2F8ND

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nD00
2NQBD 3TU4D 4YS3D 3REIC 2NZDB 5AV6A 1P3AB 4WZSB 5B32D 1JFIA 1P3OD 3MVDA 4JJNC 3WAAD 3AN2B 5C3IB 3AYWD 3AZMD 3X1SD 3MGRD 1WWIA 1P3GC 3WKJC 3UTBD 1BH9B 5AVBC 1P3BB 3LZ0A 3AZIA 1HQ3B 5BS7A 5F99B 4J8VC 4XUJD 5KDMB 1N1JA 3AFAD 5AV9C 3C1CD 4Z66B 1EQZB 5B2IC 4WU8D 5AV5A 4XZQD 5JA4B 3KWQD 4EO5C 1BH8B 1P3FA 3A6NA 4LD9D 1M19C 1U35D 3WA9D 3AZED 1ZLAD 5AY8D 1M18D 3MGSB 4J8UD 4KHAA 3W99D 2CV5C 1AOIB 3MNNC 4J8XD 3W97A 1P3PA 1ID3D 3B0BA 4X23C 3W98C 5AV8D 2NQBC 3TU4C 3KUYB 1KX4A 3LJAA 4YS3C 3VH5T 5CPIC 4H9RB 5AV6D 1KX3C 3UT9A 3C1BD 1B67A 4ZBJC 5B1MC 5BNXA 3X1VC 5B0ZB 1S32B 3B0DB 4JJNA 3AZLB 4WU9C 1P3GB 3KXBC 5AVBB 2HUEB 3R45A 3LZ1D 4J8VB 3W96D 1M1AA 2F8NG 3AZKA 3X1TC 4CSRB 5AV9B 3LZ0D 3AZGB 3AZID 1P3IC 5B2IB 5CP6A 3V9RB 5B40A 4ZUXC 5GSUB 3B6FB 1P3LA 5CPKA 1TZYC 5AV5D 2YFWA 5DNMC 5B24C 5B1LC 5GT3B 5JRGC 1M19B 2PYOC 3REHB 4Z2MG 2NZDC 1P3FD 3A6ND 1P3MC 2CV5B 3MNNB 3AV2C 3WA9C 3UTAC 3AV1A 3B6GA 5BO0B 5GXQB 4G91C 4H9NB 2NQBB 3TU4B 5GT0A 3AN2C 4YS3B 4X23A 3W97D 3W98A 1P3PD 5B32B 4NE5A 4WNNA 5B1MB 1KX4D 3LJAD 4CAYB 3VH5W 4E44A 1KX3A 3X1VA 5F99C 3UT9D 3C1BC 4KUDA 3KXBB 3AYWB 3AZJD 1B6WA 3AZHA 4YM6A 3B0CT 3MGPC 4DRAA 3UTBB 1EQZC 3X1TB 4QLCA 3AZFA 4XUJB 1M1AD 3AZKD 3RELA 4ZUXB 3REKA 1KX5D 5BT1D 4KGCD 1P3IA 2F8NK 5CP6D 5BNVB 4WU8B 3MGSC 5B40D 5B2JA 5JRGB 1P3LD 2PYOB 1AOIC 5CPKD 1TZYA 4J8WA 3KWQB 5B24A 5B1LA 5CPJA 1P3MB 3AV2B 3X1UA 1U35B 3WA9B 3KUYC 3UTAB 1ZLAB 4H9QB 5AY8B 5E5AC 1P3AA 1M18B 4H9OB 4G91B 1P34A 5B33C 5B0YC 1P3KC 3B6GD 5B0ZC 1S32C 5DNND 4NFTA 3LELC 1ID3B 3B0DC 5AV8B 3AN2A 3AZLC 5GT0D 5AVCA 5DNMB 2HIOC 2HUEC 5B31A 3C1BB 1P3BA 1HQ3A 5F99A 4NE3A 3AZGC 3AZNA 3MGPB 2RVQC 4Z5TC 3NQJB 2LY8A 5GSUC 3LZ1B 3B6FC 3AZHD 4Z66A 1F66D 3B0CW 4YM6D 3W96B 3O62D 4R8PD 4QLCD 4H9SA 5GT3C 3AZFD 3WTPD 3REHC 3REJD 1Q9CA 1BH8A 3RELD 2AROA 3MGQD 3MGSA 2FJ7C 5GXQC 5AV5B 1BFMA 5B2JD 3REIA 1H3OB 5E5AB 4J8WD 5CPJD 1P3FB 1F1EA 5B33B 5B32C 3KUYA 5B0YB 3X1UD 1P3KB 4H9RA 1P3AD 3LELB 1P34D 4KHAB 1P3OC 3WAAC 3MVDD 1S32A 5B32G 2BYMB 3AYWC 2HIOB 3AZMC 5DNNC 5CHLB 3MGRC 3X1SC 1P3GA 3WKJA 3UTBC 1KX4B 5AVBA 5AVCD 1R4VA 4J8VA 5B31D 4XUJC 4CSRA 4Z5TB 3AFAC 5AV9A 3AZJB 1P3BD 1HQ3D 3C1CC 5G49B 5B2IA 3AZND 3V9RA 4WU8C 5GSUA 3B6FA 3R45B 4Z66D 4XZQC 4UUZB 3KWQC 5GT3A 4NE6A 1M19A 1KX5B 4KGCB 3REHA 4LD9C 2BYKA 1U35C 3AZEC 1ZLAC 4H9PB 5AY8C 1M18C 2FJ7B 2AROD 2CV5A 5B40B 4J8UC 3MNNA 3W99C 1P3LB 5BO0A 5GXQA 4J8XC 1TAFB 1ID3C 2NQBA 3TU4A 5AV8C 4YS3A 3REID 5CPIA 5B32A 5AV6C 1P3OB 5B1MA 3WAAB 4CAYA 3B6GB 3AZMB 5DNNB 2F8NA 3X1SB 5AV8A 3MGRB 4JJND 4WU9A 3KXBA 5GT0B 3LZ1C 1P3GD 3WKJD 3W96C 4WNNB 3X1TA 3AFAB 5AVBD 2F8NH 2IO5B 4DRBA 3C1CB 4J8VD 3LZ0C 3VH6A 3AZIC 5BS7C 4ZUXA 5AV9D 3NQUB 1F66B 4XZQB 5B2ID 5BNVA 3O62B 4R8PB 5DNMA 5JRGA 5AV5C 2PYOA 4LD9B 3WTPB 3REJB 3AZEB 2NZDA 4Z2MH 3RELB 1P3MA 4J8UB 3AV2A 3MGQB 1P3FC 3A6NC 3WA9A 3W99B 5FUGB 3UTAA 5AY8A 4J8XB 3AV1D 2YFVB 2CV5D 3MNND 5B2JB 1ID3A 4X23D 3W97C 3W98D 5AV6B 5CPJB 1P3PC 3X1UB 5CPID 1BH9A 1KX4C 3LJAC 1JFIB 1KX3D 1P34B 3C1BA 1KU5A 1HTAA 5KDMA 5B1MD 3X1VD 3MVDB 3UT9C 4KUDD 4HGAC 3AZJC 2F8ND 3MGPA 4WU9D 1EQZA 3KXBD 3NQJA 5AVCB 3LZ1A 3W96A 3LZ0B 3AZIB 5JA4A 5B31B 3X1TD 1M1AC 1N1JB 3AZKC 3REKD 1KX5C 5BT1C 4KGCC 1P3ID 3AZNB 4E45A 5CP6C 4ZUXD 5B40C 1AOIA 1P3LC 5CPKC 1TZYD 5DNMD 5B24D 5B1LD 5JRGD 2PYOD 3A6NB 1H3OA 5E5AA 4G92B 2NZDD 5B33A 2AROB 1P3MD 5B0YA 3AV2D 3UTAD 1P3KA 5B0ZA 3LELA 3AV1C 3B6GC 3W97B 1P3PB 3VH6T 3AZLA 3AN2D 2BYMA 3REIB 2HIOA 5GT0C 3LJAB 4AWLC 3UT9B 4HGAB 5BNXB 2IO5C 3AZGA 5F99D 4M6BA 4JJNB 3WTPE 4Z5TA 4KUDC 3AZJA 5G49A 3MGPD 3WKJB 3AZHC 1F66C 4YM6C 1EQZD 1M1AB 3O62C 4R8PC 3AZKB 4QLCC 3AZFC 3WTPC 4UUZA 3REJC 5CP6B 1KX5A 3RELC 4KGCA 3REKC 3MGQC 5CPKB 4H9PA 2FJ7A 3MGSD 4H9NA 2YFWB 1AOID 5B2JC 1TAFA 4EO5B 4J8WC 5CPJC 3KUYD 2BYKB 5E5AD 3X1UC 3AV1B 1P3AC 5B33D 1P3OA 2JSSA 2L5AA 5B0YD 1P34C 3WAAA 3MVDC 3AYWA 5B0ZD 3AZMA 5DNNA 1S32D 1P3KD 3X1SA 3LELD 4X23B 3MGRA 3W98B 4AWLB 3VH6W 3AZLD 3UTBA 5C3IC 5CPIB 2HIOD 5AVCC 1ULYA 1WWSA 1KX3B 4XUJA 4ZBJB 3X1VB 5B31C 3AFAA 4KUDB 3C1CA 1P3BC 2F8NB 3AZGD 1HQ3C 4WU9B 2RVQD 3AZHB 4YM6B 3AZNC 4WU8A 4Z5TD 3VH5A 5B31G 5GSUD 3NQUA 2CWEA 4QLCB 3B6FD 1F66A 4XZQA 3AZFB 3O62A 4Z66C 4R8PA 3KWQA 1A7WA 5GT3D 4LD9A 3REKB 3WTPA 1M19D 4H9SC 3REHD 3REJA 4WV4B 3AZEA 1U35A 4H9QA 1P3IB 4G92C 1M18A 1ZLAA 4H9OA 4J8UA 3MGQA 3W99A 2AROC 3KSYA 5FUGA 4J8XA 1TZYB 2FJ7D 2YFVA 4J8WB 5GXQD 5B24B 5B1LB
chains in the Genus database with same CATH superfamily
2NQBD 3TU4D 4YS3D 3REIC 3A1KA 2NZDB 5AV6A 1P3AB 4WZSB 2W8SA 5B32D 1JFIA 1P3OD 3MVDA 4JJNC 3WAAD 3AN2B 5C3IB 3AYWD 3AZMD 3X1SD 3MGRD 1WWIA 1P3GC 3WKJC 3UTBD 3FDDA 1BH9B 5AVBC 2ZY2A 1P3BB 3LZ0A 3AZIA 1HQ3B 5BS7A 5F99B 4J8VC 4XUJD 5KDMB 1N1JA 3AFAD 3H0RC 5AV9C 3C1CD 2ZY3A 4Z66B 1EQZB 5B2IC 4WU8D 5AV5A 4XZQD 2Y2PA 5JA4B 3KWQD 4EO5C 1BH8B 1P3FA 3A6NA 4LD9D 1M19C 2J8PA 1U35D 3WA9D 3AZED 1ZLAD 5AY8D 1M18D 3MGSB 4J8UD 4KHAA 3W99D 2CV5C 1AOIB 3MNNC 4J8XD 3W97A 2Y2JA 1P3PA 1ID3D 3B0BA 4X23C 3W98C 5AV8D 2NQBC 3TU4C 3KUYB 1KX4A 3LJAA 4YS3C 3VH5T 5CPIC 4H9RB 5AV6D 1KX3C 3UT9A 3C1BD 1B67A 4ZBJC 5B1MC 5BNXA 3X1VC 5B0ZB 1S32B 2BG1A 3B0DB 4JJNA 3AZLB 4WU9C 1P3GB 3KXBC 2Y2MA 5AVBB 2HUEB 3R45A 3LZ1D 4J8VB 3W96D 1M1AA 2F8NG 3AZKA 3X1TC 4CSRB 5AV9B 2DF4C 3LZ0D 3AZGB 3AZID 1P3IC 5B2IB 5CP6A 3V9RB 2DQNC 5B40A 4ZUXC 2Y2QA 5GSUB 3B6FB 1P3LA 5CPKA 1TZYC 5AV5D 2YFWA 5DNMC 5B24C 5B1LC 5GT3B 5JRGC 1M19B 2PYOC 3REHB 4Z2MG 2NZDC 1P3FD 3A6ND 1P3MC 2CV5B 3MNNB 3AV2C 3WA9C 3EPHA 3UTAC 3AV1A 3B6GA 5BO0B 5GXQB 4G91C 4H9NB 2NQBB 3TU4B 5GT0A 3AN2C 4YS3B 4X23A 3W97D 3W98A 1P3PD 5B32B 4NE5A 4WNNA 3EPLA 2Y2GA 5B1MB 1KX4D 3LJAD 4CAYB 3VH5W 4E44A 1KX3A 3X1VA 5F99C 3UT9D 3C1BC 4KUDA 3KXBB 3AYWB 3AZJD 1B6WA 3AZHA 4YM6A 3B0CT 3MGPC 4DRAA 3UTBB 2Y2KA 1EQZC 3X1TB 4QLCA 3AZFA 4XUJB 1M1AD 2RIQA 3AZKD 3RELA 4ZUXB 3REKA 1KX5D 5BT1D 2Y2IA 4KGCD 1P3IA 3A1IA 2F8NK 5CP6D 5BNVB 4WU8B 3MGSC 5B40D 5B2JA 5JRGB 1P3LD 2PYOB 1AOIC 3H0MC 5CPKD 1TZYA 4J8WA 2ZY5A 3KWQB 5B24A 5B1LA 5CPJA 1P3MB 3AV2B 3X1UA 1U35B 3WA9B 3KUYC 3UTAB 1ZLAB 4H9QB 5AY8B 5E5AC 1P3AA 1M18B 4H9OB 4G91B 1P34A 5B33C 5B0YC 1P3KC 3B6GD 5B0ZC 1S32C 5DNND 4NFTA 3LELC 1ID3B 3B0DC 5AV8B 3AN2A 3AZLC 2JCHA 5GT0D 5AVCA 5DNMB 2HIOC 2HUEC 5B31A 3C1BB 1P3BA 1HQ3A 5F99A 4NE3A 3AZGC 3AZNA 3MGPB 2RVQC 4Z5TC 3NQJB 2LY8A 5GSUC 3LZ1B 3B6FC 3AZHD 4Z66A 1F66D 3B0CW 4YM6D 3W96B 3O62D 4R8PD 4QLCD 4H9SA 5GT3C 3AZFD 3WTPD 3REHC 3REJD 1Q9CA 1BH8A 3RELD 2AROA 3MGQD 3MGSA 2FJ7C 5GXQC 5AV5B 1BFMA 5B2JD 3REIA 1H3OB 5E5AB 4J8WD 5CPJD 1P3FB 1F1EA 5B33B 5B32C 3KUYA 5B0YB 3X1UD 3F6TA 1P3KB 4H9RA 1P3AD 3LELB 1P34D 4KHAB 1P3OC 3WAAC 3MVDD 1S32A 5B32G 2BYMB 2Y2HA 3AYWC 2HIOB 3AZMC 5DNNC 5CHLB 3MGRC 3X1SC 1P3GA 3WKJA 3UTBC 1KX4B 5AVBA 5AVCD 1R4VA 4J8VA 5B31D 4XUJC 2FFFB 4CSRA 4Z5TB 3AFAC 5AV9A 3AZJB 1P3BD 1HQ3D 3C1CC 5G49B 5B2IA 3AZND 3V9RA 2Y2LA 4WU8C 5GSUA 3B6FA 3R45B 4Z66D 4XZQC 4UUZB 3KWQC 5GT3A 4NE6A 1M19A 1KX5B 4KGCB 3REHA 4LD9C 2BYKA 1U35C 3AZEC 1ZLAC 4H9PB 5AY8C 1M18C 2FJ7B 2AROD 2CV5A 5B40B 4J8UC 3MNNA 3W99C 1P3LB 2XD1A 5BO0A 5GXQA 4J8XC 1TAFB 1ID3C 2NQBA 3TU4A 5AV8C 4YS3A 3REID 5CPIA 5B32A 5AV6C 1P3OB 5B1MA 3WAAB 4CAYA 3B6GB 3AZMB 5DNNB 2F8NA 3X1SB 5AV8A 3MGRB 4JJND 4WU9A 3KXBA 5GT0B 3LZ1C 1P3GD 3WKJD 3W96C 4WNNB 3X1TA 4WJ3C 3AFAB 5AVBD 2F8NH 2IO5B 4DRBA 3C1CB 4J8VD 3LZ0C 3VH6A 3AZIC 5BS7C 2XD5A 4DQYB 4ZUXA 5AV9D 3NQUB 1F66B 4XZQB 5B2ID 5BNVA 3O62B 4R8PB 5DNMA 5JRGA 5AV5C 2PYOA 4LD9B 3WTPB 3REJB 3AZEB 2NZDA 4Z2MH 3RELB 1P3MA 4J8UB 3AV2A 3MGQB 1P3FC 3A6NC 2G5HC 3WA9A 3W99B 5FUGB 3UTAA 5AY8A 3KFUG 4J8XB 3AV1D 2YFVB 2CV5D 3MNND 5B2JB 3IP4C 1ID3A 4X23D 3W97C 3W98D 5AV6B 5CPJB 1P3PC 3X1UB 3EG5B 5CPID 1BH9A 1KX4C 3LJAC 1JFIB 1KX3D 1P34B 3C1BA 1KU5A 1HTAA 5KDMA 5B1MD 3EPJA 3MVDB 3UT9C 3X1VD 4HGAC 4KUDD 3AZJC 2F8ND 3MGPA 4WU9D 1EQZA 3KXBD 2UWXA 3NQJA 5AVCB 3LZ1A 3W96A 3LZ0B 3AZIB 5JA4A 5B31B 3X1TD 1M1AC 1N1JB 3AZKC 3REKD 1KX5C 5BT1C 4KGCC 1P3ID 3AZNB 4E45A 5CP6C 4ZUXD 5B40C 1AOIA 3H0LC 1P3LC 5CPKC 1TZYD 5DNMD 5B24D 5B1LD 5JRGD 2PYOD 3A6NB 1H3OA 2VQRA 5E5AA 4G92B 2NZDD 5B33A 2AROB 1P3MD 5B0YA 3AV2D 3UTAD 1P3KA 5B0ZA 3LELA 3AV1C 3B6GC 3W97B 1Z2CB 1P3PB 3VH6T 3AZLA 3AN2D 2BYMA 3REIB 2HIOA 5GT0C 3LJAB 3EPKA 4AWLC 2F2AC 3UT9B 4HGAB 5BNXB 2IO5C 3AZGA 5F99D 4M6BA 4JJNB 3WTPE 4Z5TA 4KUDC 3AZJA 5G49A 3AL0C 3MGPD 3WKJB 2JE5A 3AZHC 1F66C 4YM6C 1EQZD 1M1AB 3O62C 4R8PC 3AZKB 4QLCC 3AZFC 3WTPC 4UUZA 3REJC 2G5IC 5CP6B 1KX5A 3RELC 4KGCA 2Y2OA 3REKC 3MGQC 5CPKB 4H9PA 2FJ7A 3MGSD 4H9NA 2YFWB 1AOID 5B2JC 1TAFA 4EO5B 4J8WC 4UPKA 5CPJC 3KUYD 2BYKB 5E5AD 3X1UC 3AV1B 1P3AC 5B33D 1P3OA 2JSSA 2L5AA 5B0YD 1P34C 3WAAA 3MVDC 3AYWA 5B0ZD 2ZM5A 5DNNA 3AZMA 1S32D 1P3KD 3X1SA 3LELD 4X23B 3MGRA 3W98B 4AWLB 3VH6W 3AZLD 3UTBA 5C3IC 5CPIB 2HIOD 1T3UA 3P5JB 5AVCC 1ULYA 1WWSA 1KX3B 4XUJA 4ZBJB 3X1VB 5B31C 3AFAA 2Y2NA 4KUDB 2ZY4A 3C1CA 1P3BC 2F8NB 3AZGD 1HQ3C 4WU9B 2RVQD 3AZHB 4YM6B 3AZNC 4WU8A 4Z5TD 3VH5A 5B31G 5GSUD 3NQUA 2CWEA 4QLCB 3B6FD 1F66A 4XZQA 3AZFB 3O62A 4Z66C 4R8PA 3KWQA 1A7WA 5GT3D 4LD9A 3REKB 3WTPA 1M19D 4H9SC 3REHD 3REJA 4WV4B 3AZEA 1U35A 4H9QA 1P3IB 4G92C 1M18A 1ZLAA 1W2EA 4H9OA 4J8UA 3MGQA 3W99A 2AROC 3KSYA 5FUGA 1PZRA 4J8XA 1TZYB 2FJ7D 2YFVA 4J8WB 5GXQD 5B24B 5B1LB
chains in the Genus database with same CATH topology
2NQBD 3TU4D 4YS3D 3REIC 3A1KA 2NZDB 5AV6A 1P3AB 4WZSB 2W8SA 5B32D 1JFIA 1P3OD 3MVDA 4JJNC 3WAAD 3AN2B 5C3IB 3AYWD 3AZMD 3X1SD 3MGRD 1WWIA 1P3GC 3WKJC 3UTBD 3FDDA 1BH9B 5AVBC 2ZY2A 1P3BB 3LZ0A 3AZIA 1HQ3B 5BS7A 5F99B 4J8VC 4XUJD 5KDMB 1N1JA 3AFAD 3H0RC 5AV9C 3C1CD 2ZY3A 4Z66B 1EQZB 5B2IC 4WU8D 5AV5A 4XZQD 2Y2PA 5JA4B 3KWQD 4EO5C 1BH8B 1P3FA 3A6NA 4LD9D 1M19C 2J8PA 1U35D 3WA9D 3AZED 1ZLAD 5AY8D 1M18D 3MGSB 4J8UD 4KHAA 3W99D 2CV5C 1AOIB 3MNNC 4J8XD 3W97A 2Y2JA 1P3PA 1ID3D 3B0BA 4X23C 3W98C 5AV8D 2NQBC 3TU4C 3KUYB 1KX4A 3LJAA 4YS3C 3VH5T 5CPIC 4H9RB 5AV6D 1KX3C 3UT9A 3C1BD 1B67A 4ZBJC 5B1MC 5BNXA 3X1VC 5B0ZB 1S32B 2BG1A 3B0DB 4JJNA 3AZLB 4WU9C 1P3GB 3KXBC 2Y2MA 5AVBB 2HUEB 3R45A 3LZ1D 4J8VB 3W96D 1M1AA 2F8NG 3AZKA 3X1TC 4CSRB 5AV9B 2DF4C 3LZ0D 3AZGB 3AZID 1P3IC 5B2IB 5CP6A 3V9RB 2DQNC 5B40A 4ZUXC 2Y2QA 5GSUB 3B6FB 1P3LA 5CPKA 1TZYC 5AV5D 2YFWA 5DNMC 5B24C 5B1LC 5GT3B 5JRGC 1M19B 2PYOC 3REHB 4Z2MG 2NZDC 1P3FD 3A6ND 1P3MC 2CV5B 3MNNB 3AV2C 3WA9C 3EPHA 3UTAC 3AV1A 3B6GA 5BO0B 5GXQB 4G91C 4H9NB 2NQBB 3TU4B 5GT0A 3AN2C 4YS3B 4X23A 3W97D 3W98A 1P3PD 5B32B 4NE5A 4WNNA 3EPLA 2Y2GA 5B1MB 1KX4D 3LJAD 4CAYB 3VH5W 4E44A 1KX3A 3X1VA 5F99C 3UT9D 3C1BC 4KUDA 3KXBB 3AYWB 3AZJD 1B6WA 3AZHA 4YM6A 3B0CT 3MGPC 4DRAA 3UTBB 2Y2KA 1EQZC 3X1TB 4QLCA 3AZFA 4XUJB 1M1AD 2RIQA 3AZKD 3RELA 4ZUXB 3REKA 1KX5D 5BT1D 2Y2IA 4KGCD 1P3IA 3A1IA 2F8NK 5CP6D 5BNVB 4WU8B 3MGSC 5B40D 5B2JA 5JRGB 1P3LD 2PYOB 1AOIC 3H0MC 5CPKD 1TZYA 4J8WA 2ZY5A 3KWQB 5B24A 5B1LA 5CPJA 1P3MB 3AV2B 3X1UA 1U35B 3WA9B 3KUYC 3UTAB 1ZLAB 4H9QB 5AY8B 5E5AC 1P3AA 1M18B 4H9OB 4G91B 1P34A 5B33C 5B0YC 1P3KC 3B6GD 5B0ZC 1S32C 5DNND 4NFTA 3LELC 1ID3B 3B0DC 5AV8B 3AN2A 3AZLC 2JCHA 5GT0D 5AVCA 5DNMB 2HIOC 2HUEC 5B31A 3C1BB 1P3BA 1HQ3A 5F99A 4NE3A 3AZGC 3AZNA 3MGPB 2RVQC 4Z5TC 3NQJB 2LY8A 5GSUC 3LZ1B 3B6FC 3AZHD 4Z66A 1F66D 3B0CW 4YM6D 3W96B 3O62D 4R8PD 4QLCD 4H9SA 5GT3C 3AZFD 3WTPD 3REHC 3REJD 1Q9CA 1BH8A 3RELD 2AROA 3MGQD 3MGSA 2FJ7C 5GXQC 5AV5B 1BFMA 5B2JD 3REIA 1H3OB 5E5AB 4J8WD 5CPJD 1P3FB 1F1EA 5B33B 5B32C 3KUYA 5B0YB 3X1UD 3F6TA 1P3KB 4H9RA 1P3AD 3LELB 1P34D 4KHAB 1P3OC 3WAAC 3MVDD 1S32A 5B32G 2BYMB 2Y2HA 3AYWC 2HIOB 3AZMC 5DNNC 5CHLB 3MGRC 3X1SC 1P3GA 3WKJA 3UTBC 1KX4B 5AVBA 5AVCD 1R4VA 4J8VA 5B31D 4XUJC 2FFFB 4CSRA 4Z5TB 3AFAC 5AV9A 3AZJB 1P3BD 1HQ3D 3C1CC 5G49B 5B2IA 3AZND 3V9RA 2Y2LA 4WU8C 5GSUA 3B6FA 3R45B 4Z66D 4XZQC 4UUZB 3KWQC 5GT3A 4NE6A 1M19A 1KX5B 4KGCB 3REHA 4LD9C 2BYKA 1U35C 3AZEC 1ZLAC 4H9PB 5AY8C 1M18C 2FJ7B 2AROD 2CV5A 5B40B 4J8UC 3MNNA 3W99C 1P3LB 2XD1A 5BO0A 5GXQA 4J8XC 1TAFB 1ID3C 2NQBA 3TU4A 5AV8C 4YS3A 3REID 5CPIA 5B32A 5AV6C 1P3OB 5B1MA 3WAAB 4CAYA 3B6GB 3AZMB 5DNNB 2F8NA 3X1SB 5AV8A 3MGRB 4JJND 4WU9A 3KXBA 5GT0B 3LZ1C 1P3GD 3WKJD 3W96C 4WNNB 3X1TA 4WJ3C 3AFAB 5AVBD 2F8NH 2IO5B 4DRBA 3C1CB 4J8VD 3LZ0C 3VH6A 3AZIC 5BS7C 2XD5A 4DQYB 4ZUXA 5AV9D 3NQUB 1F66B 4XZQB 5B2ID 5BNVA 3O62B 4R8PB 5DNMA 5JRGA 5AV5C 2PYOA 4LD9B 3WTPB 3REJB 3AZEB 2NZDA 4Z2MH 3RELB 1P3MA 4J8UB 3AV2A 3MGQB 1P3FC 3A6NC 2G5HC 3WA9A 3W99B 5FUGB 3UTAA 5AY8A 3KFUG 4J8XB 3AV1D 2YFVB 2CV5D 3MNND 5B2JB 3IP4C 1ID3A 4X23D 3W97C 3W98D 5AV6B 5CPJB 1P3PC 3X1UB 3EG5B 5CPID 1BH9A 1KX4C 3LJAC 1JFIB 1KX3D 1P34B 3C1BA 1KU5A 1HTAA 5KDMA 5B1MD 3EPJA 3MVDB 3UT9C 3X1VD 4HGAC 4KUDD 3AZJC 2F8ND 3MGPA 4WU9D 1EQZA 3KXBD 2UWXA 3NQJA 5AVCB 3LZ1A 3W96A 3LZ0B 3AZIB 5JA4A 5B31B 3X1TD 1M1AC 1N1JB 3AZKC 3REKD 1KX5C 5BT1C 4KGCC 1P3ID 3AZNB 4E45A 5CP6C 4ZUXD 5B40C 1AOIA 3H0LC 1P3LC 5CPKC 1TZYD 5DNMD 5B24D 5B1LD 5JRGD 2PYOD 3A6NB 1H3OA 2VQRA 5E5AA 4G92B 2NZDD 5B33A 2AROB 1P3MD 5B0YA 3AV2D 3UTAD 1P3KA 5B0ZA 3LELA 3AV1C 3B6GC 3W97B 1Z2CB 1P3PB 3VH6T 3AZLA 3AN2D 2BYMA 3REIB 2HIOA 5GT0C 3LJAB 3EPKA 4AWLC 2F2AC 3UT9B 4HGAB 5BNXB 2IO5C 3AZGA 5F99D 4M6BA 4JJNB 3WTPE 4Z5TA 4KUDC 3AZJA 5G49A 3AL0C 3MGPD 3WKJB 2JE5A 3AZHC 1F66C 4YM6C 1EQZD 1M1AB 3O62C 4R8PC 3AZKB 4QLCC 3AZFC 3WTPC 4UUZA 3REJC 2G5IC 5CP6B 1KX5A 3RELC 4KGCA 2Y2OA 3REKC 3MGQC 5CPKB 4H9PA 2FJ7A 3MGSD 4H9NA 2YFWB 1AOID 5B2JC 1TAFA 4EO5B 4J8WC 4UPKA 5CPJC 3KUYD 2BYKB 5E5AD 3X1UC 3AV1B 1P3AC 5B33D 1P3OA 2JSSA 2L5AA 5B0YD 1P34C 3WAAA 3MVDC 3AYWA 5B0ZD 2ZM5A 5DNNA 3AZMA 1S32D 1P3KD 3X1SA 3LELD 4X23B 3MGRA 3W98B 4AWLB 3VH6W 3AZLD 3UTBA 5C3IC 5CPIB 2HIOD 1T3UA 3P5JB 5AVCC 1ULYA 1WWSA 1KX3B 4XUJA 4ZBJB 3X1VB 5B31C 3AFAA 2Y2NA 4KUDB 2ZY4A 3C1CA 1P3BC 2F8NB 3AZGD 1HQ3C 4WU9B 2RVQD 3AZHB 4YM6B 3AZNC 4WU8A 4Z5TD 3VH5A 5B31G 5GSUD 3NQUA 2CWEA 4QLCB 3B6FD 1F66A 4XZQA 3AZFB 3O62A 4Z66C 4R8PA 3KWQA 1A7WA 5GT3D 4LD9A 3REKB 3WTPA 1M19D 4H9SC 3REHD 3REJA 4WV4B 3AZEA 1U35A 4H9QA 1P3IB 4G92C 1M18A 1ZLAA 1W2EA 4H9OA 4J8UA 3MGQA 3W99A 2AROC 3KSYA 5FUGA 1PZRA 4J8XA 1TZYB 2FJ7D 2YFVA 4J8WB 5GXQD 5B24B 5B1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB D;  3TU4 D;  4YS3 D;  3REI C;  2NZD B;  5AV6 A;  1P3A B;  4WZS B;  5B32 D;  1JFI A;  1P3O D;  3MVD A;  4JJN C;  3WAA D;  3AN2 B;  5C3I B;  3AYW D;  3AZM D;  3X1S D;  3MGR D;  1WWI A;  1P3G C;  3WKJ C;  3UTB D;  1BH9 B;  5AVB C;  1P3B B;  3LZ0 A;  3AZI A;  1HQ3 B;  5BS7 A;  5F99 B;  4J8V C;  4XUJ D;  5KDM B;  1N1J A;  3AFA D;  5AV9 C;  3C1C D;  4Z66 B;  1EQZ B;  5B2I C;  4WU8 D;  5AV5 A;  4XZQ D;  5JA4 B;  3KWQ D;  4EO5 C;  1BH8 B;  1P3F A;  3A6N A;  4LD9 D;  1M19 C;  1U35 D;  3WA9 D;  3AZE D;  1ZLA D;  5AY8 D;  1M18 D;  3MGS B;  4J8U D;  4KHA A;  3W99 D;  2CV5 C;  1AOI B;  3MNN C;  4J8X D;  3W97 A;  1P3P A;  1ID3 D;  3B0B A;  4X23 C;  3W98 C;  5AV8 D;  2NQB C;  3TU4 C;  3KUY B;  1KX4 A;  3LJA A;  4YS3 C;  3VH5 T;  5CPI C;  4H9R B;  5AV6 D;  1KX3 C;  3UT9 A;  3C1B D;  1B67 A;  4ZBJ C;  5B1M C;  5BNX A;  3X1V C;  5B0Z B;  1S32 B;  3B0D B;  4JJN A;  3AZL B;  4WU9 C;  1P3G B;  3KXB C;  5AVB B;  2HUE B;  3R45 A;  3LZ1 D;  4J8V B;  3W96 D;  1M1A A;  2F8N G;  3AZK A;  3X1T C;  4CSR B;  5AV9 B;  3LZ0 D;  3AZG B;  3AZI D;  1P3I C;  5B2I B;  5CP6 A;  3V9R B;  5B40 A;  4ZUX C;  5GSU B;  3B6F B;  1P3L A;  5CPK A;  1TZY C;  5AV5 D;  2YFW A;  5DNM C;  5B24 C;  5B1L C;  5GT3 B;  5JRG C;  1M19 B;  2PYO C;  3REH B;  4Z2M G;  2NZD C;  1P3F D;  3A6N D;  1P3M C;  2CV5 B;  3MNN B;  3AV2 C;  3WA9 C;  3UTA C;  3AV1 A;  3B6G A;  5BO0 B;  5GXQ B;  4G91 C;  4H9N B;  2NQB B;  3TU4 B;  5GT0 A;  3AN2 C;  4YS3 B;  4X23 A;  3W97 D;  3W98 A;  1P3P D;  5B32 B;  4NE5 A;  4WNN A;  5B1M B;  1KX4 D;  3LJA D;  4CAY B;  3VH5 W;  4E44 A;  1KX3 A;  3X1V A;  5F99 C;  3UT9 D;  3C1B C;  4KUD A;  3KXB B;  3AYW B;  3AZJ D;  1B6W A;  3AZH A;  4YM6 A;  3B0C T;  3MGP C;  4DRA A;  3UTB B;  1EQZ C;  3X1T B;  4QLC A;  3AZF A;  4XUJ B;  1M1A D;  3AZK D;  3REL A;  4ZUX B;  3REK A;  1KX5 D;  5BT1 D;  4KGC D;  1P3I A;  2F8N K;  5CP6 D;  5BNV B;  4WU8 B;  3MGS C;  5B40 D;  5B2J A;  5JRG B;  1P3L D;  2PYO B;  1AOI C;  5CPK D;  1TZY A;  4J8W A;  3KWQ B;  5B24 A;  5B1L A;  5CPJ A;  1P3M B;  3AV2 B;  3X1U A;  1U35 B;  3WA9 B;  3KUY C;  3UTA B;  1ZLA B;  4H9Q B;  5AY8 B;  5E5A C;  1P3A A;  1M18 B;  4H9O B;  4G91 B;  1P34 A;  5B33 C;  5B0Y C;  1P3K C;  3B6G D;  5B0Z C;  1S32 C;  5DNN D;  4NFT A;  3LEL C;  1ID3 B;  3B0D C;  5AV8 B;  3AN2 A;  3AZL C;  5GT0 D;  5AVC A;  5DNM B;  2HIO C;  2HUE C;  5B31 A;  3C1B B;  1P3B A;  1HQ3 A;  5F99 A;  4NE3 A;  3AZG C;  3AZN A;  3MGP B;  2RVQ C;  4Z5T C;  3NQJ B;  2LY8 A;  5GSU C;  3LZ1 B;  3B6F C;  3AZH D;  4Z66 A;  1F66 D;  3B0C W;  4YM6 D;  3W96 B;  3O62 D;  4R8P D;  4QLC D;  4H9S A;  5GT3 C;  3AZF D;  3WTP D;  3REH C;  3REJ D;  1Q9C A;  1BH8 A;  3REL D;  2ARO A;  3MGQ D;  3MGS A;  2FJ7 C;  5GXQ C;  5AV5 B;  1BFM A;  5B2J D;  3REI A;  1H3O B;  5E5A B;  4J8W D;  5CPJ D;  1P3F B;  1F1E A;  5B33 B;  5B32 C;  3KUY A;  5B0Y B;  3X1U D;  1P3K B;  4H9R A;  1P3A D;  3LEL B;  1P34 D;  4KHA B;  1P3O C;  3WAA C;  3MVD D;  1S32 A;  5B32 G;  2BYM B;  3AYW C;  2HIO B;  3AZM C;  5DNN C;  5CHL B;  3MGR C;  3X1S C;  1P3G A;  3WKJ A;  3UTB C;  1KX4 B;  5AVB A;  5AVC D;  1R4V A;  4J8V A;  5B31 D;  4XUJ C;  4CSR A;  4Z5T B;  3AFA C;  5AV9 A;  3AZJ B;  1P3B D;  1HQ3 D;  3C1C C;  5G49 B;  5B2I A;  3AZN D;  3V9R A;  4WU8 C;  5GSU A;  3B6F A;  3R45 B;  4Z66 D;  4XZQ C;  4UUZ B;  3KWQ C;  5GT3 A;  4NE6 A;  1M19 A;  1KX5 B;  4KGC B;  3REH A;  4LD9 C;  2BYK A;  1U35 C;  3AZE C;  1ZLA C;  4H9P B;  5AY8 C;  1M18 C;  2FJ7 B;  2ARO D;  2CV5 A;  5B40 B;  4J8U C;  3MNN A;  3W99 C;  1P3L B;  5BO0 A;  5GXQ A;  4J8X C;  1TAF B;  1ID3 C;  2NQB A;  3TU4 A;  5AV8 C;  4YS3 A;  3REI D;  5CPI A;  5B32 A;  5AV6 C;  1P3O B;  5B1M A;  3WAA B;  4CAY A;  3B6G B;  3AZM B;  5DNN B;  2F8N A;  3X1S B;  5AV8 A;  3MGR B;  4JJN D;  4WU9 A;  3KXB A;  5GT0 B;  3LZ1 C;  1P3G D;  3WKJ D;  3W96 C;  4WNN B;  3X1T A;  3AFA B;  5AVB D;  2F8N H;  2IO5 B;  4DRB A;  3C1C B;  4J8V D;  3LZ0 C;  3VH6 A;  3AZI C;  5BS7 C;  4ZUX A;  5AV9 D;  3NQU B;  1F66 B;  4XZQ B;  5B2I D;  5BNV A;  3O62 B;  4R8P B;  5DNM A;  5JRG A;  5AV5 C;  2PYO A;  4LD9 B;  3WTP B;  3REJ B;  3AZE B;  2NZD A;  4Z2M H;  3REL B;  1P3M A;  4J8U B;  3AV2 A;  3MGQ B;  1P3F C;  3A6N C;  3WA9 A;  3W99 B;  5FUG B;  3UTA A;  5AY8 A;  4J8X B;  3AV1 D;  2YFV B;  2CV5 D;  3MNN D;  5B2J B;  1ID3 A;  4X23 D;  3W97 C;  3W98 D;  5AV6 B;  5CPJ B;  1P3P C;  3X1U B;  5CPI D;  1BH9 A;  1KX4 C;  3LJA C;  1JFI B;  1KX3 D;  1P34 B;  3C1B A;  1KU5 A;  1HTA A;  5KDM A;  5B1M D;  3X1V D;  3MVD B;  3UT9 C;  4KUD D;  4HGA C;  3AZJ C;  2F8N D;  3MGP A;  4WU9 D;  1EQZ A;  3KXB D;  3NQJ A;  5AVC B;  3LZ1 A;  3W96 A;  3LZ0 B;  3AZI B;  5JA4 A;  5B31 B;  3X1T D;  1M1A C;  1N1J B;  3AZK C;  3REK D;  1KX5 C;  5BT1 C;  4KGC C;  1P3I D;  3AZN B;  4E45 A;  5CP6 C;  4ZUX D;  5B40 C;  1AOI A;  1P3L C;  5CPK C;  1TZY D;  5DNM D;  5B24 D;  5B1L D;  5JRG D;  2PYO D;  3A6N B;  1H3O A;  5E5A A;  4G92 B;  2NZD D;  5B33 A;  2ARO B;  1P3M D;  5B0Y A;  3AV2 D;  3UTA D;  1P3K A;  5B0Z A;  3LEL A;  3AV1 C;  3B6G C;  3W97 B;  1P3P B;  3VH6 T;  3AZL A;  3AN2 D;  2BYM A;  3REI B;  2HIO A;  5GT0 C;  3LJA B;  4AWL C;  3UT9 B;  4HGA B;  5BNX B;  2IO5 C;  3AZG A;  5F99 D;  4M6B A;  4JJN B;  3WTP E;  4Z5T A;  4KUD C;  3AZJ A;  5G49 A;  3MGP D;  3WKJ B;  3AZH C;  1F66 C;  4YM6 C;  1EQZ D;  1M1A B;  3O62 C;  4R8P C;  3AZK B;  4QLC C;  3AZF C;  3WTP C;  4UUZ A;  3REJ C;  5CP6 B;  1KX5 A;  3REL C;  4KGC A;  3REK C;  3MGQ C;  5CPK B;  4H9P A;  2FJ7 A;  3MGS D;  4H9N A;  2YFW B;  1AOI D;  5B2J C;  1TAF A;  4EO5 B;  4J8W C;  5CPJ C;  3KUY D;  2BYK B;  5E5A D;  3X1U C;  3AV1 B;  1P3A C;  5B33 D;  1P3O A;  2JSS A;  2L5A A;  5B0Y D;  1P34 C;  3WAA A;  3MVD C;  3AYW A;  5B0Z D;  3AZM A;  5DNN A;  1S32 D;  1P3K D;  3X1S A;  3LEL D;  4X23 B;  3MGR A;  3W98 B;  4AWL B;  3VH6 W;  3AZL D;  3UTB A;  5C3I C;  5CPI B;  2HIO D;  5AVC C;  1ULY A;  1WWS A;  1KX3 B;  4XUJ A;  4ZBJ B;  3X1V B;  5B31 C;  3AFA A;  4KUD B;  3C1C A;  1P3B C;  2F8N B;  3AZG D;  1HQ3 C;  4WU9 B;  2RVQ D;  3AZH B;  4YM6 B;  3AZN C;  4WU8 A;  4Z5T D;  3VH5 A;  5B31 G;  5GSU D;  3NQU A;  2CWE A;  4QLC B;  3B6F D;  1F66 A;  4XZQ A;  3AZF B;  3O62 A;  4Z66 C;  4R8P A;  3KWQ A;  1A7W A;  5GT3 D;  4LD9 A;  3REK B;  3WTP A;  1M19 D;  4H9S C;  3REH D;  3REJ A;  4WV4 B;  3AZE A;  1U35 A;  4H9Q A;  1P3I B;  4G92 C;  1M18 A;  1ZLA A;  4H9O A;  4J8U A;  3MGQ A;  3W99 A;  2ARO C;  3KSY A;  5FUG A;  4J8X A;  1TZY B;  2FJ7 D;  2YFV A;  4J8W B;  5GXQ D;  5B24 B;  5B1L B; 
#chains in the Genus database with same CATH topology
 2NQB D;  3TU4 D;  4YS3 D;  3REI C;  3A1K A;  2NZD B;  5AV6 A;  1P3A B;  4WZS B;  2W8S A;  5B32 D;  1JFI A;  1P3O D;  3MVD A;  4JJN C;  3WAA D;  3AN2 B;  5C3I B;  3AYW D;  3AZM D;  3X1S D;  3MGR D;  1WWI A;  1P3G C;  3WKJ C;  3UTB D;  3FDD A;  1BH9 B;  5AVB C;  2ZY2 A;  1P3B B;  3LZ0 A;  3AZI A;  1HQ3 B;  5BS7 A;  5F99 B;  4J8V C;  4XUJ D;  5KDM B;  1N1J A;  3AFA D;  3H0R C;  5AV9 C;  3C1C D;  2ZY3 A;  4Z66 B;  1EQZ B;  5B2I C;  4WU8 D;  5AV5 A;  4XZQ D;  2Y2P A;  5JA4 B;  3KWQ D;  4EO5 C;  1BH8 B;  1P3F A;  3A6N A;  4LD9 D;  1M19 C;  2J8P A;  1U35 D;  3WA9 D;  3AZE D;  1ZLA D;  5AY8 D;  1M18 D;  3MGS B;  4J8U D;  4KHA A;  3W99 D;  2CV5 C;  1AOI B;  3MNN C;  4J8X D;  3W97 A;  2Y2J A;  1P3P A;  1ID3 D;  3B0B A;  4X23 C;  3W98 C;  5AV8 D;  2NQB C;  3TU4 C;  3KUY B;  1KX4 A;  3LJA A;  4YS3 C;  3VH5 T;  5CPI C;  4H9R B;  5AV6 D;  1KX3 C;  3UT9 A;  3C1B D;  1B67 A;  4ZBJ C;  5B1M C;  5BNX A;  3X1V C;  5B0Z B;  1S32 B;  2BG1 A;  3B0D B;  4JJN A;  3AZL B;  4WU9 C;  1P3G B;  3KXB C;  2Y2M A;  5AVB B;  2HUE B;  3R45 A;  3LZ1 D;  4J8V B;  3W96 D;  1M1A A;  2F8N G;  3AZK A;  3X1T C;  4CSR B;  5AV9 B;  2DF4 C;  3LZ0 D;  3AZG B;  3AZI D;  1P3I C;  5B2I B;  5CP6 A;  3V9R B;  2DQN C;  5B40 A;  4ZUX C;  2Y2Q A;  5GSU B;  3B6F B;  1P3L A;  5CPK A;  1TZY C;  5AV5 D;  2YFW A;  5DNM C;  5B24 C;  5B1L C;  5GT3 B;  5JRG C;  1M19 B;  2PYO C;  3REH B;  4Z2M G;  2NZD C;  1P3F D;  3A6N D;  1P3M C;  2CV5 B;  3MNN B;  3AV2 C;  3WA9 C;  3EPH A;  3UTA C;  3AV1 A;  3B6G A;  5BO0 B;  5GXQ B;  4G91 C;  4H9N B;  2NQB B;  3TU4 B;  5GT0 A;  3AN2 C;  4YS3 B;  4X23 A;  3W97 D;  3W98 A;  1P3P D;  5B32 B;  4NE5 A;  4WNN A;  3EPL A;  2Y2G A;  5B1M B;  1KX4 D;  3LJA D;  4CAY B;  3VH5 W;  4E44 A;  1KX3 A;  3X1V A;  5F99 C;  3UT9 D;  3C1B C;  4KUD A;  3KXB B;  3AYW B;  3AZJ D;  1B6W A;  3AZH A;  4YM6 A;  3B0C T;  3MGP C;  4DRA A;  3UTB B;  2Y2K A;  1EQZ C;  3X1T B;  4QLC A;  3AZF A;  4XUJ B;  1M1A D;  2RIQ A;  3AZK D;  3REL A;  4ZUX B;  3REK A;  1KX5 D;  5BT1 D;  2Y2I A;  4KGC D;  1P3I A;  3A1I A;  2F8N K;  5CP6 D;  5BNV B;  4WU8 B;  3MGS C;  5B40 D;  5B2J A;  5JRG B;  1P3L D;  2PYO B;  1AOI C;  3H0M C;  5CPK D;  1TZY A;  4J8W A;  2ZY5 A;  3KWQ B;  5B24 A;  5B1L A;  5CPJ A;  1P3M B;  3AV2 B;  3X1U A;  1U35 B;  3WA9 B;  3KUY C;  3UTA B;  1ZLA B;  4H9Q B;  5AY8 B;  5E5A C;  1P3A A;  1M18 B;  4H9O B;  4G91 B;  1P34 A;  5B33 C;  5B0Y C;  1P3K C;  3B6G D;  5B0Z C;  1S32 C;  5DNN D;  4NFT A;  3LEL C;  1ID3 B;  3B0D C;  5AV8 B;  3AN2 A;  3AZL C;  2JCH A;  5GT0 D;  5AVC A;  5DNM B;  2HIO C;  2HUE C;  5B31 A;  3C1B B;  1P3B A;  1HQ3 A;  5F99 A;  4NE3 A;  3AZG C;  3AZN A;  3MGP B;  2RVQ C;  4Z5T C;  3NQJ B;  2LY8 A;  5GSU C;  3LZ1 B;  3B6F C;  3AZH D;  4Z66 A;  1F66 D;  3B0C W;  4YM6 D;  3W96 B;  3O62 D;  4R8P D;  4QLC D;  4H9S A;  5GT3 C;  3AZF D;  3WTP D;  3REH C;  3REJ D;  1Q9C A;  1BH8 A;  3REL D;  2ARO A;  3MGQ D;  3MGS A;  2FJ7 C;  5GXQ C;  5AV5 B;  1BFM A;  5B2J D;  3REI A;  1H3O B;  5E5A B;  4J8W D;  5CPJ D;  1P3F B;  1F1E A;  5B33 B;  5B32 C;  3KUY A;  5B0Y B;  3X1U D;  3F6T A;  1P3K B;  4H9R A;  1P3A D;  3LEL B;  1P34 D;  4KHA B;  1P3O C;  3WAA C;  3MVD D;  1S32 A;  5B32 G;  2BYM B;  2Y2H A;  3AYW C;  2HIO B;  3AZM C;  5DNN C;  5CHL B;  3MGR C;  3X1S C;  1P3G A;  3WKJ A;  3UTB C;  1KX4 B;  5AVB A;  5AVC D;  1R4V A;  4J8V A;  5B31 D;  4XUJ C;  2FFF B;  4CSR A;  4Z5T B;  3AFA C;  5AV9 A;  3AZJ B;  1P3B D;  1HQ3 D;  3C1C C;  5G49 B;  5B2I A;  3AZN D;  3V9R A;  2Y2L A;  4WU8 C;  5GSU A;  3B6F A;  3R45 B;  4Z66 D;  4XZQ C;  4UUZ B;  3KWQ C;  5GT3 A;  4NE6 A;  1M19 A;  1KX5 B;  4KGC B;  3REH A;  4LD9 C;  2BYK A;  1U35 C;  3AZE C;  1ZLA C;  4H9P B;  5AY8 C;  1M18 C;  2FJ7 B;  2ARO D;  2CV5 A;  5B40 B;  4J8U C;  3MNN A;  3W99 C;  1P3L B;  2XD1 A;  5BO0 A;  5GXQ A;  4J8X C;  1TAF B;  1ID3 C;  2NQB A;  3TU4 A;  5AV8 C;  4YS3 A;  3REI D;  5CPI A;  5B32 A;  5AV6 C;  1P3O B;  5B1M A;  3WAA B;  4CAY A;  3B6G B;  3AZM B;  5DNN B;  2F8N A;  3X1S B;  5AV8 A;  3MGR B;  4JJN D;  4WU9 A;  3KXB A;  5GT0 B;  3LZ1 C;  1P3G D;  3WKJ D;  3W96 C;  4WNN B;  3X1T A;  4WJ3 C;  3AFA B;  5AVB D;  2F8N H;  2IO5 B;  4DRB A;  3C1C B;  4J8V D;  3LZ0 C;  3VH6 A;  3AZI C;  5BS7 C;  2XD5 A;  4DQY B;  4ZUX A;  5AV9 D;  3NQU B;  1F66 B;  4XZQ B;  5B2I D;  5BNV A;  3O62 B;  4R8P B;  5DNM A;  5JRG A;  5AV5 C;  2PYO A;  4LD9 B;  3WTP B;  3REJ B;  3AZE B;  2NZD A;  4Z2M H;  3REL B;  1P3M A;  4J8U B;  3AV2 A;  3MGQ B;  1P3F C;  3A6N C;  2G5H C;  3WA9 A;  3W99 B;  5FUG B;  3UTA A;  5AY8 A;  3KFU G;  4J8X B;  3AV1 D;  2YFV B;  2CV5 D;  3MNN D;  5B2J B;  3IP4 C;  1ID3 A;  4X23 D;  3W97 C;  3W98 D;  5AV6 B;  5CPJ B;  1P3P C;  3X1U B;  3EG5 B;  5CPI D;  1BH9 A;  1KX4 C;  3LJA C;  1JFI B;  1KX3 D;  1P34 B;  3C1B A;  1KU5 A;  1HTA A;  5KDM A;  5B1M D;  3EPJ A;  3MVD B;  3UT9 C;  3X1V D;  4HGA C;  4KUD D;  3AZJ C;  2F8N D;  3MGP A;  4WU9 D;  1EQZ A;  3KXB D;  2UWX A;  3NQJ A;  5AVC B;  3LZ1 A;  3W96 A;  3LZ0 B;  3AZI B;  5JA4 A;  5B31 B;  3X1T D;  1M1A C;  1N1J B;  3AZK C;  3REK D;  1KX5 C;  5BT1 C;  4KGC C;  1P3I D;  3AZN B;  4E45 A;  5CP6 C;  4ZUX D;  5B40 C;  1AOI A;  3H0L C;  1P3L C;  5CPK C;  1TZY D;  5DNM D;  5B24 D;  5B1L D;  5JRG D;  2PYO D;  3A6N B;  1H3O A;  2VQR A;  5E5A A;  4G92 B;  2NZD D;  5B33 A;  2ARO B;  1P3M D;  5B0Y A;  3AV2 D;  3UTA D;  1P3K A;  5B0Z A;  3LEL A;  3AV1 C;  3B6G C;  3W97 B;  1Z2C B;  1P3P B;  3VH6 T;  3AZL A;  3AN2 D;  2BYM A;  3REI B;  2HIO A;  5GT0 C;  3LJA B;  3EPK A;  4AWL C;  2F2A C;  3UT9 B;  4HGA B;  5BNX B;  2IO5 C;  3AZG A;  5F99 D;  4M6B A;  4JJN B;  3WTP E;  4Z5T A;  4KUD C;  3AZJ A;  5G49 A;  3AL0 C;  3MGP D;  3WKJ B;  2JE5 A;  3AZH C;  1F66 C;  4YM6 C;  1EQZ D;  1M1A B;  3O62 C;  4R8P C;  3AZK B;  4QLC C;  3AZF C;  3WTP C;  4UUZ A;  3REJ C;  2G5I C;  5CP6 B;  1KX5 A;  3REL C;  4KGC A;  2Y2O A;  3REK C;  3MGQ C;  5CPK B;  4H9P A;  2FJ7 A;  3MGS D;  4H9N A;  2YFW B;  1AOI D;  5B2J C;  1TAF A;  4EO5 B;  4J8W C;  4UPK A;  5CPJ C;  3KUY D;  2BYK B;  5E5A D;  3X1U C;  3AV1 B;  1P3A C;  5B33 D;  1P3O A;  2JSS A;  2L5A A;  5B0Y D;  1P34 C;  3WAA A;  3MVD C;  3AYW A;  5B0Z D;  2ZM5 A;  5DNN A;  3AZM A;  1S32 D;  1P3K D;  3X1S A;  3LEL D;  4X23 B;  3MGR A;  3W98 B;  4AWL B;  3VH6 W;  3AZL D;  3UTB A;  5C3I C;  5CPI B;  2HIO D;  1T3U A;  3P5J B;  5AVC C;  1ULY A;  1WWS A;  1KX3 B;  4XUJ A;  4ZBJ B;  3X1V B;  5B31 C;  3AFA A;  2Y2N A;  4KUD B;  2ZY4 A;  3C1C A;  1P3B C;  2F8N B;  3AZG D;  1HQ3 C;  4WU9 B;  2RVQ D;  3AZH B;  4YM6 B;  3AZN C;  4WU8 A;  4Z5T D;  3VH5 A;  5B31 G;  5GSU D;  3NQU A;  2CWE A;  4QLC B;  3B6F D;  1F66 A;  4XZQ A;  3AZF B;  3O62 A;  4Z66 C;  4R8P A;  3KWQ A;  1A7W A;  5GT3 D;  4LD9 A;  3REK B;  3WTP A;  1M19 D;  4H9S C;  3REH D;  3REJ A;  4WV4 B;  3AZE A;  1U35 A;  4H9Q A;  1P3I B;  4G92 C;  1M18 A;  1ZLA A;  1W2E A;  4H9O A;  4J8U A;  3MGQ A;  3W99 A;  2ARO C;  3KSY A;  5FUG A;  1PZR A;  4J8X A;  1TZY B;  2FJ7 D;  2YFV A;  4J8W B;  5GXQ D;  5B24 B;  5B1L B; 
#chains in the Genus database with same CATH homology
 2NQB D;  3TU4 D;  4YS3 D;  3REI C;  3A1K A;  2NZD B;  5AV6 A;  1P3A B;  4WZS B;  2W8S A;  5B32 D;  1JFI A;  1P3O D;  3MVD A;  4JJN C;  3WAA D;  3AN2 B;  5C3I B;  3AYW D;  3AZM D;  3X1S D;  3MGR D;  1WWI A;  1P3G C;  3WKJ C;  3UTB D;  3FDD A;  1BH9 B;  5AVB C;  2ZY2 A;  1P3B B;  3LZ0 A;  3AZI A;  1HQ3 B;  5BS7 A;  5F99 B;  4J8V C;  4XUJ D;  5KDM B;  1N1J A;  3AFA D;  3H0R C;  5AV9 C;  3C1C D;  2ZY3 A;  4Z66 B;  1EQZ B;  5B2I C;  4WU8 D;  5AV5 A;  4XZQ D;  2Y2P A;  5JA4 B;  3KWQ D;  4EO5 C;  1BH8 B;  1P3F A;  3A6N A;  4LD9 D;  1M19 C;  2J8P A;  1U35 D;  3WA9 D;  3AZE D;  1ZLA D;  5AY8 D;  1M18 D;  3MGS B;  4J8U D;  4KHA A;  3W99 D;  2CV5 C;  1AOI B;  3MNN C;  4J8X D;  3W97 A;  2Y2J A;  1P3P A;  1ID3 D;  3B0B A;  4X23 C;  3W98 C;  5AV8 D;  2NQB C;  3TU4 C;  3KUY B;  1KX4 A;  3LJA A;  4YS3 C;  3VH5 T;  5CPI C;  4H9R B;  5AV6 D;  1KX3 C;  3UT9 A;  3C1B D;  1B67 A;  4ZBJ C;  5B1M C;  5BNX A;  3X1V C;  5B0Z B;  1S32 B;  2BG1 A;  3B0D B;  4JJN A;  3AZL B;  4WU9 C;  1P3G B;  3KXB C;  2Y2M A;  5AVB B;  2HUE B;  3R45 A;  3LZ1 D;  4J8V B;  3W96 D;  1M1A A;  2F8N G;  3AZK A;  3X1T C;  4CSR B;  5AV9 B;  2DF4 C;  3LZ0 D;  3AZG B;  3AZI D;  1P3I C;  5B2I B;  5CP6 A;  3V9R B;  2DQN C;  5B40 A;  4ZUX C;  2Y2Q A;  5GSU B;  3B6F B;  1P3L A;  5CPK A;  1TZY C;  5AV5 D;  2YFW A;  5DNM C;  5B24 C;  5B1L C;  5GT3 B;  5JRG C;  1M19 B;  2PYO C;  3REH B;  4Z2M G;  2NZD C;  1P3F D;  3A6N D;  1P3M C;  2CV5 B;  3MNN B;  3AV2 C;  3WA9 C;  3EPH A;  3UTA C;  3AV1 A;  3B6G A;  5BO0 B;  5GXQ B;  4G91 C;  4H9N B;  2NQB B;  3TU4 B;  5GT0 A;  3AN2 C;  4YS3 B;  4X23 A;  3W97 D;  3W98 A;  1P3P D;  5B32 B;  4NE5 A;  4WNN A;  3EPL A;  2Y2G A;  5B1M B;  1KX4 D;  3LJA D;  4CAY B;  3VH5 W;  4E44 A;  1KX3 A;  3X1V A;  5F99 C;  3UT9 D;  3C1B C;  4KUD A;  3KXB B;  3AYW B;  3AZJ D;  1B6W A;  3AZH A;  4YM6 A;  3B0C T;  3MGP C;  4DRA A;  3UTB B;  2Y2K A;  1EQZ C;  3X1T B;  4QLC A;  3AZF A;  4XUJ B;  1M1A D;  2RIQ A;  3AZK D;  3REL A;  4ZUX B;  3REK A;  1KX5 D;  5BT1 D;  2Y2I A;  4KGC D;  1P3I A;  3A1I A;  2F8N K;  5CP6 D;  5BNV B;  4WU8 B;  3MGS C;  5B40 D;  5B2J A;  5JRG B;  1P3L D;  2PYO B;  1AOI C;  3H0M C;  5CPK D;  1TZY A;  4J8W A;  2ZY5 A;  3KWQ B;  5B24 A;  5B1L A;  5CPJ A;  1P3M B;  3AV2 B;  3X1U A;  1U35 B;  3WA9 B;  3KUY C;  3UTA B;  1ZLA B;  4H9Q B;  5AY8 B;  5E5A C;  1P3A A;  1M18 B;  4H9O B;  4G91 B;  1P34 A;  5B33 C;  5B0Y C;  1P3K C;  3B6G D;  5B0Z C;  1S32 C;  5DNN D;  4NFT A;  3LEL C;  1ID3 B;  3B0D C;  5AV8 B;  3AN2 A;  3AZL C;  2JCH A;  5GT0 D;  5AVC A;  5DNM B;  2HIO C;  2HUE C;  5B31 A;  3C1B B;  1P3B A;  1HQ3 A;  5F99 A;  4NE3 A;  3AZG C;  3AZN A;  3MGP B;  2RVQ C;  4Z5T C;  3NQJ B;  2LY8 A;  5GSU C;  3LZ1 B;  3B6F C;  3AZH D;  4Z66 A;  1F66 D;  3B0C W;  4YM6 D;  3W96 B;  3O62 D;  4R8P D;  4QLC D;  4H9S A;  5GT3 C;  3AZF D;  3WTP D;  3REH C;  3REJ D;  1Q9C A;  1BH8 A;  3REL D;  2ARO A;  3MGQ D;  3MGS A;  2FJ7 C;  5GXQ C;  5AV5 B;  1BFM A;  5B2J D;  3REI A;  1H3O B;  5E5A B;  4J8W D;  5CPJ D;  1P3F B;  1F1E A;  5B33 B;  5B32 C;  3KUY A;  5B0Y B;  3X1U D;  3F6T A;  1P3K B;  4H9R A;  1P3A D;  3LEL B;  1P34 D;  4KHA B;  1P3O C;  3WAA C;  3MVD D;  1S32 A;  5B32 G;  2BYM B;  2Y2H A;  3AYW C;  2HIO B;  3AZM C;  5DNN C;  5CHL B;  3MGR C;  3X1S C;  1P3G A;  3WKJ A;  3UTB C;  1KX4 B;  5AVB A;  5AVC D;  1R4V A;  4J8V A;  5B31 D;  4XUJ C;  2FFF B;  4CSR A;  4Z5T B;  3AFA C;  5AV9 A;  3AZJ B;  1P3B D;  1HQ3 D;  3C1C C;  5G49 B;  5B2I A;  3AZN D;  3V9R A;  2Y2L A;  4WU8 C;  5GSU A;  3B6F A;  3R45 B;  4Z66 D;  4XZQ C;  4UUZ B;  3KWQ C;  5GT3 A;  4NE6 A;  1M19 A;  1KX5 B;  4KGC B;  3REH A;  4LD9 C;  2BYK A;  1U35 C;  3AZE C;  1ZLA C;  4H9P B;  5AY8 C;  1M18 C;  2FJ7 B;  2ARO D;  2CV5 A;  5B40 B;  4J8U C;  3MNN A;  3W99 C;  1P3L B;  2XD1 A;  5BO0 A;  5GXQ A;  4J8X C;  1TAF B;  1ID3 C;  2NQB A;  3TU4 A;  5AV8 C;  4YS3 A;  3REI D;  5CPI A;  5B32 A;  5AV6 C;  1P3O B;  5B1M A;  3WAA B;  4CAY A;  3B6G B;  3AZM B;  5DNN B;  2F8N A;  3X1S B;  5AV8 A;  3MGR B;  4JJN D;  4WU9 A;  3KXB A;  5GT0 B;  3LZ1 C;  1P3G D;  3WKJ D;  3W96 C;  4WNN B;  3X1T A;  4WJ3 C;  3AFA B;  5AVB D;  2F8N H;  2IO5 B;  4DRB A;  3C1C B;  4J8V D;  3LZ0 C;  3VH6 A;  3AZI C;  5BS7 C;  2XD5 A;  4DQY B;  4ZUX A;  5AV9 D;  3NQU B;  1F66 B;  4XZQ B;  5B2I D;  5BNV A;  3O62 B;  4R8P B;  5DNM A;  5JRG A;  5AV5 C;  2PYO A;  4LD9 B;  3WTP B;  3REJ B;  3AZE B;  2NZD A;  4Z2M H;  3REL B;  1P3M A;  4J8U B;  3AV2 A;  3MGQ B;  1P3F C;  3A6N C;  2G5H C;  3WA9 A;  3W99 B;  5FUG B;  3UTA A;  5AY8 A;  3KFU G;  4J8X B;  3AV1 D;  2YFV B;  2CV5 D;  3MNN D;  5B2J B;  3IP4 C;  1ID3 A;  4X23 D;  3W97 C;  3W98 D;  5AV6 B;  5CPJ B;  1P3P C;  3X1U B;  3EG5 B;  5CPI D;  1BH9 A;  1KX4 C;  3LJA C;  1JFI B;  1KX3 D;  1P34 B;  3C1B A;  1KU5 A;  1HTA A;  5KDM A;  5B1M D;  3EPJ A;  3MVD B;  3UT9 C;  3X1V D;  4HGA C;  4KUD D;  3AZJ C;  2F8N D;  3MGP A;  4WU9 D;  1EQZ A;  3KXB D;  2UWX A;  3NQJ A;  5AVC B;  3LZ1 A;  3W96 A;  3LZ0 B;  3AZI B;  5JA4 A;  5B31 B;  3X1T D;  1M1A C;  1N1J B;  3AZK C;  3REK D;  1KX5 C;  5BT1 C;  4KGC C;  1P3I D;  3AZN B;  4E45 A;  5CP6 C;  4ZUX D;  5B40 C;  1AOI A;  3H0L C;  1P3L C;  5CPK C;  1TZY D;  5DNM D;  5B24 D;  5B1L D;  5JRG D;  2PYO D;  3A6N B;  1H3O A;  2VQR A;  5E5A A;  4G92 B;  2NZD D;  5B33 A;  2ARO B;  1P3M D;  5B0Y A;  3AV2 D;  3UTA D;  1P3K A;  5B0Z A;  3LEL A;  3AV1 C;  3B6G C;  3W97 B;  1Z2C B;  1P3P B;  3VH6 T;  3AZL A;  3AN2 D;  2BYM A;  3REI B;  2HIO A;  5GT0 C;  3LJA B;  3EPK A;  4AWL C;  2F2A C;  3UT9 B;  4HGA B;  5BNX B;  2IO5 C;  3AZG A;  5F99 D;  4M6B A;  4JJN B;  3WTP E;  4Z5T A;  4KUD C;  3AZJ A;  5G49 A;  3AL0 C;  3MGP D;  3WKJ B;  2JE5 A;  3AZH C;  1F66 C;  4YM6 C;  1EQZ D;  1M1A B;  3O62 C;  4R8P C;  3AZK B;  4QLC C;  3AZF C;  3WTP C;  4UUZ A;  3REJ C;  2G5I C;  5CP6 B;  1KX5 A;  3REL C;  4KGC A;  2Y2O A;  3REK C;  3MGQ C;  5CPK B;  4H9P A;  2FJ7 A;  3MGS D;  4H9N A;  2YFW B;  1AOI D;  5B2J C;  1TAF A;  4EO5 B;  4J8W C;  4UPK A;  5CPJ C;  3KUY D;  2BYK B;  5E5A D;  3X1U C;  3AV1 B;  1P3A C;  5B33 D;  1P3O A;  2JSS A;  2L5A A;  5B0Y D;  1P34 C;  3WAA A;  3MVD C;  3AYW A;  5B0Z D;  2ZM5 A;  5DNN A;  3AZM A;  1S32 D;  1P3K D;  3X1S A;  3LEL D;  4X23 B;  3MGR A;  3W98 B;  4AWL B;  3VH6 W;  3AZL D;  3UTB A;  5C3I C;  5CPI B;  2HIO D;  1T3U A;  3P5J B;  5AVC C;  1ULY A;  1WWS A;  1KX3 B;  4XUJ A;  4ZBJ B;  3X1V B;  5B31 C;  3AFA A;  2Y2N A;  4KUD B;  2ZY4 A;  3C1C A;  1P3B C;  2F8N B;  3AZG D;  1HQ3 C;  4WU9 B;  2RVQ D;  3AZH B;  4YM6 B;  3AZN C;  4WU8 A;  4Z5T D;  3VH5 A;  5B31 G;  5GSU D;  3NQU A;  2CWE A;  4QLC B;  3B6F D;  1F66 A;  4XZQ A;  3AZF B;  3O62 A;  4Z66 C;  4R8P A;  3KWQ A;  1A7W A;  5GT3 D;  4LD9 A;  3REK B;  3WTP A;  1M19 D;  4H9S C;  3REH D;  3REJ A;  4WV4 B;  3AZE A;  1U35 A;  4H9Q A;  1P3I B;  4G92 C;  1M18 A;  1ZLA A;  1W2E A;  4H9O A;  4J8U A;  3MGQ A;  3W99 A;  2ARO C;  3KSY A;  5FUG A;  1PZR A;  4J8X A;  1TZY B;  2FJ7 D;  2YFV A;  4J8W B;  5GXQ D;  5B24 B;  5B1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...