 5B2IA 5CPID 1F66C 1M1AD 1P3AC 1M18D 1JFIA 1P3LB 4X23A 3NQUB 4H9RB 3MGRC 3LELD 2NQBC 3AV2C 3AFAA 3UT9C 5AV6D 3B6GC 5FUGB 5CPKB 2CV5D 3AFAD 1P3OB 3W96C 3KXBC 5AVBC 4X23D 4H9PB 3KWQB 1A7WA 3RELC 2HIOD 3C1CA 4AWLC 5DNNB 2FJ7A 5B0YB 3LELB 5B40A 4YS3B
chains in the Genus database with same CATH superfamily
5CPIC 3X1SA 1HQ3B 3IP4C 3AZMC 3MGQD 5B0ZB 3X1VD 1ID3B 5B33D 4J8WC 3UTBB 5CPIB 4CAYB 1KX5A 2Y2OA 5B31B 3LZ1A 1EQZB 5JA4A 5B2JB 2NZDA 5E5AB 1P3FC 3WTPB 4J8XA 5AVCD 2NZDB 4H9RA 3VH6T 1TAFB 1T3UA 1EQZC 5F99D 3AZNC 4H9SC 2YFVA 2FFFB 3MGSB 5GT0D 4LD9B 3AZID 5GT3D 3AZND 1H3OB 1TZYC 3AZFA 5B1MB 3AZFB 3MGQB 3B6GD 3EPHA 4Z5TD 5GSUB 3B0CT 1BH8B 1M19C 2RVQC 5BO0B 3UTAD 5JRGD 2NQBA 1Q9CA 3KFUG 4XUJD 1U35D 2FJ7B 5JRGC 4WU8A 5AV5D 3F6TA 2NZDC 1M19D 5B32B 1F66D 1M1AB 4XUJB 4HGAB 3KWQA 4DRBA 3LZ0A 1S32A 1P3GC 5CPIA 2Y2QA 3VH6A 5B2JD 1P3OA 3MGRA 1EQZD 3B6GB 3WA9C 5KDMB 2W8SA 4YS3A 1P3LC 4J8UC 3REJB 5CP6D 3W96D 3W99B 2Y2KA 4NE3A 3AZMA 4J8UA 1P3FD 3UTBA 1M18B 4G92B 5B31A 3LZ1B 5BS7A 3W97A 5AY8A 1HQ3A 2ZY2A 4M6BA 5E5AD 3W99D 4H9SA 2CWEA 3AZHD 3WAAD 1KX4D 5GT3C 4J8VA 5B0YD 1M18C 3W98B 3REIA 4E45A 1P3KC 1EQZA 3EG5B 5B2JA 3R45A 3NQUA 2LY8A 3LZ0D 1PZRA 4Z2MH 5B2JC 5GXQD 1AOID 4WU9B 3TU4C 3H0MC 5CPJD 5B1MD 2JE5A 4WNNA 4NFTA 3VH5T 2AROC 4WU8D 1BH9A 3AFAC 4JJNA 3LZ0B 3KXBA 5B31G 2Y2HA 1S32B 1H3OA 1HQ3C 5B1MA 1U35B 2F8NB 3V9RA 1WWIA 4H9QA 2G5IC 3A6ND 1P3KA 3B6FB 1ID3A 1KU5A 2XD5A 2XD1A 1P3MD 5CHLB 3WAAC 2Y2JA 4DRAA 5E5AA 2ZM5A 5AV8D 3AYWD 5CPKC 2PYOA 3WAAA 2JCHA 2PYOB 2Y2IA 5B24C 3REJA 2F8NH 5AY8D 3W97D 1KX3B 4YM6B 3WKJD 5B0ZD 2UWXA 3WTPC 5CPJC 4LD9A 3X1UB 5DNMD 4H9OB 1KX5D 4J8UD 1P34A 4H9OA 1TAFA 4YS3D 3W98C 3W96A 2F8NK 3MGQA 5AY8C 3C1BA 3W97C 3MGRD 3RELA 5AVCB 1P3MA 4WV4B 1ID3C 1ZLAD 4JJNB 5B40C 1N1JB 3C1CD 3KXBB 2IO5C 5C3IB 1P3LA 3AV1D 2Y2GA 3P5JB 4UUZB 5BO0A 2HUEB 1P3GB 3AZGD 4XUJA 5B24B 2F2AC 3O62C 3AZJC 5B24A 3R45B 3REJC 4KUDB 3AZIB 3UTAB 5CP6C 1AOIA 3B6GA 5KDMA 4XZQA 3AZFD 2HUEC 5BNVA 3B0BA 3O62B 3KUYD 5AV8C 3MVDA 3REID 4HGAC 3AYWC 3AZNA 3AZJB 5CPKD 2CV5B 4J8VD 1M18A 4KGCB 3WA9B 3H0LC 3AV1B 4KHAB 3REHC 4ZBJC 4Z66A 5B1LC 4ZUXD 3REHD 3AZHC 3MGPA 5B33C 5AY8B 3W97B 3MGQC 5B32C 3X1VB 4H9NB 3WAAB 4WU8C 3REKA 1ZLAB 3X1VA 4H9NA 5B40D 2F8NG 3RELB 1P3GA 5GXQC 1BH9B 3X1TD 3MGSA 5B2IC 3MNNA 2HIOA 1P3PC 3MNNB 4KUDA 4EO5B 5CPKA 3KUYA 3AN2C 1B6WA 3MGSC 1P3AA 5DNMC 5B0ZC 5B2IB 4H9QB 2Y2LA 3TU4B 4UUZA 1P3BC 3UTBC 5GXQB 1W2EA 3AN2B 1BFMA 4R8PC 3A1KA 3EPLA 5AV6A 2CV5A 3MVDB 3UT9A 3UT9D 4R8PA 3LELA 1ZLAC 1U35C 5GT3B 3B0DC 3X1SB 3AZKB 4XZQB 3KSYA 5BNXB 1P3KB 3B6FA 3MGSD 3X1TA 1P3AD 1M1AA 4Z5TB 1P3LD 3X1TB 1P3PD 2ZY5A 4KGCA 4WU9C 1B67A 3X1UA 1P3GD 5GT0B 4WJ3C 3AZIC 2Y2MA 5BNVB 5DNNC 3REKD 5BT1D 3LZ1D 3AL0C 3C1CB 5DNNA 4E44A 5AV5C 4J8UB 3AV2D 4ZUXB 5AV6C 1AOIC 3WKJA 4ZUXA 5AV9C 5AVBA 1P3IC 3X1SD 3REJD 2ZY3A 1KX3D 3WKJB 3W96B 3O62D 3LJAB 3KUYB 3C1BB 4DQYB 3UTAC 5BS7C 3AZJD 4Z66D 1M1AC 4XZQC 2PYOD 1BH8A 4Z5TC 3C1CC 1P3PA 3MVDD 2JSSA 5CP6B 1N1JA 4YM6D 5AV6B 4KGCC 1ID3D 2J8PA 5GT0C 2IO5B 4R8PD 2BYMB 5G49A 4WZSB 1P3ID 1KX3C 3AZKD 5BNXA 4WNNB 2YFVB 1KX5C 4J8WB 5B1MC 3TU4D 4J8WA 2F8ND 3VH6W 5AVCC 5GSUC 3KXBD 3AZKC 3MGPC 1AOIB 5B24D 5BT1C 3AZGC 3AV1A 3X1TC 3H0RC 5GSUA 1P3IB 3WKJC 4KUDD 5GXQA 1ZLAA 4YM6C 4WU9D 3AZNB 3AZGB 3WA9A 5C3IC 3MGPB 4WU8B 3A6NC 3MVDC 3AZEB 3NQJA 2RIQA 3AZEA 4Z66B 3RELD 1P34D 1F1EA 3LJAD 2G5HC 5DNMA 4XUJC 3AZHA 4LD9D 5B1LB 1ULYA 3REHB 5DNMB 3B0DB 3X1SC 3MGPD 4CAYA 1HQ3D 3REHA 1KX5B 4J8VB 3AZLD 3REIB 3UTBD 4J8VC 3LJAA 3AZLC 1R4VA 4CSRB 4QLCD 5AV8A 3AYWA 3AZMB 1P3MB 1TZYA 3AZFC 1P3OC 3AN2A 4EO5C 2DF4C 1S32C 5AVBB 3A1IA 3EPJA 4XZQD 4G91C 1KX4C 1JFIB 3A6NA 1P3KD 4X23B 2L5AA 3MNNC 5B0YC 2BG1A 4AWLB 2NQBB 5G49B 5B32D 4JJND 3W99C 3UT9B 3AZGA 3AV1C 2Y2NA 3LZ1C 2AROD 4G91B 5B31C 3UTAA 5B32A 3VH5W 3AFAB 3AZKA 1P3IA 4Z5TA 4H9PA 5AV5B 3AZHB 3C1BC 3AN2D 3AV2B 4NE6A 1HTAA 3MGRB 4YS3C 3W98D 4YM6A 5CPJB 3KUYC 3C1BD 4QLCC 5GT0A 3V9RB 5B0YA 1KX4B 3WTPD 2Y2PA 1P3BB 1KX4A 4QLCA 1P3BA 5B31D 3W99A 5B0ZA 5AVCA 2ZY4A 3AZMD 1P3FA 2BYKB 2NZDD 1P3PB 5CP6A 3AZLB 5B40B 4JJNC 3NQJB 1P3BD 2RVQD 3LJAC 3AZLA 5F99B 1P3MC 3WTPA 5B33A 5AV9B 3REKB 1P3OD 3W98A 2BYMA 1S32D 3AZED 3B6FC 3WA9D 4X23C 2FJ7C 3KWQD 1TZYB 3X1UC 1P34B 3REIC 5FUGA 1F66A 5F99C 2HIOB 4WU9A 2AROB 1M19A 1F66B 3A6NB 2AROA 3AZEC 1M19B 3B6FD 3WTPE 5GSUD 2YFWB 5AV5A 3TU4A 5JRGA 2YFWA 2NQBD 3LELC 5JRGB 1P34C 1U35A 4J8XC 4J8WD 2F8NA 5CPJA 4LD9C 3X1VC 4R8PB 5B32G 2VQRA 5GT3A 3B0CW 1TZYD 4NE5A 5E5AC 1P3FB 3MNND 3AZIA 4KUDC 2PYOC 4Z66C 5JA4B 2HIOC 5B2ID 5F99A 4J8XD 5B33B 5B1LA 5AV9D 4Z2MG 3AV2A 3O62A 3AZJA 4CSRA 1KX3A 5AV8B 3AYWB 5AVBD 2CV5C 1Z2CB 1WWSA 2BYKA 4ZBJB 3REKC 3FDDA 5DNND 4J8XB 4KHAA 4G92C 4QLCB 3VH5A 3X1UD 1P3AB 5B1LD 4ZUXC 5AV9A 3KWQC 2FJ7D 4KGCD 3LZ0C 5B2IA 5CPID 1F66C 1M1AD 1P3AC 1M18D 1JFIA 1P3LB 4X23A 3NQUB 4H9RB 3MGRC 3LELD 2NQBC 3AV2C 3AFAA 3UT9C 5AV6D 3B6GC 5FUGB 5CPKB 2CV5D 3AFAD 1P3OB 3W96C 3KXBC 5AVBC 4X23D 4H9PB 3KWQB 3EPKA 1A7WA 3RELC 4UPKA 2DQNC 2HIOD 3C1CA 4AWLC 5DNNB 2FJ7A 5B0YB 3LELB 5B40A 4YS3B
chains in the Genus database with same CATH topology
5CPIC 3X1SA 1HQ3B 3IP4C 3AZMC 3MGQD 5B0ZB 3X1VD 1ID3B 5B33D 4J8WC 3UTBB 5CPIB 4CAYB 1KX5A 2Y2OA 5B31B 3LZ1A 1EQZB 5JA4A 5B2JB 2NZDA 5E5AB 1P3FC 3WTPB 4J8XA 5AVCD 2NZDB 4H9RA 3VH6T 1TAFB 1T3UA 1EQZC 5F99D 3AZNC 4H9SC 2YFVA 2FFFB 3MGSB 5GT0D 4LD9B 3AZID 5GT3D 3AZND 1H3OB 1TZYC 3AZFA 5B1MB 3AZFB 3MGQB 3B6GD 3EPHA 4Z5TD 5GSUB 3B0CT 1BH8B 1M19C 2RVQC 5BO0B 3UTAD 5JRGD 2NQBA 1Q9CA 3KFUG 4XUJD 1U35D 2FJ7B 5JRGC 4WU8A 5AV5D 3F6TA 2NZDC 1M19D 5B32B 1F66D 1M1AB 4XUJB 4HGAB 3KWQA 4DRBA 3LZ0A 1S32A 1P3GC 5CPIA 2Y2QA 3VH6A 5B2JD 1P3OA 3MGRA 1EQZD 3B6GB 3WA9C 5KDMB 2W8SA 4YS3A 1P3LC 4J8UC 3REJB 5CP6D 3W96D 3W99B 2Y2KA 4NE3A 3AZMA 4J8UA 1P3FD 3UTBA 1M18B 4G92B 5B31A 3LZ1B 5BS7A 3W97A 5AY8A 1HQ3A 2ZY2A 4M6BA 5E5AD 3W99D 4H9SA 2CWEA 3AZHD 3WAAD 1KX4D 5GT3C 4J8VA 5B0YD 1M18C 3W98B 3REIA 4E45A 1P3KC 1EQZA 3EG5B 5B2JA 3R45A 3NQUA 2LY8A 3LZ0D 1PZRA 4Z2MH 5B2JC 5GXQD 1AOID 4WU9B 3TU4C 3H0MC 5CPJD 5B1MD 2JE5A 4WNNA 4NFTA 3VH5T 2AROC 4WU8D 1BH9A 3AFAC 4JJNA 3LZ0B 3KXBA 5B31G 2Y2HA 1S32B 1H3OA 1HQ3C 5B1MA 1U35B 2F8NB 3V9RA 1WWIA 4H9QA 2G5IC 3A6ND 1P3KA 3B6FB 1ID3A 1KU5A 2XD5A 2XD1A 1P3MD 5CHLB 3WAAC 2Y2JA 4DRAA 5E5AA 2ZM5A 5AV8D 3AYWD 5CPKC 2PYOA 3WAAA 2JCHA 2PYOB 2Y2IA 5B24C 3REJA 2F8NH 5AY8D 3W97D 1KX3B 4YM6B 3WKJD 5B0ZD 2UWXA 3WTPC 5CPJC 4LD9A 3X1UB 5DNMD 4H9OB 1KX5D 4J8UD 1P34A 4H9OA 1TAFA 4YS3D 3W98C 3W96A 2F8NK 3MGQA 5AY8C 3C1BA 3W97C 3MGRD 3RELA 5AVCB 1P3MA 4WV4B 1ID3C 1ZLAD 4JJNB 5B40C 1N1JB 3C1CD 3KXBB 2IO5C 5C3IB 1P3LA 3AV1D 2Y2GA 3P5JB 4UUZB 5BO0A 2HUEB 1P3GB 3AZGD 4XUJA 5B24B 2F2AC 3O62C 3AZJC 5B24A 3R45B 3REJC 4KUDB 3AZIB 3UTAB 5CP6C 1AOIA 3B6GA 5KDMA 4XZQA 3AZFD 2HUEC 5BNVA 3B0BA 3O62B 3KUYD 5AV8C 3MVDA 3REID 4HGAC 3AYWC 3AZNA 3AZJB 5CPKD 2CV5B 4J8VD 1M18A 4KGCB 3WA9B 3H0LC 3AV1B 4KHAB 3REHC 4ZBJC 4Z66A 5B1LC 4ZUXD 3REHD 3AZHC 3MGPA 5B33C 5AY8B 3W97B 3MGQC 5B32C 3X1VB 4H9NB 3WAAB 4WU8C 3REKA 1ZLAB 3X1VA 4H9NA 5B40D 2F8NG 3RELB 1P3GA 5GXQC 1BH9B 3X1TD 3MGSA 5B2IC 3MNNA 2HIOA 1P3PC 3MNNB 4KUDA 4EO5B 5CPKA 3KUYA 3AN2C 1B6WA 3MGSC 1P3AA 5DNMC 5B0ZC 5B2IB 4H9QB 2Y2LA 3TU4B 4UUZA 1P3BC 3UTBC 5GXQB 1W2EA 3AN2B 1BFMA 4R8PC 3A1KA 3EPLA 5AV6A 2CV5A 3MVDB 3UT9A 3UT9D 4R8PA 3LELA 1ZLAC 1U35C 5GT3B 3B0DC 3X1SB 3AZKB 4XZQB 3KSYA 5BNXB 1P3KB 3B6FA 3MGSD 3X1TA 1P3AD 1M1AA 4Z5TB 1P3LD 3X1TB 1P3PD 2ZY5A 4KGCA 4WU9C 1B67A 3X1UA 1P3GD 5GT0B 4WJ3C 3AZIC 2Y2MA 5BNVB 5DNNC 3REKD 5BT1D 3LZ1D 3AL0C 3C1CB 5DNNA 4E44A 5AV5C 4J8UB 3AV2D 4ZUXB 5AV6C 1AOIC 3WKJA 4ZUXA 5AV9C 5AVBA 1P3IC 3X1SD 3REJD 2ZY3A 1KX3D 3WKJB 3W96B 3O62D 3LJAB 3KUYB 3C1BB 4DQYB 3UTAC 5BS7C 3AZJD 4Z66D 1M1AC 4XZQC 2PYOD 1BH8A 4Z5TC 3C1CC 1P3PA 3MVDD 2JSSA 5CP6B 1N1JA 4YM6D 5AV6B 4KGCC 1ID3D 2J8PA 5GT0C 2IO5B 4R8PD 2BYMB 5G49A 4WZSB 1P3ID 1KX3C 3AZKD 5BNXA 4WNNB 2YFVB 1KX5C 4J8WB 5B1MC 3TU4D 4J8WA 2F8ND 3VH6W 5AVCC 5GSUC 3KXBD 3AZKC 3MGPC 1AOIB 5B24D 5BT1C 3AZGC 3AV1A 3X1TC 3H0RC 5GSUA 1P3IB 3WKJC 4KUDD 5GXQA 1ZLAA 4YM6C 4WU9D 3AZNB 3AZGB 3WA9A 5C3IC 3MGPB 4WU8B 3A6NC 3MVDC 3AZEB 3NQJA 2RIQA 3AZEA 4Z66B 3RELD 1P34D 1F1EA 3LJAD 2G5HC 5DNMA 4XUJC 3AZHA 4LD9D 5B1LB 1ULYA 3REHB 5DNMB 3B0DB 3X1SC 3MGPD 4CAYA 1HQ3D 3REHA 1KX5B 4J8VB 3AZLD 3REIB 3UTBD 4J8VC 3LJAA 3AZLC 1R4VA 4CSRB 4QLCD 5AV8A 3AYWA 3AZMB 1P3MB 1TZYA 3AZFC 1P3OC 3AN2A 4EO5C 2DF4C 1S32C 5AVBB 3A1IA 3EPJA 4XZQD 4G91C 1KX4C 1JFIB 3A6NA 1P3KD 4X23B 2L5AA 3MNNC 5B0YC 2BG1A 4AWLB 2NQBB 5G49B 5B32D 4JJND 3W99C 3UT9B 3AZGA 3AV1C 2Y2NA 3LZ1C 2AROD 4G91B 5B31C 3UTAA 5B32A 3VH5W 3AFAB 3AZKA 1P3IA 4Z5TA 4H9PA 5AV5B 3AZHB 3C1BC 3AN2D 3AV2B 4NE6A 1HTAA 3MGRB 4YS3C 3W98D 4YM6A 5CPJB 3KUYC 3C1BD 4QLCC 5GT0A 3V9RB 5B0YA 1KX4B 3WTPD 2Y2PA 1P3BB 1KX4A 4QLCA 1P3BA 5B31D 3W99A 5B0ZA 5AVCA 2ZY4A 3AZMD 1P3FA 2BYKB 2NZDD 1P3PB 5CP6A 3AZLB 5B40B 4JJNC 3NQJB 1P3BD 2RVQD 3LJAC 3AZLA 5F99B 1P3MC 3WTPA 5B33A 5AV9B 3REKB 1P3OD 3W98A 2BYMA 1S32D 3AZED 3B6FC 3WA9D 4X23C 2FJ7C 3KWQD 1TZYB 3X1UC 1P34B 3REIC 5FUGA 1F66A 5F99C 2HIOB 4WU9A 2AROB 1M19A 1F66B 3A6NB 2AROA 3AZEC 1M19B 3B6FD 3WTPE 5GSUD 2YFWB 5AV5A 3TU4A 5JRGA 2YFWA 2NQBD 3LELC 5JRGB 1P34C 1U35A 4J8XC 4J8WD 2F8NA 5CPJA 4LD9C 3X1VC 4R8PB 5B32G 2VQRA 5GT3A 3B0CW 1TZYD 4NE5A 5E5AC 1P3FB 3MNND 3AZIA 4KUDC 2PYOC 4Z66C 5JA4B 2HIOC 5B2ID 5F99A 4J8XD 5B33B 5B1LA 5AV9D 4Z2MG 3AV2A 3O62A 3AZJA 4CSRA 1KX3A 5AV8B 3AYWB 5AVBD 2CV5C 1Z2CB 1WWSA 2BYKA 4ZBJB 3REKC 3FDDA 5DNND 4J8XB 4KHAA 4G92C 4QLCB 3VH5A 3X1UD 1P3AB 5B1LD 4ZUXC 5AV9A 3KWQC 2FJ7D 4KGCD 3LZ0C 5B2IA 5CPID 1F66C 1M1AD 1P3AC 1M18D 1JFIA 1P3LB 4X23A 3NQUB 4H9RB 3MGRC 3LELD 2NQBC 3AV2C 3AFAA 3UT9C 5AV6D 3B6GC 5FUGB 5CPKB 2CV5D 3AFAD 1P3OB 3W96C 3KXBC 5AVBC 4X23D 4H9PB 3KWQB 3EPKA 1A7WA 3RELC 4UPKA 2DQNC 2HIOD 3C1CA 4AWLC 5DNNB 2FJ7A 5B0YB 3LELB 5B40A 4YS3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI C;  3X1S A;  1HQ3 B;  3AZM C;  3MGQ D;  5B0Z B;  3X1V D;  1ID3 B;  5B33 D;  4J8W C;  3UTB B;  5CPI B;  4CAY B;  1KX5 A;  5B31 B;  3LZ1 A;  1EQZ B;  5JA4 A;  5B2J B;  2NZD A;  5E5A B;  1P3F C;  3WTP B;  4J8X A;  5AVC D;  2NZD B;  4H9R A;  3VH6 T;  1TAF B;  1EQZ C;  5F99 D;  3AZN C;  4H9S C;  2YFV A;  3MGS B;  5GT0 D;  4LD9 B;  3AZI D;  5GT3 D;  3AZN D;  1H3O B;  1TZY C;  3AZF A;  5B1M B;  3AZF B;  3MGQ B;  3B6G D;  4Z5T D;  5GSU B;  3B0C T;  1BH8 B;  1M19 C;  2RVQ C;  5BO0 B;  3UTA D;  5JRG D;  2NQB A;  1Q9C A;  4XUJ D;  1U35 D;  2FJ7 B;  5JRG C;  4WU8 A;  5AV5 D;  2NZD C;  1M19 D;  5B32 B;  1F66 D;  1M1A B;  4XUJ B;  4HGA B;  3KWQ A;  4DRB A;  3LZ0 A;  1S32 A;  1P3G C;  5CPI A;  3VH6 A;  5B2J D;  1P3O A;  3MGR A;  1EQZ D;  3B6G B;  3WA9 C;  5KDM B;  4YS3 A;  1P3L C;  4J8U C;  3REJ B;  5CP6 D;  3W96 D;  3W99 B;  1M18 B;  4NE3 A;  3AZM A;  4J8U A;  1P3F D;  3UTB A;  4G92 B;  5B31 A;  3LZ1 B;  5BS7 A;  3W97 A;  5AY8 A;  1HQ3 A;  4M6B A;  5E5A D;  3W99 D;  4H9S A;  2CWE A;  3AZH D;  3WAA D;  1KX4 D;  5GT3 C;  4J8V A;  5B0Y D;  1M18 C;  3W98 B;  3REI A;  4E45 A;  1P3K C;  1EQZ A;  5B2J A;  3R45 A;  3NQU A;  2LY8 A;  3LZ0 D;  4Z2M H;  5B2J C;  5GXQ D;  1AOI D;  4WU9 B;  3TU4 C;  5CPJ D;  5B1M D;  4WNN A;  4NFT A;  3VH5 T;  2ARO C;  4WU8 D;  1BH9 A;  3AFA C;  4JJN A;  3LZ0 B;  3KXB A;  5B31 G;  1S32 B;  1H3O A;  1HQ3 C;  5B1M A;  1U35 B;  2F8N B;  3V9R A;  1WWI A;  4H9Q A;  3A6N D;  1P3K A;  3B6F B;  1ID3 A;  1KU5 A;  1P3M D;  5CHL B;  3WAA C;  4DRA A;  5E5A A;  5AV8 D;  3AYW D;  5CPK C;  2PYO A;  3WAA A;  2PYO B;  5B24 C;  3REJ A;  2F8N H;  5AY8 D;  3W97 D;  1KX3 B;  4YM6 B;  3WKJ D;  5B0Z D;  3WTP C;  5CPJ C;  4LD9 A;  3X1U B;  5DNM D;  4H9O B;  1KX5 D;  4J8U D;  1P34 A;  4H9O A;  1TAF A;  4YS3 D;  3W98 C;  3W96 A;  2F8N K;  3MGQ A;  5AY8 C;  3C1B A;  3W97 C;  3MGR D;  3REL A;  5AVC B;  1P3M A;  4WV4 B;  1ID3 C;  1ZLA D;  4JJN B;  5B40 C;  1N1J B;  3C1C D;  3KXB B;  2IO5 C;  5C3I B;  1P3L A;  3AV1 D;  4UUZ B;  5BO0 A;  2HUE B;  1P3G B;  3AZG D;  4XUJ A;  5B24 B;  3O62 C;  3AZJ C;  5B24 A;  3R45 B;  3REJ C;  4KUD B;  3AZI B;  3UTA B;  5CP6 C;  1AOI A;  3B6G A;  5KDM A;  4XZQ A;  3AZF D;  2HUE C;  5BNV A;  3B0B A;  3O62 B;  3KUY D;  5AV8 C;  3MVD A;  3REI D;  4HGA C;  3AYW C;  3AZN A;  3AZJ B;  5CPK D;  2CV5 B;  4J8V D;  1M18 A;  4KGC B;  3WA9 B;  3AV1 B;  4KHA B;  3REH C;  4ZBJ C;  4Z66 A;  5B1L C;  4ZUX D;  3REH D;  3AZH C;  3MGP A;  5B33 C;  5AY8 B;  3W97 B;  3MGQ C;  5B32 C;  3X1V B;  4H9N B;  3WAA B;  4WU8 C;  3REK A;  1ZLA B;  3X1V A;  4H9N A;  5B40 D;  2F8N G;  3REL B;  1P3G A;  5GXQ C;  1BH9 B;  3X1T D;  3MGS A;  5B2I C;  3MNN A;  2HIO A;  1P3P C;  3MNN B;  4KUD A;  4EO5 B;  5CPK A;  3KUY A;  3AN2 C;  1B6W A;  3MGS C;  1P3A A;  5DNM C;  5B0Z C;  5B2I B;  4H9Q B;  3TU4 B;  4UUZ A;  1P3B C;  3UTB C;  5GXQ B;  3AN2 B;  1BFM A;  4R8P C;  5AV6 A;  2CV5 A;  3MVD B;  3UT9 A;  3UT9 D;  4R8P A;  3LEL A;  1ZLA C;  1U35 C;  5GT3 B;  3B0D C;  3X1S B;  3AZK B;  4XZQ B;  3KSY A;  5BNX B;  1P3K B;  3B6F A;  3MGS D;  3X1T A;  1P3A D;  1M1A A;  4Z5T B;  1P3L D;  3X1T B;  1P3P D;  4KGC A;  4WU9 C;  1B67 A;  3X1U A;  1P3G D;  5GT0 B;  3AZI C;  5BNV B;  5DNN C;  3REK D;  5BT1 D;  3LZ1 D;  3C1C B;  5DNN A;  4E44 A;  5AV5 C;  4J8U B;  3AV2 D;  4ZUX B;  5AV6 C;  1AOI C;  3WKJ A;  4ZUX A;  5AV9 C;  5AVB A;  1P3I C;  3X1S D;  3REJ D;  1KX3 D;  3WKJ B;  3W96 B;  3O62 D;  3LJA B;  3KUY B;  3C1B B;  3UTA C;  3AZJ D;  5BS7 C;  4Z66 D;  1M1A C;  4XZQ C;  2PYO D;  1BH8 A;  4Z5T C;  3C1C C;  1P3P A;  3MVD D;  2JSS A;  5CP6 B;  1N1J A;  4YM6 D;  5AV6 B;  4KGC C;  1ID3 D;  5GT0 C;  2IO5 B;  4R8P D;  2BYM B;  5G49 A;  4WZS B;  1P3I D;  1KX3 C;  3AZK D;  5BNX A;  4WNN B;  2YFV B;  1KX5 C;  4J8W B;  5B1M C;  3TU4 D;  4J8W A;  2F8N D;  3VH6 W;  5AVC C;  5GSU C;  3KXB D;  3AZK C;  3MGP C;  1AOI B;  5B24 D;  5BT1 C;  3AZG C;  3AV1 A;  3X1T C;  1P3I B;  5GSU A;  3WKJ C;  4KUD D;  5GXQ A;  1ZLA A;  4YM6 C;  4WU9 D;  3AZN B;  3AZG B;  3WA9 A;  5C3I C;  3MGP B;  4WU8 B;  3A6N C;  3MVD C;  3AZE B;  3NQJ A;  3AZE A;  4Z66 B;  3REL D;  1P34 D;  1F1E A;  3LJA D;  3AZH A;  5DNM A;  4XUJ C;  4LD9 D;  5B1L B;  1ULY A;  3REH B;  5DNM B;  3B0D B;  3X1S C;  3MGP D;  4CAY A;  1HQ3 D;  3REH A;  1KX5 B;  4J8V B;  3AZL D;  3REI B;  3UTB D;  4J8V C;  3LJA A;  3AZL C;  1R4V A;  4CSR B;  4QLC D;  5AV8 A;  3AYW A;  3AZM B;  1P3M B;  1TZY A;  3AZF C;  1P3O C;  3AN2 A;  4EO5 C;  1S32 C;  5AVB B;  4XZQ D;  4G91 C;  1KX4 C;  1JFI B;  3A6N A;  1P3K D;  4X23 B;  2L5A A;  3MNN C;  5B0Y C;  4AWL B;  2NQB B;  5G49 B;  5B32 D;  4JJN D;  3W99 C;  3UT9 B;  3AZG A;  3AV1 C;  3LZ1 C;  2ARO D;  4G91 B;  5B31 C;  3UTA A;  5B32 A;  3VH5 W;  3AFA B;  3AZK A;  1P3I A;  4Z5T A;  4H9P A;  5AV5 B;  3AZH B;  3C1B C;  3AN2 D;  3AV2 B;  4NE6 A;  1HTA A;  3MGR B;  4YS3 C;  3W98 D;  4YM6 A;  5CPJ B;  3KUY C;  3C1B D;  4QLC C;  5GT0 A;  3V9R B;  5B0Y A;  1KX4 B;  3WTP D;  1P3B B;  1KX4 A;  4QLC A;  1P3B A;  5B31 D;  3W99 A;  5B0Z A;  5AVC A;  3AZM D;  1P3F A;  2BYK B;  2NZD D;  1P3P B;  5CP6 A;  3AZL B;  5B40 B;  4JJN C;  3NQJ B;  1P3B D;  2RVQ D;  3LJA C;  3AZL A;  5F99 B;  1P3M C;  3WTP A;  5B33 A;  5AV9 B;  3REK B;  1P3O D;  3W98 A;  2BYM A;  1S32 D;  3AZE D;  3B6F C;  3WA9 D;  4X23 C;  2FJ7 C;  3KWQ D;  1TZY B;  3X1U C;  1P34 B;  3REI C;  5FUG A;  1F66 A;  5F99 C;  2HIO B;  4WU9 A;  2ARO B;  1M19 A;  1F66 B;  3A6N B;  2ARO A;  3AZE C;  1M19 B;  3B6F D;  3WTP E;  5GSU D;  2YFW B;  5AV5 A;  3TU4 A;  5JRG A;  2YFW A;  2NQB D;  3LEL C;  5JRG B;  1P34 C;  1U35 A;  4J8X C;  4J8W D;  2F8N A;  5CPJ A;  4LD9 C;  3X1V C;  4R8P B;  5B32 G;  5GT3 A;  3B0C W;  1TZY D;  4NE5 A;  5E5A C;  1P3F B;  3MNN D;  3AZI A;  4KUD C;  2PYO C;  4Z66 C;  5JA4 B;  2HIO C;  5B2I D;  5F99 A;  4J8X D;  5B33 B;  5B1L A;  5AV9 D;  4Z2M G;  3AV2 A;  3O62 A;  3AZJ A;  4CSR A;  1KX3 A;  5AV8 B;  3AYW B;  5AVB D;  2CV5 C;  1WWS A;  2BYK A;  4ZBJ B;  3REK C;  4J8X B;  5DNN D;  4KHA A;  4G92 C;  4QLC B;  3VH5 A;  3X1U D;  1P3A B;  5B1L D;  4ZUX C;  5AV9 A;  3KWQ C;  2FJ7 D;  4KGC D;  3LZ0 C;  5B2I A;  5CPI D;  1F66 C;  1M1A D;  1P3A C;  1M18 D;  1JFI A;  1P3L B;  4X23 A;  3NQU B;  4H9R B;  3MGR C;  3LEL D;  2NQB C;  3AV2 C;  3AFA A;  3UT9 C;  5AV6 D;  3B6G C;  5FUG B;  5CPK B;  2CV5 D;  3AFA D;  1P3O B;  3W96 C;  3KXB C;  5AVB C;  4X23 D;  4H9P B;  3KWQ B;  1A7W A;  3REL C;  2HIO D;  3C1C A;  4AWL C;  5DNN B;  2FJ7 A;  5B0Y B;  3LEL B;  5B40 A;  4YS3 B; 
#chains in the Genus database with same CATH topology
 5CPI C;  3X1S A;  1HQ3 B;  3IP4 C;  3AZM C;  3MGQ D;  5B0Z B;  3X1V D;  1ID3 B;  5B33 D;  4J8W C;  3UTB B;  5CPI B;  4CAY B;  1KX5 A;  2Y2O A;  5B31 B;  3LZ1 A;  1EQZ B;  5JA4 A;  5B2J B;  2NZD A;  5E5A B;  1P3F C;  3WTP B;  4J8X A;  5AVC D;  2NZD B;  4H9R A;  3VH6 T;  1TAF B;  1T3U A;  1EQZ C;  5F99 D;  3AZN C;  4H9S C;  2YFV A;  2FFF B;  3MGS B;  5GT0 D;  4LD9 B;  3AZI D;  5GT3 D;  3AZN D;  1H3O B;  1TZY C;  3AZF A;  5B1M B;  3AZF B;  3MGQ B;  3B6G D;  3EPH A;  4Z5T D;  5GSU B;  3B0C T;  1BH8 B;  1M19 C;  2RVQ C;  5BO0 B;  3UTA D;  5JRG D;  2NQB A;  1Q9C A;  3KFU G;  4XUJ D;  1U35 D;  2FJ7 B;  5JRG C;  4WU8 A;  5AV5 D;  3F6T A;  2NZD C;  1M19 D;  5B32 B;  1F66 D;  1M1A B;  4XUJ B;  4HGA B;  3KWQ A;  4DRB A;  3LZ0 A;  1S32 A;  1P3G C;  5CPI A;  2Y2Q A;  3VH6 A;  5B2J D;  1P3O A;  3MGR A;  1EQZ D;  3B6G B;  3WA9 C;  5KDM B;  2W8S A;  4YS3 A;  1P3L C;  4J8U C;  3REJ B;  5CP6 D;  3W96 D;  3W99 B;  2Y2K A;  4NE3 A;  3AZM A;  4J8U A;  1P3F D;  3UTB A;  1M18 B;  4G92 B;  5B31 A;  3LZ1 B;  5BS7 A;  3W97 A;  5AY8 A;  1HQ3 A;  2ZY2 A;  4M6B A;  5E5A D;  3W99 D;  4H9S A;  2CWE A;  3AZH D;  3WAA D;  1KX4 D;  5GT3 C;  4J8V A;  5B0Y D;  1M18 C;  3W98 B;  3REI A;  4E45 A;  1P3K C;  1EQZ A;  3EG5 B;  5B2J A;  3R45 A;  3NQU A;  2LY8 A;  3LZ0 D;  1PZR A;  4Z2M H;  5B2J C;  5GXQ D;  1AOI D;  4WU9 B;  3TU4 C;  3H0M C;  5CPJ D;  5B1M D;  2JE5 A;  4WNN A;  4NFT A;  3VH5 T;  2ARO C;  4WU8 D;  1BH9 A;  3AFA C;  4JJN A;  3LZ0 B;  3KXB A;  5B31 G;  2Y2H A;  1S32 B;  1H3O A;  1HQ3 C;  5B1M A;  1U35 B;  2F8N B;  3V9R A;  1WWI A;  4H9Q A;  2G5I C;  3A6N D;  1P3K A;  3B6F B;  1ID3 A;  1KU5 A;  2XD5 A;  2XD1 A;  1P3M D;  5CHL B;  3WAA C;  2Y2J A;  4DRA A;  5E5A A;  2ZM5 A;  5AV8 D;  3AYW D;  5CPK C;  2PYO A;  3WAA A;  2JCH A;  2PYO B;  2Y2I A;  5B24 C;  3REJ A;  2F8N H;  5AY8 D;  3W97 D;  1KX3 B;  4YM6 B;  3WKJ D;  5B0Z D;  2UWX A;  3WTP C;  5CPJ C;  4LD9 A;  3X1U B;  5DNM D;  4H9O B;  1KX5 D;  4J8U D;  1P34 A;  4H9O A;  1TAF A;  4YS3 D;  3W98 C;  3W96 A;  2F8N K;  3MGQ A;  5AY8 C;  3C1B A;  3W97 C;  3MGR D;  3REL A;  5AVC B;  1P3M A;  4WV4 B;  1ID3 C;  1ZLA D;  4JJN B;  5B40 C;  1N1J B;  3C1C D;  3KXB B;  2IO5 C;  5C3I B;  1P3L A;  3AV1 D;  2Y2G A;  3P5J B;  4UUZ B;  5BO0 A;  2HUE B;  1P3G B;  3AZG D;  4XUJ A;  5B24 B;  2F2A C;  3O62 C;  3AZJ C;  5B24 A;  3R45 B;  3REJ C;  4KUD B;  3AZI B;  3UTA B;  5CP6 C;  1AOI A;  3B6G A;  5KDM A;  4XZQ A;  3AZF D;  2HUE C;  5BNV A;  3B0B A;  3O62 B;  3KUY D;  5AV8 C;  3MVD A;  3REI D;  4HGA C;  3AYW C;  3AZN A;  3AZJ B;  5CPK D;  2CV5 B;  4J8V D;  1M18 A;  4KGC B;  3WA9 B;  3H0L C;  3AV1 B;  4KHA B;  3REH C;  4ZBJ C;  4Z66 A;  5B1L C;  4ZUX D;  3REH D;  3AZH C;  3MGP A;  5B33 C;  5AY8 B;  3W97 B;  3MGQ C;  5B32 C;  3X1V B;  4H9N B;  3WAA B;  4WU8 C;  3REK A;  1ZLA B;  3X1V A;  4H9N A;  5B40 D;  2F8N G;  3REL B;  1P3G A;  5GXQ C;  1BH9 B;  3X1T D;  3MGS A;  5B2I C;  3MNN A;  2HIO A;  1P3P C;  3MNN B;  4KUD A;  4EO5 B;  5CPK A;  3KUY A;  3AN2 C;  1B6W A;  3MGS C;  1P3A A;  5DNM C;  5B0Z C;  5B2I B;  4H9Q B;  2Y2L A;  3TU4 B;  4UUZ A;  1P3B C;  3UTB C;  5GXQ B;  1W2E A;  3AN2 B;  1BFM A;  4R8P C;  3A1K A;  3EPL A;  5AV6 A;  2CV5 A;  3MVD B;  3UT9 A;  3UT9 D;  4R8P A;  3LEL A;  1ZLA C;  1U35 C;  5GT3 B;  3B0D C;  3X1S B;  3AZK B;  4XZQ B;  3KSY A;  5BNX B;  1P3K B;  3B6F A;  3MGS D;  3X1T A;  1P3A D;  1M1A A;  4Z5T B;  1P3L D;  3X1T B;  1P3P D;  2ZY5 A;  4KGC A;  4WU9 C;  1B67 A;  3X1U A;  1P3G D;  5GT0 B;  4WJ3 C;  3AZI C;  2Y2M A;  5BNV B;  5DNN C;  3REK D;  5BT1 D;  3LZ1 D;  3AL0 C;  3C1C B;  5DNN A;  4E44 A;  5AV5 C;  4J8U B;  3AV2 D;  4ZUX B;  5AV6 C;  1AOI C;  3WKJ A;  4ZUX A;  5AV9 C;  5AVB A;  1P3I C;  3X1S D;  3REJ D;  2ZY3 A;  1KX3 D;  3WKJ B;  3W96 B;  3O62 D;  3LJA B;  3KUY B;  3C1B B;  4DQY B;  3UTA C;  5BS7 C;  3AZJ D;  4Z66 D;  1M1A C;  4XZQ C;  2PYO D;  1BH8 A;  4Z5T C;  3C1C C;  1P3P A;  3MVD D;  2JSS A;  5CP6 B;  1N1J A;  4YM6 D;  5AV6 B;  4KGC C;  1ID3 D;  2J8P A;  5GT0 C;  2IO5 B;  4R8P D;  2BYM B;  5G49 A;  4WZS B;  1P3I D;  1KX3 C;  3AZK D;  5BNX A;  4WNN B;  2YFV B;  1KX5 C;  4J8W B;  5B1M C;  3TU4 D;  4J8W A;  2F8N D;  3VH6 W;  5AVC C;  5GSU C;  3KXB D;  3AZK C;  3MGP C;  1AOI B;  5B24 D;  5BT1 C;  3AZG C;  3AV1 A;  3X1T C;  3H0R C;  5GSU A;  1P3I B;  3WKJ C;  4KUD D;  5GXQ A;  1ZLA A;  4YM6 C;  4WU9 D;  3AZN B;  3AZG B;  3WA9 A;  5C3I C;  3MGP B;  4WU8 B;  3A6N C;  3MVD C;  3AZE B;  3NQJ A;  2RIQ A;  3AZE A;  4Z66 B;  3REL D;  1P34 D;  1F1E A;  3LJA D;  2G5H C;  5DNM A;  4XUJ C;  3AZH A;  4LD9 D;  5B1L B;  1ULY A;  3REH B;  5DNM B;  3B0D B;  3X1S C;  3MGP D;  4CAY A;  1HQ3 D;  3REH A;  1KX5 B;  4J8V B;  3AZL D;  3REI B;  3UTB D;  4J8V C;  3LJA A;  3AZL C;  1R4V A;  4CSR B;  4QLC D;  5AV8 A;  3AYW A;  3AZM B;  1P3M B;  1TZY A;  3AZF C;  1P3O C;  3AN2 A;  4EO5 C;  2DF4 C;  1S32 C;  5AVB B;  3A1I A;  3EPJ A;  4XZQ D;  4G91 C;  1KX4 C;  1JFI B;  3A6N A;  1P3K D;  4X23 B;  2L5A A;  3MNN C;  5B0Y C;  2BG1 A;  4AWL B;  2NQB B;  5G49 B;  5B32 D;  4JJN D;  3W99 C;  3UT9 B;  3AZG A;  3AV1 C;  2Y2N A;  3LZ1 C;  2ARO D;  4G91 B;  5B31 C;  3UTA A;  5B32 A;  3VH5 W;  3AFA B;  3AZK A;  1P3I A;  4Z5T A;  4H9P A;  5AV5 B;  3AZH B;  3C1B C;  3AN2 D;  3AV2 B;  4NE6 A;  1HTA A;  3MGR B;  4YS3 C;  3W98 D;  4YM6 A;  5CPJ B;  3KUY C;  3C1B D;  4QLC C;  5GT0 A;  3V9R B;  5B0Y A;  1KX4 B;  3WTP D;  2Y2P A;  1P3B B;  1KX4 A;  4QLC A;  1P3B A;  5B31 D;  3W99 A;  5B0Z A;  5AVC A;  2ZY4 A;  3AZM D;  1P3F A;  2BYK B;  2NZD D;  1P3P B;  5CP6 A;  3AZL B;  5B40 B;  4JJN C;  3NQJ B;  1P3B D;  2RVQ D;  3LJA C;  3AZL A;  5F99 B;  1P3M C;  3WTP A;  5B33 A;  5AV9 B;  3REK B;  1P3O D;  3W98 A;  2BYM A;  1S32 D;  3AZE D;  3B6F C;  3WA9 D;  4X23 C;  2FJ7 C;  3KWQ D;  1TZY B;  3X1U C;  1P34 B;  3REI C;  5FUG A;  1F66 A;  5F99 C;  2HIO B;  4WU9 A;  2ARO B;  1M19 A;  1F66 B;  3A6N B;  2ARO A;  3AZE C;  1M19 B;  3B6F D;  3WTP E;  5GSU D;  2YFW B;  5AV5 A;  3TU4 A;  5JRG A;  2YFW A;  2NQB D;  3LEL C;  5JRG B;  1P34 C;  1U35 A;  4J8X C;  4J8W D;  2F8N A;  5CPJ A;  4LD9 C;  3X1V C;  4R8P B;  5B32 G;  2VQR A;  5GT3 A;  3B0C W;  1TZY D;  4NE5 A;  5E5A C;  1P3F B;  3MNN D;  3AZI A;  4KUD C;  2PYO C;  4Z66 C;  5JA4 B;  2HIO C;  5B2I D;  5F99 A;  4J8X D;  5B33 B;  5B1L A;  5AV9 D;  4Z2M G;  3AV2 A;  3O62 A;  3AZJ A;  4CSR A;  1KX3 A;  5AV8 B;  3AYW B;  5AVB D;  2CV5 C;  1Z2C B;  1WWS A;  2BYK A;  4ZBJ B;  3REK C;  3FDD A;  5DNN D;  4J8X B;  4KHA A;  4G92 C;  4QLC B;  3VH5 A;  3X1U D;  1P3A B;  5B1L D;  4ZUX C;  5AV9 A;  3KWQ C;  2FJ7 D;  4KGC D;  3LZ0 C;  5B2I A;  5CPI D;  1F66 C;  1M1A D;  1P3A C;  1M18 D;  1JFI A;  1P3L B;  4X23 A;  3NQU B;  4H9R B;  3MGR C;  3LEL D;  2NQB C;  3AV2 C;  3AFA A;  3UT9 C;  5AV6 D;  3B6G C;  5FUG B;  5CPK B;  2CV5 D;  3AFA D;  1P3O B;  3W96 C;  3KXB C;  5AVB C;  4X23 D;  4H9P B;  3KWQ B;  3EPK A;  1A7W A;  3REL C;  4UPK A;  2DQN C;  2HIO D;  3C1C A;  4AWL C;  5DNN B;  2FJ7 A;  5B0Y B;  3LEL B;  5B40 A;  4YS3 B; 
#chains in the Genus database with same CATH homology
 5CPI C;  3X1S A;  1HQ3 B;  3IP4 C;  3AZM C;  3MGQ D;  5B0Z B;  3X1V D;  1ID3 B;  5B33 D;  4J8W C;  3UTB B;  5CPI B;  4CAY B;  1KX5 A;  2Y2O A;  5B31 B;  3LZ1 A;  1EQZ B;  5JA4 A;  5B2J B;  2NZD A;  5E5A B;  1P3F C;  3WTP B;  4J8X A;  5AVC D;  2NZD B;  4H9R A;  3VH6 T;  1TAF B;  1T3U A;  1EQZ C;  5F99 D;  3AZN C;  4H9S C;  2YFV A;  2FFF B;  3MGS B;  5GT0 D;  4LD9 B;  3AZI D;  5GT3 D;  3AZN D;  1H3O B;  1TZY C;  3AZF A;  5B1M B;  3AZF B;  3MGQ B;  3B6G D;  3EPH A;  4Z5T D;  5GSU B;  3B0C T;  1BH8 B;  1M19 C;  2RVQ C;  5BO0 B;  3UTA D;  5JRG D;  2NQB A;  1Q9C A;  3KFU G;  4XUJ D;  1U35 D;  2FJ7 B;  5JRG C;  4WU8 A;  5AV5 D;  3F6T A;  2NZD C;  1M19 D;  5B32 B;  1F66 D;  1M1A B;  4XUJ B;  4HGA B;  3KWQ A;  4DRB A;  3LZ0 A;  1S32 A;  1P3G C;  5CPI A;  2Y2Q A;  3VH6 A;  5B2J D;  1P3O A;  3MGR A;  1EQZ D;  3B6G B;  3WA9 C;  5KDM B;  2W8S A;  4YS3 A;  1P3L C;  4J8U C;  3REJ B;  5CP6 D;  3W96 D;  3W99 B;  2Y2K A;  4NE3 A;  3AZM A;  4J8U A;  1P3F D;  3UTB A;  1M18 B;  4G92 B;  5B31 A;  3LZ1 B;  5BS7 A;  3W97 A;  5AY8 A;  1HQ3 A;  2ZY2 A;  4M6B A;  5E5A D;  3W99 D;  4H9S A;  2CWE A;  3AZH D;  3WAA D;  1KX4 D;  5GT3 C;  4J8V A;  5B0Y D;  1M18 C;  3W98 B;  3REI A;  4E45 A;  1P3K C;  1EQZ A;  3EG5 B;  5B2J A;  3R45 A;  3NQU A;  2LY8 A;  3LZ0 D;  1PZR A;  4Z2M H;  5B2J C;  5GXQ D;  1AOI D;  4WU9 B;  3TU4 C;  3H0M C;  5CPJ D;  5B1M D;  2JE5 A;  4WNN A;  4NFT A;  3VH5 T;  2ARO C;  4WU8 D;  1BH9 A;  3AFA C;  4JJN A;  3LZ0 B;  3KXB A;  5B31 G;  2Y2H A;  1S32 B;  1H3O A;  1HQ3 C;  5B1M A;  1U35 B;  2F8N B;  3V9R A;  1WWI A;  4H9Q A;  2G5I C;  3A6N D;  1P3K A;  3B6F B;  1ID3 A;  1KU5 A;  2XD5 A;  2XD1 A;  1P3M D;  5CHL B;  3WAA C;  2Y2J A;  4DRA A;  5E5A A;  2ZM5 A;  5AV8 D;  3AYW D;  5CPK C;  2PYO A;  3WAA A;  2JCH A;  2PYO B;  2Y2I A;  5B24 C;  3REJ A;  2F8N H;  5AY8 D;  3W97 D;  1KX3 B;  4YM6 B;  3WKJ D;  5B0Z D;  2UWX A;  3WTP C;  5CPJ C;  4LD9 A;  3X1U B;  5DNM D;  4H9O B;  1KX5 D;  4J8U D;  1P34 A;  4H9O A;  1TAF A;  4YS3 D;  3W98 C;  3W96 A;  2F8N K;  3MGQ A;  5AY8 C;  3C1B A;  3W97 C;  3MGR D;  3REL A;  5AVC B;  1P3M A;  4WV4 B;  1ID3 C;  1ZLA D;  4JJN B;  5B40 C;  1N1J B;  3C1C D;  3KXB B;  2IO5 C;  5C3I B;  1P3L A;  3AV1 D;  2Y2G A;  3P5J B;  4UUZ B;  5BO0 A;  2HUE B;  1P3G B;  3AZG D;  4XUJ A;  5B24 B;  2F2A C;  3O62 C;  3AZJ C;  5B24 A;  3R45 B;  3REJ C;  4KUD B;  3AZI B;  3UTA B;  5CP6 C;  1AOI A;  3B6G A;  5KDM A;  4XZQ A;  3AZF D;  2HUE C;  5BNV A;  3B0B A;  3O62 B;  3KUY D;  5AV8 C;  3MVD A;  3REI D;  4HGA C;  3AYW C;  3AZN A;  3AZJ B;  5CPK D;  2CV5 B;  4J8V D;  1M18 A;  4KGC B;  3WA9 B;  3H0L C;  3AV1 B;  4KHA B;  3REH C;  4ZBJ C;  4Z66 A;  5B1L C;  4ZUX D;  3REH D;  3AZH C;  3MGP A;  5B33 C;  5AY8 B;  3W97 B;  3MGQ C;  5B32 C;  3X1V B;  4H9N B;  3WAA B;  4WU8 C;  3REK A;  1ZLA B;  3X1V A;  4H9N A;  5B40 D;  2F8N G;  3REL B;  1P3G A;  5GXQ C;  1BH9 B;  3X1T D;  3MGS A;  5B2I C;  3MNN A;  2HIO A;  1P3P C;  3MNN B;  4KUD A;  4EO5 B;  5CPK A;  3KUY A;  3AN2 C;  1B6W A;  3MGS C;  1P3A A;  5DNM C;  5B0Z C;  5B2I B;  4H9Q B;  2Y2L A;  3TU4 B;  4UUZ A;  1P3B C;  3UTB C;  5GXQ B;  1W2E A;  3AN2 B;  1BFM A;  4R8P C;  3A1K A;  3EPL A;  5AV6 A;  2CV5 A;  3MVD B;  3UT9 A;  3UT9 D;  4R8P A;  3LEL A;  1ZLA C;  1U35 C;  5GT3 B;  3B0D C;  3X1S B;  3AZK B;  4XZQ B;  3KSY A;  5BNX B;  1P3K B;  3B6F A;  3MGS D;  3X1T A;  1P3A D;  1M1A A;  4Z5T B;  1P3L D;  3X1T B;  1P3P D;  2ZY5 A;  4KGC A;  4WU9 C;  1B67 A;  3X1U A;  1P3G D;  5GT0 B;  4WJ3 C;  3AZI C;  2Y2M A;  5BNV B;  5DNN C;  3REK D;  5BT1 D;  3LZ1 D;  3AL0 C;  3C1C B;  5DNN A;  4E44 A;  5AV5 C;  4J8U B;  3AV2 D;  4ZUX B;  5AV6 C;  1AOI C;  3WKJ A;  4ZUX A;  5AV9 C;  5AVB A;  1P3I C;  3X1S D;  3REJ D;  2ZY3 A;  1KX3 D;  3WKJ B;  3W96 B;  3O62 D;  3LJA B;  3KUY B;  3C1B B;  4DQY B;  3UTA C;  5BS7 C;  3AZJ D;  4Z66 D;  1M1A C;  4XZQ C;  2PYO D;  1BH8 A;  4Z5T C;  3C1C C;  1P3P A;  3MVD D;  2JSS A;  5CP6 B;  1N1J A;  4YM6 D;  5AV6 B;  4KGC C;  1ID3 D;  2J8P A;  5GT0 C;  2IO5 B;  4R8P D;  2BYM B;  5G49 A;  4WZS B;  1P3I D;  1KX3 C;  3AZK D;  5BNX A;  4WNN B;  2YFV B;  1KX5 C;  4J8W B;  5B1M C;  3TU4 D;  4J8W A;  2F8N D;  3VH6 W;  5AVC C;  5GSU C;  3KXB D;  3AZK C;  3MGP C;  1AOI B;  5B24 D;  5BT1 C;  3AZG C;  3AV1 A;  3X1T C;  3H0R C;  5GSU A;  1P3I B;  3WKJ C;  4KUD D;  5GXQ A;  1ZLA A;  4YM6 C;  4WU9 D;  3AZN B;  3AZG B;  3WA9 A;  5C3I C;  3MGP B;  4WU8 B;  3A6N C;  3MVD C;  3AZE B;  3NQJ A;  2RIQ A;  3AZE A;  4Z66 B;  3REL D;  1P34 D;  1F1E A;  3LJA D;  2G5H C;  5DNM A;  4XUJ C;  3AZH A;  4LD9 D;  5B1L B;  1ULY A;  3REH B;  5DNM B;  3B0D B;  3X1S C;  3MGP D;  4CAY A;  1HQ3 D;  3REH A;  1KX5 B;  4J8V B;  3AZL D;  3REI B;  3UTB D;  4J8V C;  3LJA A;  3AZL C;  1R4V A;  4CSR B;  4QLC D;  5AV8 A;  3AYW A;  3AZM B;  1P3M B;  1TZY A;  3AZF C;  1P3O C;  3AN2 A;  4EO5 C;  2DF4 C;  1S32 C;  5AVB B;  3A1I A;  3EPJ A;  4XZQ D;  4G91 C;  1KX4 C;  1JFI B;  3A6N A;  1P3K D;  4X23 B;  2L5A A;  3MNN C;  5B0Y C;  2BG1 A;  4AWL B;  2NQB B;  5G49 B;  5B32 D;  4JJN D;  3W99 C;  3UT9 B;  3AZG A;  3AV1 C;  2Y2N A;  3LZ1 C;  2ARO D;  4G91 B;  5B31 C;  3UTA A;  5B32 A;  3VH5 W;  3AFA B;  3AZK A;  1P3I A;  4Z5T A;  4H9P A;  5AV5 B;  3AZH B;  3C1B C;  3AN2 D;  3AV2 B;  4NE6 A;  1HTA A;  3MGR B;  4YS3 C;  3W98 D;  4YM6 A;  5CPJ B;  3KUY C;  3C1B D;  4QLC C;  5GT0 A;  3V9R B;  5B0Y A;  1KX4 B;  3WTP D;  2Y2P A;  1P3B B;  1KX4 A;  4QLC A;  1P3B A;  5B31 D;  3W99 A;  5B0Z A;  5AVC A;  2ZY4 A;  3AZM D;  1P3F A;  2BYK B;  2NZD D;  1P3P B;  5CP6 A;  3AZL B;  5B40 B;  4JJN C;  3NQJ B;  1P3B D;  2RVQ D;  3LJA C;  3AZL A;  5F99 B;  1P3M C;  3WTP A;  5B33 A;  5AV9 B;  3REK B;  1P3O D;  3W98 A;  2BYM A;  1S32 D;  3AZE D;  3B6F C;  3WA9 D;  4X23 C;  2FJ7 C;  3KWQ D;  1TZY B;  3X1U C;  1P34 B;  3REI C;  5FUG A;  1F66 A;  5F99 C;  2HIO B;  4WU9 A;  2ARO B;  1M19 A;  1F66 B;  3A6N B;  2ARO A;  3AZE C;  1M19 B;  3B6F D;  3WTP E;  5GSU D;  2YFW B;  5AV5 A;  3TU4 A;  5JRG A;  2YFW A;  2NQB D;  3LEL C;  5JRG B;  1P34 C;  1U35 A;  4J8X C;  4J8W D;  2F8N A;  5CPJ A;  4LD9 C;  3X1V C;  4R8P B;  5B32 G;  2VQR A;  5GT3 A;  3B0C W;  1TZY D;  4NE5 A;  5E5A C;  1P3F B;  3MNN D;  3AZI A;  4KUD C;  2PYO C;  4Z66 C;  5JA4 B;  2HIO C;  5B2I D;  5F99 A;  4J8X D;  5B33 B;  5B1L A;  5AV9 D;  4Z2M G;  3AV2 A;  3O62 A;  3AZJ A;  4CSR A;  1KX3 A;  5AV8 B;  3AYW B;  5AVB D;  2CV5 C;  1Z2C B;  1WWS A;  2BYK A;  4ZBJ B;  3REK C;  3FDD A;  5DNN D;  4J8X B;  4KHA A;  4G92 C;  4QLC B;  3VH5 A;  3X1U D;  1P3A B;  5B1L D;  4ZUX C;  5AV9 A;  3KWQ C;  2FJ7 D;  4KGC D;  3LZ0 C;  5B2I A;  5CPI D;  1F66 C;  1M1A D;  1P3A C;  1M18 D;  1JFI A;  1P3L B;  4X23 A;  3NQU B;  4H9R B;  3MGR C;  3LEL D;  2NQB C;  3AV2 C;  3AFA A;  3UT9 C;  5AV6 D;  3B6G C;  5FUG B;  5CPK B;  2CV5 D;  3AFA D;  1P3O B;  3W96 C;  3KXB C;  5AVB C;  4X23 D;  4H9P B;  3KWQ B;  3EPK A;  1A7W A;  3REL C;  4UPK A;  2DQN C;  2HIO D;  3C1C A;  4AWL C;  5DNN B;  2FJ7 A;  5B0Y B;  3LEL B;  5B40 A;  4YS3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...