5F99A

X-ray structure of the mmtv-a nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title X-ray structure of the MMTV-A nucleosome core.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5f99A00
4HGAC 4WU8C 1B6WA 3C1BB 3REKB 3X1VC 3AZID 1KX4D 5B1LC 4YM6D 1P34B 5B2JD 4Z66D 1ID3C 4Z2MH 5CP6A 3AFAD 3AN2C 1P3PA 3W97C 3O62D 2PYOD 5B32C 3AZFA 3B0CT 4ZBJB 3KXBA 1ULYA 3AZMA 1AOID 1HQ3C 2AROD 5GT0A 3AV1D 5CP6B 1P3PB 5B0ZC 3WAAA 5AV6C 3MGSA 3RELC 5B33A 3AZGD 3AZFB 3AV2D 3W99A 5AV9D 3KXBB 3LZ1A 3AZMB 5GT0B 2NZDD 1P3LA 4KUDA 4UUZA 3W96C 5CPIC 3WAAB 4G92C 3MGSB 3V9RA 5B33B 3W99B 4WU9C 5CPJA 3LZ1B 5B24A 1P3LB 4KUDB 4UUZB 3A6NA 4J8UA 3MGPD 1P3AD 3KXBC 3REJA 3V9RB 5AY8D 1U35A 5CPJB 4YS3C 1M19A 5B24B 3WAAC 3AYWC 4G91C 3A6NB 3WKJC 4J8UB 4ZUXA 3UT9D 3REJB 5BO0A 4H9QA 1KX5C 1P3LC 1M19B 5BNXA 1EQZA 2HIOC 1WWSA 4ZUXB 1KX3A 1HTAA 5E5AD 5BO0B 4R8PD 4H9QB 5B0YD 5BNXB 3AZJD 4J8WD 3X1UD 1P3OC 3VH6A 5GSUC 3LJAA 1EQZB 1U35C 3B0CW 4J8XA 1KX3B 4QLCD 1M19C 5BS7A 1M1AD 1P3MC 3W98A 3LJAB 4J8XB 5B40D 3AZHA 5CHLB 5GT3A 3W98B 5DNND 3X1TD 4JJNA 5B31G 3UTAC 2NQBC 3AZHB 5BT1C 4CSRA 3AZEC 1R4VA 5GT3B 4XZQA 5JA4A 4J8XC 2CV5A 4JJNB 1TZYC 3WTPA 3LELD 4CSRB 3KUYC 4XZQB 5JA4B 5AVCD 2BYKA 2CV5B 5GXQA 3C1CA 5AV5D 3MGQC 2FJ7C 1JFIA 1A7WA 4KGCD 3X1SC 3WTPB 1M18C 1ZLAC 4WU8A 1B67A 2BYKB 4Z5TD 4M6BA 5GXQB 5DNMD 3C1CB 5B1LA 1P3GC 2YFVA 1JFIB 3B0DB 1ID3A 5F99A 4HGAB 4WU8B 3B6FD 4NFTA 3W97A 3AN2A 3B6GD 1Q9CA 1KX4C 5B32A 1EQZD 5B1LB 2YFVB 5B2JC 4Z66C 3AFAC 1HQ3A 1ID3B 5F99B 3AZLC 3O62C 3AN2B 2PYOC 5B0ZA 3W97B 5B32B 5AV6A 3RELA 1AOIC 3MNND 2AROC 3AV1C 5B1MD 1HQ3B 4NE3A 1F66D 1BH8A 5B0ZB 3W96A 3AV2C 5CPIA 5AVBA 5AV6B 5AV9C 3RELB 3TU4D 3VH5T 4WU9A 5F99C 2NZDC 2F8ND 3UTBD 1BH8B 1BH9A 2JSSA 4EO5C 5CPIB 3W96B 5AVBB 3REIA 4G92B 4H9PA 1P3FA 4WU9B 4JJND 4YS3A 3LZ0D 3AYWA 3MGPC 1P3AC 4E44A 3WKJA 1BH9B 1P3KD 4H9OA 4XUJD 3REIB 5AY8C 4Z2MG 4J8VC 3REHD 4H9PB 5AV8D 1TAFA 1P3FB 3R45A 4YS3B 1KX5A 5B2ID 1P3BD 3KWQD 5AVBC 3AYWB 4G91B 3WKJB 3UT9C 2HIOA 4H9OB 3MVDD 4LD9D 1S32D 1TAFB 3WA9D 3R45B 1KX5B 3MGRD 5BNVA 3REIC 5CPKD 5GSUA 1P3OA 2CWEA 2HIOB 3AZKD 1P3FC 5B31D 4R8PC 5E5AC 3X1VD 5B0YC 1P3ID 3AZJC 4J8WC 3X1UC 5KDMA 1P3MA 5BNVB 1P3OB 5GSUB 3WTPE 4QLCC 1U35B 1F1EA 2F8NG 3AZND 1M1AC 2RVQD 5KDMB 3C1BD 3REKD 1P3MB 2YFWA 5B40C 3VH5W 3UTAA 4X23C 1P34D 2NQBA 3RELD 3AZEA 5DNNC 3X1TC 2YFWB 3UTAB 2NQBB 1TZYA 3AZEB 3KUYA 5CP6D 1P3PD 5G49A 5JRGA 2FJ7A 3MGQA 3AZFD 3X1SA 3LELC 3KXBD 3AZMD 1TZYB 1M18A 1ZLAA 5GT0D 5AVCC 3KUYB 5G49B 5AV5C 3WAAD 4KGCC 5JRGB 1P3GA 3WKJD 3MGSD 3MGQB 5B33D 2FJ7B 3W99D 3X1SB 3LZ1D 2IO5B 1M18B 1ZLAB 4Z5TC 1P3LD 4KUDD 1KX4A 5DNMC 1P3GB 5B32G 5B2JA 4Z66A 5CPJD 3AFAA 3B6FC 4WZSB 3B6GC 3AZLA 4NE6A 3O62A 5B24D 2F8NK 2PYOA 5JRGC 3A6ND 1KX4B 4J8UD 3REJD 1AOIA 5B2JB 2AROA 2IO5C 4Z66B 3AV1A 1U35D 3AFAB 1BFMA 1M19D 3AZLB 3O62B 2PYOB 3AZGA 3AV2A 3VH6T 3MNNC 4ZUXD 5AV9A 1AOIB 5B1MC 2AROB 3AV1B 1F66C 2NZDA 3AZIC 4YM6C 3TU4C 3AZGB 3AV2B 2HUEC 5AV9B 1KX3D 3UTBC 2NZDB 3MGPA 1P3AA 5C3IC 4EO5B 3LJAD 5AY8A 4J8VA 4J8XD 4H9SC 3LZ0C 1P3KC 3AZGC 3MGPB 1P3AB 3W98D 3UT9A 3REHC 5AV8C 5AY8B 4J8VB 5B2IC 1N1JA 3AZHD 1P3BC 3KWQC 5GT3D 3MVDC 4LD9C 4AWLC 3UT9B 1S32C 5E5AA 4R8PA 3WA9C 5B0YA 1N1JB 3MGRC 3AZJA 4J8WA 3X1UA 5CPKC 2LY8A 3AZKC 4XZQD 5B31C 4QLCA 2CV5D 5E5AB 4R8PB 5B0YB 1P3IC 1M1AA 3WTPD 4J8WB 3AZJB 3X1UB 1WWIA 3AZLD 3VH6W 5B40A 4QLCB 5GXQD 3AZNC 3C1CD 4X23A 2BYMA 1M1AB 2RVQC 3C1BC 3REKC 4WU8D 5DNNA 5FUGA 3X1TA 1KU5A 5B40B 1P34C 5B1LD 4X23B 2BYMB 1ID3D 5F99D 5DNNB 3AN2D 3W97D 4NE5A 5FUGB 3X1TB 4ZBJC 5B32D 3LELA 5CP6C 1HQ3D 1P3PC 3B0BA 5AVCA 3NQJA 5B0ZD 2F8NH 5AV5A 3AZFC 4KGCA 5AV6D 3AZMC 3LELB 1H3OA 5GT0C 4J8VD 5AVCB 4Z5TA 3NQJB 5DNMA 4DRAA 5AV5B 3MGSC 5B33C 5CPID 3W99C 5AVBD 3W96D 4KGCB 3LZ1C 4WU9D 1H3OB 3B6FA 4KUDC 3B6GA 4Z5TB 5DNMB 3NQUA 3REID 5CPJC 1P3FD 4YS3D 5B24C 3B6FB 3B6GB 3A6NC 4J8UC 4WV4B 3AYWD 3REJC 3MNNA 3NQUB 5B1MA 2L5AA 1F66A 1KX5D 3AZIA 4YM6A 4ZUXC 3TU4A 2HIOD 3MNNB 2F8NA 3UTBA 5B1MB 1F66B 4E45A 4X23D 3KSYA 3AZIB 1EQZC 4YM6B 1P3OD 3TU4B 5GSUD 1KX3C 2HUEB 4H9SA 4H9NA 3UTBB 2F8NB 3LZ0A 1P3KA 4XUJA 3LJAC 1P3MD 5C3IB 3VH5A 3REHA 5AV8A 4CAYA 4H9NB 5BS7C 5B2IA 1P3BA 3LZ0B 3KWQA 3W98C 1P3KB 4XUJB 3MVDA 4LD9A 1S32A 3REHB 5AV8B 3AZHC 3WA9A 4CAYB 3UTAD 4WNNA 5B2IB 3MGRA 1P3BB 2NQBD 3KWQB 5GT3C 5BT1D 5CPKA 3AZED 3AZKA 3MVDB 4LD9B 4AWLB 5B31A 1S32B 4JJNC 3X1VA 4H9RA 3WA9B 4KHAA 4DRBA 1P3IA 4WNNB 3MGRB 1TZYD 4XUJC 5CPKB 4XZQC 3KUYD 3AZKB 2CV5C 5B31B 3X1VB 5JRGD 3AZNA 4H9RB 2FJ7D 4KHAB 3MGQD 1P3IB 3WTPC 3X1SD 3C1BA 3REKA 1M18D 1ZLAD 5GXQC 3C1CC 1P34A 1P3GD 3AZNB 3B0DC
chains in the Genus database with same CATH superfamily
4HGAC 4WU8C 1B6WA 3C1BB 2XD1A 3REKB 3X1VC 3AZID 1KX4D 5B1LC 4YM6D 1P34B 3A1IA 5B2JD 4Z66D 1ID3C 4Z2MH 5CP6A 3AFAD 3AN2C 1P3PA 3W97C 3O62D 2PYOD 5B32C 3AZFA 3B0CT 3H0RC 4ZBJB 3KXBA 1ULYA 3AZMA 1AOID 1HQ3C 2AROD 5GT0A 3AV1D 5CP6B 1P3PB 5B0ZC 3WAAA 5AV6C 3MGSA 3RELC 5B33A 3AZGD 3AZFB 3AV2D 3W99A 5AV9D 3KXBB 3LZ1A 3AZMB 3EPKA 2Y2QA 5GT0B 2NZDD 1P3LA 4KUDA 4UUZA 3W96C 5CPIC 3WAAB 4G92C 3MGSB 3V9RA 5B33B 3W99B 4WU9C 5CPJA 3LZ1B 5B24A 1P3LB 4KUDB 4UUZB 3A6NA 4J8UA 3MGPD 1P3AD 3KXBC 3REJA 3V9RB 5AY8D 1U35A 5CPJB 2Y2HA 4YS3C 1M19A 5B24B 3WAAC 3AYWC 4G91C 3A6NB 3WKJC 4J8UB 4ZUXA 3UT9D 3REJB 5BO0A 4H9QA 1KX5C 1P3LC 1M19B 5BNXA 3IP4C 1EQZA 2DF4C 2HIOC 1WWSA 4ZUXB 1KX3A 1HTAA 5E5AD 5BO0B 4R8PD 4H9QB 5B0YD 5BNXB 3AZJD 4J8WD 3X1UD 1P3OC 3VH6A 5GSUC 3LJAA 1EQZB 1U35C 3B0CW 4J8XA 1KX3B 4QLCD 1M19C 5BS7A 1M1AD 1P3MC 3W98A 3LJAB 4J8XB 5B40D 3AZHA 2XD5A 5CHLB 5GT3A 3W98B 5DNND 3H0LC 3X1TD 4JJNA 5B31G 3UTAC 2NQBC 3AZHB 5BT1C 4CSRA 3AZEC 1R4VA 5GT3B 4XZQA 5JA4A 4J8XC 2CV5A 2DQNC 3FDDA 4JJNB 1TZYC 3WTPA 3P5JB 3LELD 4CSRB 2Y2MA 2Y2JA 3KUYC 2ZY4A 4XZQB 5JA4B 5AVCD 2BYKA 2CV5B 5GXQA 3C1CA 5AV5D 3MGQC 2FJ7C 1JFIA 1A7WA 4KGCD 3X1SC 3WTPB 1M18C 1ZLAC 4WU8A 1B67A 2Y2KA 2BYKB 4Z5TD 4M6BA 5GXQB 5DNMD 3C1CB 5B1LA 1P3GC 2YFVA 1JFIB 3B0DB 1ID3A 5F99A 4HGAB 4WU8B 3B6FD 4NFTA 3W97A 3AN2A 3B6GD 1Q9CA 1KX4C 5B32A 1EQZD 5B1LB 2YFVB 5B2JC 4Z66C 3AFAC 1HQ3A 1ID3B 5F99B 3AZLC 3O62C 3AN2B 2PYOC 5B0ZA 3W97B 3H0MC 3EPJA 5B32B 5AV6A 3RELA 1AOIC 3MNND 2AROC 3AV1C 5B1MD 1HQ3B 4NE3A 2ZY2A 1BH8A 1F66D 2Y2OA 2G5IC 5B0ZB 3W96A 3AV2C 5CPIA 5AVBA 5AV6B 5AV9C 3RELB 3TU4D 3VH5T 4WU9A 5F99C 2NZDC 2F8ND 3UTBD 1BH8B 2JE5A 1BH9A 2JSSA 4EO5C 5CPIB 3W96B 5AVBB 3REIA 4G92B 4H9PA 1P3FA 4WU9B 4JJND 4YS3A 3LZ0D 3AYWA 3MGPC 1P3AC 4E44A 3WKJA 1BH9B 1P3KD 4H9OA 4XUJD 3REIB 5AY8C 4Z2MG 4J8VC 3REHD 4H9PB 5AV8D 1TAFA 1P3FB 3R45A 4YS3B 1KX5A 5B2ID 1P3BD 3KWQD 5AVBC 3AYWB 4G91B 3WKJB 3UT9C 2HIOA 4H9OB 3MVDD 4LD9D 1S32D 1TAFB 3WA9D 3R45B 1KX5B 3EPLA 3MGRD 5BNVA 3REIC 5CPKD 5GSUA 1P3OA 3EPHA 2CWEA 2HIOB 3AZKD 1P3FC 5B31D 4R8PC 5E5AC 3X1VD 5B0YC 1P3ID 3AZJC 4J8WC 3X1UC 5KDMA 1P3MA 5BNVB 1P3OB 5GSUB 3WTPE 4QLCC 1U35B 1F1EA 2F8NG 3AZND 1M1AC 4WJ3C 2RVQD 5KDMB 3C1BD 3REKD 1P3MB 2YFWA 5B40C 3VH5W 3UTAA 4X23C 1P34D 2NQBA 3RELD 3AZEA 5DNNC 3X1TC 2YFWB 3UTAB 2NQBB 1TZYA 3AZEB 3KUYA 5CP6D 1P3PD 2J8PA 5G49A 5JRGA 2FJ7A 3MGQA 3AZFD 3X1SA 3LELC 3KXBD 3AZMD 1TZYB 1M18A 1ZLAA 5GT0D 5AVCC 3KUYB 5G49B 5AV5C 3WAAD 4KGCC 5JRGB 1P3GA 3WKJD 3MGSD 3MGQB 5B33D 2FJ7B 3W99D 3X1SB 3LZ1D 2IO5B 1M18B 1ZLAB 4Z5TC 1P3LD 4KUDD 1KX4A 5DNMC 1P3GB 5B32G 5B2JA 2ZY3A 4Z66A 5CPJD 2Y2LA 3AFAA 3B6FC 4WZSB 3B6GC 3AZLA 4NE6A 3O62A 5B24D 2F8NK 2PYOA 2JCHA 5JRGC 3A6ND 1KX4B 4J8UD 3REJD 1AOIA 5B2JB 2AROA 2IO5C 4Z66B 3AV1A 1U35D 3AL0C 3AFAB 1BFMA 1M19D 3AZLB 3O62B 2F2AC 2PYOB 3AZGA 3AV2A 3VH6T 3MNNC 4ZUXD 5AV9A 1AOIB 5B1MC 2AROB 2ZM5A 3AV1B 1F66C 2NZDA 3AZIC 4YM6C 2VQRA 3TU4C 3AZGB 3AV2B 2HUEC 5AV9B 1KX3D 3UTBC 2NZDB 3MGPA 1P3AA 3A1KA 5C3IC 4EO5B 3LJAD 5AY8A 4J8VA 4J8XD 4H9SC 3LZ0C 1W2EA 2G5HC 1P3KC 3AZGC 3MGPB 1P3AB 3W98D 3UT9A 3REHC 5AV8C 5AY8B 3EG5B 4J8VB 5B2IC 1N1JA 3AZHD 1P3BC 3KWQC 5GT3D 3MVDC 4LD9C 4AWLC 3UT9B 1S32C 5E5AA 4R8PA 3WA9C 5B0YA 1N1JB 3MGRC 3AZJA 4J8WA 3X1UA 2UWXA 5CPKC 2LY8A 3AZKC 4XZQD 5B31C 4QLCA 2CV5D 5E5AB 4R8PB 5B0YB 1P3IC 1M1AA 2Y2GA 3WTPD 4J8WB 3AZJB 3X1UB 1WWIA 3AZLD 3VH6W 5B40A 4QLCB 5GXQD 3AZNC 3C1CD 2FFFB 4X23A 2BYMA 1M1AB 2RVQC 3C1BC 3REKC 4WU8D 5DNNA 4UPKA 5FUGA 3X1TA 1KU5A 5B40B 1P34C 5B1LD 4X23B 2BYMB 2BG1A 1ID3D 5F99D 5DNNB 3AN2D 3W97D 4NE5A 5FUGB 3X1TB 4ZBJC 5B32D 3F6TA 3LELA 5CP6C 1HQ3D 1P3PC 3B0BA 5AVCA 3NQJA 5B0ZD 2F8NH 5AV5A 3AZFC 4KGCA 5AV6D 3AZMC 3LELB 1H3OA 5GT0C 4J8VD 5AVCB 4Z5TA 3NQJB 5DNMA 4DRAA 5AV5B 3MGSC 5B33C 5CPID 3W99C 5AVBD 2RIQA 3W96D 4KGCB 3LZ1C 4WU9D 1H3OB 3B6FA 4KUDC 3B6GA 4Z5TB 5DNMB 3NQUA 3REID 5CPJC 2ZY5A 3KFUG 1P3FD 4YS3D 5B24C 3B6FB 3B6GB 3A6NC 4J8UC 4WV4B 3AYWD 3REJC 3MNNA 3NQUB 5B1MA 2L5AA 1F66A 1KX5D 3AZIA 4YM6A 4ZUXC 3TU4A 2HIOD 3MNNB 2F8NA 3UTBA 5B1MB 1F66B 4E45A 4X23D 3KSYA 3AZIB 1EQZC 4YM6B 1P3OD 3TU4B 5GSUD 1KX3C 2HUEB 2Y2NA 4H9SA 4H9NA 3UTBB 2F8NB 3LZ0A 1P3KA 4XUJA 2Y2IA 3LJAC 5C3IB 1P3MD 3VH5A 3REHA 5AV8A 4CAYA 4H9NB 5BS7C 5B2IA 1P3BA 3LZ0B 3KWQA 3W98C 1P3KB 4XUJB 3MVDA 2W8SA 2Y2PA 4LD9A 1S32A 3REHB 5AV8B 4DQYB 3AZHC 3WA9A 4CAYB 3UTAD 4WNNA 5B2IB 3MGRA 1P3BB 2NQBD 3KWQB 5GT3C 5BT1D 5CPKA 3AZED 1Z2CB 3AZKA 3MVDB 4LD9B 4AWLB 5B31A 1S32B 4JJNC 3X1VA 4H9RA 3WA9B 4KHAA 4DRBA 1P3IA 4WNNB 3MGRB 1TZYD 4XUJC 5CPKB 4XZQC 3KUYD 3AZKB 2CV5C 1PZRA 5B31B 3X1VB 5JRGD 3AZNA 4H9RB 2FJ7D 4KHAB 3MGQD 1T3UA 1P3IB 3WTPC 3X1SD 3C1BA 3REKA 1M18D 1ZLAD 5GXQC 3C1CC 1P34A 1P3GD 3AZNB 3B0DC
chains in the Genus database with same CATH topology
4HGAC 4WU8C 1B6WA 3C1BB 2XD1A 3REKB 3X1VC 3AZID 1KX4D 5B1LC 4YM6D 1P34B 3A1IA 5B2JD 4Z66D 1ID3C 4Z2MH 5CP6A 3AFAD 3AN2C 1P3PA 3W97C 3O62D 2PYOD 5B32C 3AZFA 3B0CT 3H0RC 4ZBJB 3KXBA 1ULYA 3AZMA 1AOID 1HQ3C 2AROD 5GT0A 3AV1D 5CP6B 1P3PB 5B0ZC 3WAAA 5AV6C 3MGSA 3RELC 5B33A 3AZGD 3AZFB 3AV2D 3W99A 5AV9D 3KXBB 3LZ1A 3AZMB 3EPKA 2Y2QA 5GT0B 2NZDD 1P3LA 4KUDA 4UUZA 3W96C 5CPIC 3WAAB 4G92C 3MGSB 3V9RA 5B33B 3W99B 4WU9C 5CPJA 3LZ1B 5B24A 1P3LB 4KUDB 4UUZB 3A6NA 4J8UA 3MGPD 1P3AD 3KXBC 3REJA 3V9RB 5AY8D 1U35A 5CPJB 2Y2HA 4YS3C 1M19A 5B24B 3WAAC 3AYWC 4G91C 3A6NB 3WKJC 4J8UB 4ZUXA 3UT9D 3REJB 5BO0A 4H9QA 1KX5C 1P3LC 1M19B 5BNXA 3IP4C 1EQZA 2DF4C 2HIOC 1WWSA 4ZUXB 1KX3A 1HTAA 5E5AD 5BO0B 4R8PD 4H9QB 5B0YD 5BNXB 3AZJD 4J8WD 3X1UD 1P3OC 3VH6A 5GSUC 3LJAA 1EQZB 1U35C 3B0CW 4J8XA 1KX3B 4QLCD 1M19C 5BS7A 1M1AD 1P3MC 3W98A 3LJAB 4J8XB 5B40D 3AZHA 2XD5A 5CHLB 5GT3A 3W98B 5DNND 3H0LC 3X1TD 4JJNA 5B31G 3UTAC 2NQBC 3AZHB 5BT1C 4CSRA 3AZEC 1R4VA 5GT3B 4XZQA 5JA4A 4J8XC 2CV5A 2DQNC 3FDDA 4JJNB 1TZYC 3WTPA 3P5JB 3LELD 4CSRB 2Y2MA 2Y2JA 3KUYC 2ZY4A 4XZQB 5JA4B 5AVCD 2BYKA 2CV5B 5GXQA 3C1CA 5AV5D 3MGQC 2FJ7C 1JFIA 1A7WA 4KGCD 3X1SC 3WTPB 1M18C 1ZLAC 4WU8A 1B67A 2Y2KA 2BYKB 4Z5TD 4M6BA 5GXQB 5DNMD 3C1CB 5B1LA 1P3GC 2YFVA 1JFIB 3B0DB 1ID3A 5F99A 4HGAB 4WU8B 3B6FD 4NFTA 3W97A 3AN2A 3B6GD 1Q9CA 1KX4C 5B32A 1EQZD 5B1LB 2YFVB 5B2JC 4Z66C 3AFAC 1HQ3A 1ID3B 5F99B 3AZLC 3O62C 3AN2B 2PYOC 5B0ZA 3W97B 3H0MC 3EPJA 5B32B 5AV6A 3RELA 1AOIC 3MNND 2AROC 3AV1C 5B1MD 1HQ3B 4NE3A 2ZY2A 1BH8A 1F66D 2Y2OA 2G5IC 5B0ZB 3W96A 3AV2C 5CPIA 5AVBA 5AV6B 5AV9C 3RELB 3TU4D 3VH5T 4WU9A 5F99C 2NZDC 2F8ND 3UTBD 1BH8B 2JE5A 1BH9A 2JSSA 4EO5C 5CPIB 3W96B 5AVBB 3REIA 4G92B 4H9PA 1P3FA 4WU9B 4JJND 4YS3A 3LZ0D 3AYWA 3MGPC 1P3AC 4E44A 3WKJA 1BH9B 1P3KD 4H9OA 4XUJD 3REIB 5AY8C 4Z2MG 4J8VC 3REHD 4H9PB 5AV8D 1TAFA 1P3FB 3R45A 4YS3B 1KX5A 5B2ID 1P3BD 3KWQD 5AVBC 3AYWB 4G91B 3WKJB 3UT9C 2HIOA 4H9OB 3MVDD 4LD9D 1S32D 1TAFB 3WA9D 3R45B 1KX5B 3EPLA 3MGRD 5BNVA 3REIC 5CPKD 5GSUA 1P3OA 3EPHA 2CWEA 2HIOB 3AZKD 1P3FC 5B31D 4R8PC 5E5AC 3X1VD 5B0YC 1P3ID 3AZJC 4J8WC 3X1UC 5KDMA 1P3MA 5BNVB 1P3OB 5GSUB 3WTPE 4QLCC 1U35B 1F1EA 2F8NG 3AZND 1M1AC 4WJ3C 2RVQD 5KDMB 3C1BD 3REKD 1P3MB 2YFWA 5B40C 3VH5W 3UTAA 4X23C 1P34D 2NQBA 3RELD 3AZEA 5DNNC 3X1TC 2YFWB 3UTAB 2NQBB 1TZYA 3AZEB 3KUYA 5CP6D 1P3PD 2J8PA 5G49A 5JRGA 2FJ7A 3MGQA 3AZFD 3X1SA 3LELC 3KXBD 3AZMD 1TZYB 1M18A 1ZLAA 5GT0D 5AVCC 3KUYB 5G49B 5AV5C 3WAAD 4KGCC 5JRGB 1P3GA 3WKJD 3MGSD 3MGQB 5B33D 2FJ7B 3W99D 3X1SB 3LZ1D 2IO5B 1M18B 1ZLAB 4Z5TC 1P3LD 4KUDD 1KX4A 5DNMC 1P3GB 5B32G 5B2JA 2ZY3A 4Z66A 5CPJD 2Y2LA 3AFAA 3B6FC 4WZSB 3B6GC 3AZLA 4NE6A 3O62A 5B24D 2F8NK 2PYOA 2JCHA 5JRGC 3A6ND 1KX4B 4J8UD 3REJD 1AOIA 5B2JB 2AROA 2IO5C 4Z66B 3AV1A 1U35D 3AL0C 3AFAB 1BFMA 1M19D 3AZLB 3O62B 2F2AC 2PYOB 3AZGA 3AV2A 3VH6T 3MNNC 4ZUXD 5AV9A 1AOIB 5B1MC 2AROB 2ZM5A 3AV1B 1F66C 2NZDA 3AZIC 4YM6C 2VQRA 3TU4C 3AZGB 3AV2B 2HUEC 5AV9B 1KX3D 3UTBC 2NZDB 3MGPA 1P3AA 3A1KA 5C3IC 4EO5B 3LJAD 5AY8A 4J8VA 4J8XD 4H9SC 3LZ0C 1W2EA 2G5HC 1P3KC 3AZGC 3MGPB 1P3AB 3W98D 3UT9A 3REHC 5AV8C 5AY8B 3EG5B 4J8VB 5B2IC 1N1JA 3AZHD 1P3BC 3KWQC 5GT3D 3MVDC 4LD9C 4AWLC 3UT9B 1S32C 5E5AA 4R8PA 3WA9C 5B0YA 1N1JB 3MGRC 3AZJA 4J8WA 3X1UA 2UWXA 5CPKC 2LY8A 3AZKC 4XZQD 5B31C 4QLCA 2CV5D 5E5AB 4R8PB 5B0YB 1P3IC 1M1AA 2Y2GA 3WTPD 4J8WB 3AZJB 3X1UB 1WWIA 3AZLD 3VH6W 5B40A 4QLCB 5GXQD 3AZNC 3C1CD 2FFFB 4X23A 2BYMA 1M1AB 2RVQC 3C1BC 3REKC 4WU8D 5DNNA 4UPKA 5FUGA 3X1TA 1KU5A 5B40B 1P34C 5B1LD 4X23B 2BYMB 2BG1A 1ID3D 5F99D 5DNNB 3AN2D 3W97D 4NE5A 5FUGB 3X1TB 4ZBJC 5B32D 3F6TA 3LELA 5CP6C 1HQ3D 1P3PC 3B0BA 5AVCA 3NQJA 5B0ZD 2F8NH 5AV5A 3AZFC 4KGCA 5AV6D 3AZMC 3LELB 1H3OA 5GT0C 4J8VD 5AVCB 4Z5TA 3NQJB 5DNMA 4DRAA 5AV5B 3MGSC 5B33C 5CPID 3W99C 5AVBD 2RIQA 3W96D 4KGCB 3LZ1C 4WU9D 1H3OB 3B6FA 4KUDC 3B6GA 4Z5TB 5DNMB 3NQUA 3REID 5CPJC 2ZY5A 3KFUG 1P3FD 4YS3D 5B24C 3B6FB 3B6GB 3A6NC 4J8UC 4WV4B 3AYWD 3REJC 3MNNA 3NQUB 5B1MA 2L5AA 1F66A 1KX5D 3AZIA 4YM6A 4ZUXC 3TU4A 2HIOD 3MNNB 2F8NA 3UTBA 5B1MB 1F66B 4E45A 4X23D 3KSYA 3AZIB 1EQZC 4YM6B 1P3OD 3TU4B 5GSUD 1KX3C 2HUEB 2Y2NA 4H9SA 4H9NA 3UTBB 2F8NB 3LZ0A 1P3KA 4XUJA 2Y2IA 3LJAC 5C3IB 1P3MD 3VH5A 3REHA 5AV8A 4CAYA 4H9NB 5BS7C 5B2IA 1P3BA 3LZ0B 3KWQA 3W98C 1P3KB 4XUJB 3MVDA 2W8SA 2Y2PA 4LD9A 1S32A 3REHB 5AV8B 4DQYB 3AZHC 3WA9A 4CAYB 3UTAD 4WNNA 5B2IB 3MGRA 1P3BB 2NQBD 3KWQB 5GT3C 5BT1D 5CPKA 3AZED 1Z2CB 3AZKA 3MVDB 4LD9B 4AWLB 5B31A 1S32B 4JJNC 3X1VA 4H9RA 3WA9B 4KHAA 4DRBA 1P3IA 4WNNB 3MGRB 1TZYD 4XUJC 5CPKB 4XZQC 3KUYD 3AZKB 2CV5C 1PZRA 5B31B 3X1VB 5JRGD 3AZNA 4H9RB 2FJ7D 4KHAB 3MGQD 1T3UA 1P3IB 3WTPC 3X1SD 3C1BA 3REKA 1M18D 1ZLAD 5GXQC 3C1CC 1P34A 1P3GD 3AZNB 3B0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA C;  4WU8 C;  1B6W A;  3C1B B;  3REK B;  3X1V C;  3AZI D;  1KX4 D;  5B1L C;  4YM6 D;  1P34 B;  5B2J D;  4Z66 D;  1ID3 C;  4Z2M H;  5CP6 A;  3AFA D;  3AN2 C;  1P3P A;  3W97 C;  3O62 D;  2PYO D;  5B32 C;  3AZF A;  3B0C T;  4ZBJ B;  3KXB A;  1ULY A;  3AZM A;  1AOI D;  1HQ3 C;  2ARO D;  5GT0 A;  3AV1 D;  5CP6 B;  1P3P B;  5B0Z C;  3WAA A;  5AV6 C;  3MGS A;  3REL C;  5B33 A;  3AZG D;  3AZF B;  3AV2 D;  3W99 A;  5AV9 D;  3KXB B;  3LZ1 A;  3AZM B;  5GT0 B;  2NZD D;  1P3L A;  4KUD A;  4UUZ A;  3W96 C;  5CPI C;  3WAA B;  4G92 C;  3MGS B;  3V9R A;  5B33 B;  3W99 B;  4WU9 C;  5CPJ A;  3LZ1 B;  5B24 A;  1P3L B;  4KUD B;  4UUZ B;  3A6N A;  4J8U A;  3MGP D;  1P3A D;  3KXB C;  3REJ A;  3V9R B;  5AY8 D;  1U35 A;  5CPJ B;  4YS3 C;  1M19 A;  5B24 B;  3WAA C;  3AYW C;  4G91 C;  3A6N B;  3WKJ C;  4J8U B;  4ZUX A;  3UT9 D;  3REJ B;  5BO0 A;  4H9Q A;  1KX5 C;  1P3L C;  1M19 B;  5BNX A;  1EQZ A;  2HIO C;  1WWS A;  4ZUX B;  1KX3 A;  1HTA A;  5E5A D;  5BO0 B;  4R8P D;  4H9Q B;  5B0Y D;  5BNX B;  3AZJ D;  4J8W D;  3X1U D;  1P3O C;  3VH6 A;  5GSU C;  3LJA A;  1EQZ B;  1U35 C;  3B0C W;  4J8X A;  1KX3 B;  4QLC D;  1M19 C;  5BS7 A;  1M1A D;  1P3M C;  3W98 A;  3LJA B;  4J8X B;  5B40 D;  3AZH A;  5CHL B;  5GT3 A;  3W98 B;  5DNN D;  3X1T D;  4JJN A;  5B31 G;  3UTA C;  2NQB C;  3AZH B;  5BT1 C;  4CSR A;  3AZE C;  1R4V A;  5GT3 B;  4XZQ A;  5JA4 A;  4J8X C;  2CV5 A;  4JJN B;  1TZY C;  3WTP A;  3LEL D;  4CSR B;  3KUY C;  4XZQ B;  5JA4 B;  5AVC D;  2BYK A;  2CV5 B;  5GXQ A;  3C1C A;  5AV5 D;  3MGQ C;  2FJ7 C;  1JFI A;  1A7W A;  4KGC D;  3X1S C;  3WTP B;  1M18 C;  1ZLA C;  4WU8 A;  1B67 A;  2BYK B;  4Z5T D;  4M6B A;  5GXQ B;  5DNM D;  3C1C B;  5B1L A;  1P3G C;  2YFV A;  1JFI B;  3B0D B;  1ID3 A;  5F99 A;  4HGA B;  4WU8 B;  3B6F D;  4NFT A;  3W97 A;  3AN2 A;  3B6G D;  1Q9C A;  1KX4 C;  5B32 A;  1EQZ D;  5B1L B;  2YFV B;  5B2J C;  4Z66 C;  3AFA C;  1HQ3 A;  1ID3 B;  5F99 B;  3AZL C;  3O62 C;  3AN2 B;  2PYO C;  5B0Z A;  3W97 B;  5B32 B;  5AV6 A;  3REL A;  1AOI C;  3MNN D;  2ARO C;  3AV1 C;  5B1M D;  1HQ3 B;  4NE3 A;  1F66 D;  1BH8 A;  5B0Z B;  3W96 A;  3AV2 C;  5CPI A;  5AVB A;  5AV6 B;  5AV9 C;  3REL B;  3TU4 D;  3VH5 T;  4WU9 A;  5F99 C;  2NZD C;  2F8N D;  3UTB D;  1BH8 B;  1BH9 A;  2JSS A;  4EO5 C;  5CPI B;  3W96 B;  5AVB B;  3REI A;  4G92 B;  4H9P A;  1P3F A;  4WU9 B;  4JJN D;  4YS3 A;  3LZ0 D;  3AYW A;  3MGP C;  1P3A C;  4E44 A;  3WKJ A;  1BH9 B;  1P3K D;  4H9O A;  4XUJ D;  3REI B;  5AY8 C;  4Z2M G;  4J8V C;  3REH D;  4H9P B;  5AV8 D;  1TAF A;  1P3F B;  3R45 A;  4YS3 B;  1KX5 A;  5B2I D;  1P3B D;  3KWQ D;  5AVB C;  3AYW B;  4G91 B;  3WKJ B;  3UT9 C;  2HIO A;  4H9O B;  3MVD D;  4LD9 D;  1S32 D;  1TAF B;  3WA9 D;  3R45 B;  1KX5 B;  3MGR D;  5BNV A;  3REI C;  5CPK D;  5GSU A;  1P3O A;  2CWE A;  2HIO B;  3AZK D;  1P3F C;  5B31 D;  4R8P C;  5E5A C;  3X1V D;  5B0Y C;  1P3I D;  3AZJ C;  4J8W C;  3X1U C;  5KDM A;  1P3M A;  5BNV B;  1P3O B;  5GSU B;  3WTP E;  4QLC C;  1U35 B;  1F1E A;  2F8N G;  3AZN D;  1M1A C;  2RVQ D;  5KDM B;  3C1B D;  3REK D;  1P3M B;  2YFW A;  5B40 C;  3VH5 W;  3UTA A;  4X23 C;  1P34 D;  2NQB A;  3REL D;  3AZE A;  5DNN C;  3X1T C;  2YFW B;  3UTA B;  2NQB B;  1TZY A;  3AZE B;  3KUY A;  5CP6 D;  1P3P D;  5G49 A;  5JRG A;  2FJ7 A;  3MGQ A;  3AZF D;  3X1S A;  3LEL C;  3KXB D;  3AZM D;  1TZY B;  1M18 A;  1ZLA A;  5GT0 D;  5AVC C;  3KUY B;  5G49 B;  5AV5 C;  3WAA D;  4KGC C;  5JRG B;  1P3G A;  3WKJ D;  3MGS D;  3MGQ B;  5B33 D;  2FJ7 B;  3W99 D;  3X1S B;  3LZ1 D;  2IO5 B;  1M18 B;  1ZLA B;  4Z5T C;  1P3L D;  4KUD D;  1KX4 A;  5DNM C;  1P3G B;  5B32 G;  5B2J A;  4Z66 A;  5CPJ D;  3AFA A;  3B6F C;  4WZS B;  3B6G C;  3AZL A;  4NE6 A;  3O62 A;  5B24 D;  2F8N K;  2PYO A;  5JRG C;  3A6N D;  1KX4 B;  4J8U D;  3REJ D;  1AOI A;  5B2J B;  2ARO A;  2IO5 C;  4Z66 B;  3AV1 A;  1U35 D;  3AFA B;  1BFM A;  1M19 D;  3AZL B;  3O62 B;  2PYO B;  3AZG A;  3AV2 A;  3VH6 T;  3MNN C;  4ZUX D;  5AV9 A;  1AOI B;  5B1M C;  2ARO B;  3AV1 B;  1F66 C;  2NZD A;  3AZI C;  4YM6 C;  3TU4 C;  3AZG B;  3AV2 B;  2HUE C;  5AV9 B;  1KX3 D;  3UTB C;  2NZD B;  3MGP A;  1P3A A;  5C3I C;  4EO5 B;  3LJA D;  5AY8 A;  4J8V A;  4J8X D;  4H9S C;  3LZ0 C;  1P3K C;  3AZG C;  3MGP B;  1P3A B;  3W98 D;  3UT9 A;  3REH C;  5AV8 C;  5AY8 B;  4J8V B;  5B2I C;  1N1J A;  3AZH D;  1P3B C;  3KWQ C;  5GT3 D;  3MVD C;  4LD9 C;  4AWL C;  3UT9 B;  1S32 C;  5E5A A;  4R8P A;  3WA9 C;  5B0Y A;  1N1J B;  3MGR C;  3AZJ A;  4J8W A;  3X1U A;  5CPK C;  2LY8 A;  3AZK C;  4XZQ D;  5B31 C;  4QLC A;  2CV5 D;  5E5A B;  4R8P B;  5B0Y B;  1P3I C;  1M1A A;  3WTP D;  4J8W B;  3AZJ B;  3X1U B;  1WWI A;  3AZL D;  3VH6 W;  5B40 A;  4QLC B;  5GXQ D;  3AZN C;  3C1C D;  4X23 A;  2BYM A;  1M1A B;  2RVQ C;  3C1B C;  3REK C;  4WU8 D;  5DNN A;  5FUG A;  3X1T A;  1KU5 A;  5B40 B;  1P34 C;  5B1L D;  4X23 B;  2BYM B;  1ID3 D;  5F99 D;  5DNN B;  3AN2 D;  3W97 D;  4NE5 A;  5FUG B;  3X1T B;  4ZBJ C;  5B32 D;  3LEL A;  5CP6 C;  1HQ3 D;  1P3P C;  3B0B A;  5AVC A;  3NQJ A;  5B0Z D;  2F8N H;  5AV5 A;  3AZF C;  4KGC A;  5AV6 D;  3AZM C;  3LEL B;  1H3O A;  5GT0 C;  4J8V D;  5AVC B;  4Z5T A;  3NQJ B;  5DNM A;  4DRA A;  5AV5 B;  3MGS C;  5B33 C;  5CPI D;  3W99 C;  5AVB D;  3W96 D;  4KGC B;  3LZ1 C;  4WU9 D;  1H3O B;  3B6F A;  4KUD C;  3B6G A;  4Z5T B;  5DNM B;  3NQU A;  3REI D;  5CPJ C;  1P3F D;  4YS3 D;  5B24 C;  3B6F B;  3B6G B;  3A6N C;  4J8U C;  4WV4 B;  3AYW D;  3REJ C;  3MNN A;  3NQU B;  5B1M A;  2L5A A;  1F66 A;  1KX5 D;  3AZI A;  4YM6 A;  4ZUX C;  3TU4 A;  2HIO D;  3MNN B;  2F8N A;  3UTB A;  5B1M B;  1F66 B;  4E45 A;  4X23 D;  3KSY A;  3AZI B;  1EQZ C;  4YM6 B;  1P3O D;  3TU4 B;  5GSU D;  1KX3 C;  2HUE B;  4H9S A;  4H9N A;  3UTB B;  2F8N B;  3LZ0 A;  1P3K A;  4XUJ A;  3LJA C;  1P3M D;  5C3I B;  3VH5 A;  3REH A;  5AV8 A;  4CAY A;  4H9N B;  5BS7 C;  5B2I A;  1P3B A;  3LZ0 B;  3KWQ A;  3W98 C;  1P3K B;  4XUJ B;  3MVD A;  4LD9 A;  1S32 A;  3REH B;  5AV8 B;  3AZH C;  3WA9 A;  4CAY B;  3UTA D;  4WNN A;  5B2I B;  3MGR A;  1P3B B;  2NQB D;  3KWQ B;  5GT3 C;  5BT1 D;  5CPK A;  3AZE D;  3AZK A;  3MVD B;  4LD9 B;  4AWL B;  5B31 A;  1S32 B;  4JJN C;  3X1V A;  4H9R A;  3WA9 B;  4KHA A;  4DRB A;  1P3I A;  4WNN B;  3MGR B;  1TZY D;  4XUJ C;  5CPK B;  4XZQ C;  3KUY D;  3AZK B;  2CV5 C;  5B31 B;  3X1V B;  5JRG D;  3AZN A;  4H9R B;  2FJ7 D;  4KHA B;  3MGQ D;  1P3I B;  3WTP C;  3X1S D;  3C1B A;  3REK A;  1M18 D;  1ZLA D;  5GXQ C;  3C1C C;  1P34 A;  1P3G D;  3AZN B;  3B0D C; 
#chains in the Genus database with same CATH topology
 4HGA C;  4WU8 C;  1B6W A;  3C1B B;  2XD1 A;  3REK B;  3X1V C;  3AZI D;  1KX4 D;  5B1L C;  4YM6 D;  1P34 B;  3A1I A;  5B2J D;  4Z66 D;  1ID3 C;  4Z2M H;  5CP6 A;  3AFA D;  3AN2 C;  1P3P A;  3W97 C;  3O62 D;  2PYO D;  5B32 C;  3AZF A;  3B0C T;  3H0R C;  4ZBJ B;  3KXB A;  1ULY A;  3AZM A;  1AOI D;  1HQ3 C;  2ARO D;  5GT0 A;  3AV1 D;  5CP6 B;  1P3P B;  5B0Z C;  3WAA A;  5AV6 C;  3MGS A;  3REL C;  5B33 A;  3AZG D;  3AZF B;  3AV2 D;  3W99 A;  5AV9 D;  3KXB B;  3LZ1 A;  3AZM B;  3EPK A;  2Y2Q A;  5GT0 B;  2NZD D;  1P3L A;  4KUD A;  4UUZ A;  3W96 C;  5CPI C;  3WAA B;  4G92 C;  3MGS B;  3V9R A;  5B33 B;  3W99 B;  4WU9 C;  5CPJ A;  3LZ1 B;  5B24 A;  1P3L B;  4KUD B;  4UUZ B;  3A6N A;  4J8U A;  3MGP D;  1P3A D;  3KXB C;  3REJ A;  3V9R B;  5AY8 D;  1U35 A;  5CPJ B;  2Y2H A;  4YS3 C;  1M19 A;  5B24 B;  3WAA C;  3AYW C;  4G91 C;  3A6N B;  3WKJ C;  4J8U B;  4ZUX A;  3UT9 D;  3REJ B;  5BO0 A;  4H9Q A;  1KX5 C;  1P3L C;  1M19 B;  5BNX A;  3IP4 C;  1EQZ A;  2DF4 C;  2HIO C;  1WWS A;  4ZUX B;  1KX3 A;  1HTA A;  5E5A D;  5BO0 B;  4R8P D;  4H9Q B;  5B0Y D;  5BNX B;  3AZJ D;  4J8W D;  3X1U D;  1P3O C;  3VH6 A;  5GSU C;  3LJA A;  1EQZ B;  1U35 C;  3B0C W;  4J8X A;  1KX3 B;  4QLC D;  1M19 C;  5BS7 A;  1M1A D;  1P3M C;  3W98 A;  3LJA B;  4J8X B;  5B40 D;  3AZH A;  2XD5 A;  5CHL B;  5GT3 A;  3W98 B;  5DNN D;  3H0L C;  3X1T D;  4JJN A;  5B31 G;  3UTA C;  2NQB C;  3AZH B;  5BT1 C;  4CSR A;  3AZE C;  1R4V A;  5GT3 B;  4XZQ A;  5JA4 A;  4J8X C;  2CV5 A;  2DQN C;  3FDD A;  4JJN B;  1TZY C;  3WTP A;  3P5J B;  3LEL D;  4CSR B;  2Y2M A;  2Y2J A;  3KUY C;  2ZY4 A;  4XZQ B;  5JA4 B;  5AVC D;  2BYK A;  2CV5 B;  5GXQ A;  3C1C A;  5AV5 D;  3MGQ C;  2FJ7 C;  1JFI A;  1A7W A;  4KGC D;  3X1S C;  3WTP B;  1M18 C;  1ZLA C;  4WU8 A;  1B67 A;  2Y2K A;  2BYK B;  4Z5T D;  4M6B A;  5GXQ B;  5DNM D;  3C1C B;  5B1L A;  1P3G C;  2YFV A;  1JFI B;  3B0D B;  1ID3 A;  5F99 A;  4HGA B;  4WU8 B;  3B6F D;  4NFT A;  3W97 A;  3AN2 A;  3B6G D;  1Q9C A;  1KX4 C;  5B32 A;  1EQZ D;  5B1L B;  2YFV B;  5B2J C;  4Z66 C;  3AFA C;  1HQ3 A;  1ID3 B;  5F99 B;  3AZL C;  3O62 C;  3AN2 B;  2PYO C;  5B0Z A;  3W97 B;  3H0M C;  3EPJ A;  5B32 B;  5AV6 A;  3REL A;  1AOI C;  3MNN D;  2ARO C;  3AV1 C;  5B1M D;  1HQ3 B;  4NE3 A;  2ZY2 A;  1BH8 A;  1F66 D;  2Y2O A;  2G5I C;  5B0Z B;  3W96 A;  3AV2 C;  5CPI A;  5AVB A;  5AV6 B;  5AV9 C;  3REL B;  3TU4 D;  3VH5 T;  4WU9 A;  5F99 C;  2NZD C;  2F8N D;  3UTB D;  1BH8 B;  2JE5 A;  1BH9 A;  2JSS A;  4EO5 C;  5CPI B;  3W96 B;  5AVB B;  3REI A;  4G92 B;  4H9P A;  1P3F A;  4WU9 B;  4JJN D;  4YS3 A;  3LZ0 D;  3AYW A;  3MGP C;  1P3A C;  4E44 A;  3WKJ A;  1BH9 B;  1P3K D;  4H9O A;  4XUJ D;  3REI B;  5AY8 C;  4Z2M G;  4J8V C;  3REH D;  4H9P B;  5AV8 D;  1TAF A;  1P3F B;  3R45 A;  4YS3 B;  1KX5 A;  5B2I D;  1P3B D;  3KWQ D;  5AVB C;  3AYW B;  4G91 B;  3WKJ B;  3UT9 C;  2HIO A;  4H9O B;  3MVD D;  4LD9 D;  1S32 D;  1TAF B;  3WA9 D;  3R45 B;  1KX5 B;  3EPL A;  3MGR D;  5BNV A;  3REI C;  5CPK D;  5GSU A;  1P3O A;  3EPH A;  2CWE A;  2HIO B;  3AZK D;  1P3F C;  5B31 D;  4R8P C;  5E5A C;  3X1V D;  5B0Y C;  1P3I D;  3AZJ C;  4J8W C;  3X1U C;  5KDM A;  1P3M A;  5BNV B;  1P3O B;  5GSU B;  3WTP E;  4QLC C;  1U35 B;  1F1E A;  2F8N G;  3AZN D;  1M1A C;  4WJ3 C;  2RVQ D;  5KDM B;  3C1B D;  3REK D;  1P3M B;  2YFW A;  5B40 C;  3VH5 W;  3UTA A;  4X23 C;  1P34 D;  2NQB A;  3REL D;  3AZE A;  5DNN C;  3X1T C;  2YFW B;  3UTA B;  2NQB B;  1TZY A;  3AZE B;  3KUY A;  5CP6 D;  1P3P D;  2J8P A;  5G49 A;  5JRG A;  2FJ7 A;  3MGQ A;  3AZF D;  3X1S A;  3LEL C;  3KXB D;  3AZM D;  1TZY B;  1M18 A;  1ZLA A;  5GT0 D;  5AVC C;  3KUY B;  5G49 B;  5AV5 C;  3WAA D;  4KGC C;  5JRG B;  1P3G A;  3WKJ D;  3MGS D;  3MGQ B;  5B33 D;  2FJ7 B;  3W99 D;  3X1S B;  3LZ1 D;  2IO5 B;  1M18 B;  1ZLA B;  4Z5T C;  1P3L D;  4KUD D;  1KX4 A;  5DNM C;  1P3G B;  5B32 G;  5B2J A;  2ZY3 A;  4Z66 A;  5CPJ D;  2Y2L A;  3AFA A;  3B6F C;  4WZS B;  3B6G C;  3AZL A;  4NE6 A;  3O62 A;  5B24 D;  2F8N K;  2PYO A;  2JCH A;  5JRG C;  3A6N D;  1KX4 B;  4J8U D;  3REJ D;  1AOI A;  5B2J B;  2ARO A;  2IO5 C;  4Z66 B;  3AV1 A;  1U35 D;  3AL0 C;  3AFA B;  1BFM A;  1M19 D;  3AZL B;  3O62 B;  2F2A C;  2PYO B;  3AZG A;  3AV2 A;  3VH6 T;  3MNN C;  4ZUX D;  5AV9 A;  1AOI B;  5B1M C;  2ARO B;  2ZM5 A;  3AV1 B;  1F66 C;  2NZD A;  3AZI C;  4YM6 C;  2VQR A;  3TU4 C;  3AZG B;  3AV2 B;  2HUE C;  5AV9 B;  1KX3 D;  3UTB C;  2NZD B;  3MGP A;  1P3A A;  3A1K A;  5C3I C;  4EO5 B;  3LJA D;  5AY8 A;  4J8V A;  4J8X D;  4H9S C;  3LZ0 C;  1W2E A;  2G5H C;  1P3K C;  3AZG C;  3MGP B;  1P3A B;  3W98 D;  3UT9 A;  3REH C;  5AV8 C;  5AY8 B;  3EG5 B;  4J8V B;  5B2I C;  1N1J A;  3AZH D;  1P3B C;  3KWQ C;  5GT3 D;  3MVD C;  4LD9 C;  4AWL C;  3UT9 B;  1S32 C;  5E5A A;  4R8P A;  3WA9 C;  5B0Y A;  1N1J B;  3MGR C;  3AZJ A;  4J8W A;  3X1U A;  2UWX A;  5CPK C;  2LY8 A;  3AZK C;  4XZQ D;  5B31 C;  4QLC A;  2CV5 D;  5E5A B;  4R8P B;  5B0Y B;  1P3I C;  1M1A A;  2Y2G A;  3WTP D;  4J8W B;  3AZJ B;  3X1U B;  1WWI A;  3AZL D;  3VH6 W;  5B40 A;  4QLC B;  5GXQ D;  3AZN C;  3C1C D;  2FFF B;  4X23 A;  2BYM A;  1M1A B;  2RVQ C;  3C1B C;  3REK C;  4WU8 D;  5DNN A;  4UPK A;  5FUG A;  3X1T A;  1KU5 A;  5B40 B;  1P34 C;  5B1L D;  4X23 B;  2BYM B;  2BG1 A;  1ID3 D;  5F99 D;  5DNN B;  3AN2 D;  3W97 D;  4NE5 A;  5FUG B;  3X1T B;  4ZBJ C;  5B32 D;  3F6T A;  3LEL A;  5CP6 C;  1HQ3 D;  1P3P C;  3B0B A;  5AVC A;  3NQJ A;  5B0Z D;  2F8N H;  5AV5 A;  3AZF C;  4KGC A;  5AV6 D;  3AZM C;  3LEL B;  1H3O A;  5GT0 C;  4J8V D;  5AVC B;  4Z5T A;  3NQJ B;  5DNM A;  4DRA A;  5AV5 B;  3MGS C;  5B33 C;  5CPI D;  3W99 C;  5AVB D;  2RIQ A;  3W96 D;  4KGC B;  3LZ1 C;  4WU9 D;  1H3O B;  3B6F A;  4KUD C;  3B6G A;  4Z5T B;  5DNM B;  3NQU A;  3REI D;  5CPJ C;  2ZY5 A;  3KFU G;  1P3F D;  4YS3 D;  5B24 C;  3B6F B;  3B6G B;  3A6N C;  4J8U C;  4WV4 B;  3AYW D;  3REJ C;  3MNN A;  3NQU B;  5B1M A;  2L5A A;  1F66 A;  1KX5 D;  3AZI A;  4YM6 A;  4ZUX C;  3TU4 A;  2HIO D;  3MNN B;  2F8N A;  3UTB A;  5B1M B;  1F66 B;  4E45 A;  4X23 D;  3KSY A;  3AZI B;  1EQZ C;  4YM6 B;  1P3O D;  3TU4 B;  5GSU D;  1KX3 C;  2HUE B;  2Y2N A;  4H9S A;  4H9N A;  3UTB B;  2F8N B;  3LZ0 A;  1P3K A;  4XUJ A;  2Y2I A;  3LJA C;  5C3I B;  1P3M D;  3VH5 A;  3REH A;  5AV8 A;  4CAY A;  4H9N B;  5BS7 C;  5B2I A;  1P3B A;  3LZ0 B;  3KWQ A;  3W98 C;  1P3K B;  4XUJ B;  3MVD A;  2W8S A;  2Y2P A;  4LD9 A;  1S32 A;  3REH B;  5AV8 B;  4DQY B;  3AZH C;  3WA9 A;  4CAY B;  3UTA D;  4WNN A;  5B2I B;  3MGR A;  1P3B B;  2NQB D;  3KWQ B;  5GT3 C;  5BT1 D;  5CPK A;  3AZE D;  1Z2C B;  3AZK A;  3MVD B;  4LD9 B;  4AWL B;  5B31 A;  1S32 B;  4JJN C;  3X1V A;  4H9R A;  3WA9 B;  4KHA A;  4DRB A;  1P3I A;  4WNN B;  3MGR B;  1TZY D;  4XUJ C;  5CPK B;  4XZQ C;  3KUY D;  3AZK B;  2CV5 C;  1PZR A;  5B31 B;  3X1V B;  5JRG D;  3AZN A;  4H9R B;  2FJ7 D;  4KHA B;  3MGQ D;  1T3U A;  1P3I B;  3WTP C;  3X1S D;  3C1B A;  3REK A;  1M18 D;  1ZLA D;  5GXQ C;  3C1C C;  1P34 A;  1P3G D;  3AZN B;  3B0D C; 
#chains in the Genus database with same CATH homology
 4HGA C;  4WU8 C;  1B6W A;  3C1B B;  2XD1 A;  3REK B;  3X1V C;  3AZI D;  1KX4 D;  5B1L C;  4YM6 D;  1P34 B;  3A1I A;  5B2J D;  4Z66 D;  1ID3 C;  4Z2M H;  5CP6 A;  3AFA D;  3AN2 C;  1P3P A;  3W97 C;  3O62 D;  2PYO D;  5B32 C;  3AZF A;  3B0C T;  3H0R C;  4ZBJ B;  3KXB A;  1ULY A;  3AZM A;  1AOI D;  1HQ3 C;  2ARO D;  5GT0 A;  3AV1 D;  5CP6 B;  1P3P B;  5B0Z C;  3WAA A;  5AV6 C;  3MGS A;  3REL C;  5B33 A;  3AZG D;  3AZF B;  3AV2 D;  3W99 A;  5AV9 D;  3KXB B;  3LZ1 A;  3AZM B;  3EPK A;  2Y2Q A;  5GT0 B;  2NZD D;  1P3L A;  4KUD A;  4UUZ A;  3W96 C;  5CPI C;  3WAA B;  4G92 C;  3MGS B;  3V9R A;  5B33 B;  3W99 B;  4WU9 C;  5CPJ A;  3LZ1 B;  5B24 A;  1P3L B;  4KUD B;  4UUZ B;  3A6N A;  4J8U A;  3MGP D;  1P3A D;  3KXB C;  3REJ A;  3V9R B;  5AY8 D;  1U35 A;  5CPJ B;  2Y2H A;  4YS3 C;  1M19 A;  5B24 B;  3WAA C;  3AYW C;  4G91 C;  3A6N B;  3WKJ C;  4J8U B;  4ZUX A;  3UT9 D;  3REJ B;  5BO0 A;  4H9Q A;  1KX5 C;  1P3L C;  1M19 B;  5BNX A;  3IP4 C;  1EQZ A;  2DF4 C;  2HIO C;  1WWS A;  4ZUX B;  1KX3 A;  1HTA A;  5E5A D;  5BO0 B;  4R8P D;  4H9Q B;  5B0Y D;  5BNX B;  3AZJ D;  4J8W D;  3X1U D;  1P3O C;  3VH6 A;  5GSU C;  3LJA A;  1EQZ B;  1U35 C;  3B0C W;  4J8X A;  1KX3 B;  4QLC D;  1M19 C;  5BS7 A;  1M1A D;  1P3M C;  3W98 A;  3LJA B;  4J8X B;  5B40 D;  3AZH A;  2XD5 A;  5CHL B;  5GT3 A;  3W98 B;  5DNN D;  3H0L C;  3X1T D;  4JJN A;  5B31 G;  3UTA C;  2NQB C;  3AZH B;  5BT1 C;  4CSR A;  3AZE C;  1R4V A;  5GT3 B;  4XZQ A;  5JA4 A;  4J8X C;  2CV5 A;  2DQN C;  3FDD A;  4JJN B;  1TZY C;  3WTP A;  3P5J B;  3LEL D;  4CSR B;  2Y2M A;  2Y2J A;  3KUY C;  2ZY4 A;  4XZQ B;  5JA4 B;  5AVC D;  2BYK A;  2CV5 B;  5GXQ A;  3C1C A;  5AV5 D;  3MGQ C;  2FJ7 C;  1JFI A;  1A7W A;  4KGC D;  3X1S C;  3WTP B;  1M18 C;  1ZLA C;  4WU8 A;  1B67 A;  2Y2K A;  2BYK B;  4Z5T D;  4M6B A;  5GXQ B;  5DNM D;  3C1C B;  5B1L A;  1P3G C;  2YFV A;  1JFI B;  3B0D B;  1ID3 A;  5F99 A;  4HGA B;  4WU8 B;  3B6F D;  4NFT A;  3W97 A;  3AN2 A;  3B6G D;  1Q9C A;  1KX4 C;  5B32 A;  1EQZ D;  5B1L B;  2YFV B;  5B2J C;  4Z66 C;  3AFA C;  1HQ3 A;  1ID3 B;  5F99 B;  3AZL C;  3O62 C;  3AN2 B;  2PYO C;  5B0Z A;  3W97 B;  3H0M C;  3EPJ A;  5B32 B;  5AV6 A;  3REL A;  1AOI C;  3MNN D;  2ARO C;  3AV1 C;  5B1M D;  1HQ3 B;  4NE3 A;  2ZY2 A;  1BH8 A;  1F66 D;  2Y2O A;  2G5I C;  5B0Z B;  3W96 A;  3AV2 C;  5CPI A;  5AVB A;  5AV6 B;  5AV9 C;  3REL B;  3TU4 D;  3VH5 T;  4WU9 A;  5F99 C;  2NZD C;  2F8N D;  3UTB D;  1BH8 B;  2JE5 A;  1BH9 A;  2JSS A;  4EO5 C;  5CPI B;  3W96 B;  5AVB B;  3REI A;  4G92 B;  4H9P A;  1P3F A;  4WU9 B;  4JJN D;  4YS3 A;  3LZ0 D;  3AYW A;  3MGP C;  1P3A C;  4E44 A;  3WKJ A;  1BH9 B;  1P3K D;  4H9O A;  4XUJ D;  3REI B;  5AY8 C;  4Z2M G;  4J8V C;  3REH D;  4H9P B;  5AV8 D;  1TAF A;  1P3F B;  3R45 A;  4YS3 B;  1KX5 A;  5B2I D;  1P3B D;  3KWQ D;  5AVB C;  3AYW B;  4G91 B;  3WKJ B;  3UT9 C;  2HIO A;  4H9O B;  3MVD D;  4LD9 D;  1S32 D;  1TAF B;  3WA9 D;  3R45 B;  1KX5 B;  3EPL A;  3MGR D;  5BNV A;  3REI C;  5CPK D;  5GSU A;  1P3O A;  3EPH A;  2CWE A;  2HIO B;  3AZK D;  1P3F C;  5B31 D;  4R8P C;  5E5A C;  3X1V D;  5B0Y C;  1P3I D;  3AZJ C;  4J8W C;  3X1U C;  5KDM A;  1P3M A;  5BNV B;  1P3O B;  5GSU B;  3WTP E;  4QLC C;  1U35 B;  1F1E A;  2F8N G;  3AZN D;  1M1A C;  4WJ3 C;  2RVQ D;  5KDM B;  3C1B D;  3REK D;  1P3M B;  2YFW A;  5B40 C;  3VH5 W;  3UTA A;  4X23 C;  1P34 D;  2NQB A;  3REL D;  3AZE A;  5DNN C;  3X1T C;  2YFW B;  3UTA B;  2NQB B;  1TZY A;  3AZE B;  3KUY A;  5CP6 D;  1P3P D;  2J8P A;  5G49 A;  5JRG A;  2FJ7 A;  3MGQ A;  3AZF D;  3X1S A;  3LEL C;  3KXB D;  3AZM D;  1TZY B;  1M18 A;  1ZLA A;  5GT0 D;  5AVC C;  3KUY B;  5G49 B;  5AV5 C;  3WAA D;  4KGC C;  5JRG B;  1P3G A;  3WKJ D;  3MGS D;  3MGQ B;  5B33 D;  2FJ7 B;  3W99 D;  3X1S B;  3LZ1 D;  2IO5 B;  1M18 B;  1ZLA B;  4Z5T C;  1P3L D;  4KUD D;  1KX4 A;  5DNM C;  1P3G B;  5B32 G;  5B2J A;  2ZY3 A;  4Z66 A;  5CPJ D;  2Y2L A;  3AFA A;  3B6F C;  4WZS B;  3B6G C;  3AZL A;  4NE6 A;  3O62 A;  5B24 D;  2F8N K;  2PYO A;  2JCH A;  5JRG C;  3A6N D;  1KX4 B;  4J8U D;  3REJ D;  1AOI A;  5B2J B;  2ARO A;  2IO5 C;  4Z66 B;  3AV1 A;  1U35 D;  3AL0 C;  3AFA B;  1BFM A;  1M19 D;  3AZL B;  3O62 B;  2F2A C;  2PYO B;  3AZG A;  3AV2 A;  3VH6 T;  3MNN C;  4ZUX D;  5AV9 A;  1AOI B;  5B1M C;  2ARO B;  2ZM5 A;  3AV1 B;  1F66 C;  2NZD A;  3AZI C;  4YM6 C;  2VQR A;  3TU4 C;  3AZG B;  3AV2 B;  2HUE C;  5AV9 B;  1KX3 D;  3UTB C;  2NZD B;  3MGP A;  1P3A A;  3A1K A;  5C3I C;  4EO5 B;  3LJA D;  5AY8 A;  4J8V A;  4J8X D;  4H9S C;  3LZ0 C;  1W2E A;  2G5H C;  1P3K C;  3AZG C;  3MGP B;  1P3A B;  3W98 D;  3UT9 A;  3REH C;  5AV8 C;  5AY8 B;  3EG5 B;  4J8V B;  5B2I C;  1N1J A;  3AZH D;  1P3B C;  3KWQ C;  5GT3 D;  3MVD C;  4LD9 C;  4AWL C;  3UT9 B;  1S32 C;  5E5A A;  4R8P A;  3WA9 C;  5B0Y A;  1N1J B;  3MGR C;  3AZJ A;  4J8W A;  3X1U A;  2UWX A;  5CPK C;  2LY8 A;  3AZK C;  4XZQ D;  5B31 C;  4QLC A;  2CV5 D;  5E5A B;  4R8P B;  5B0Y B;  1P3I C;  1M1A A;  2Y2G A;  3WTP D;  4J8W B;  3AZJ B;  3X1U B;  1WWI A;  3AZL D;  3VH6 W;  5B40 A;  4QLC B;  5GXQ D;  3AZN C;  3C1C D;  2FFF B;  4X23 A;  2BYM A;  1M1A B;  2RVQ C;  3C1B C;  3REK C;  4WU8 D;  5DNN A;  4UPK A;  5FUG A;  3X1T A;  1KU5 A;  5B40 B;  1P34 C;  5B1L D;  4X23 B;  2BYM B;  2BG1 A;  1ID3 D;  5F99 D;  5DNN B;  3AN2 D;  3W97 D;  4NE5 A;  5FUG B;  3X1T B;  4ZBJ C;  5B32 D;  3F6T A;  3LEL A;  5CP6 C;  1HQ3 D;  1P3P C;  3B0B A;  5AVC A;  3NQJ A;  5B0Z D;  2F8N H;  5AV5 A;  3AZF C;  4KGC A;  5AV6 D;  3AZM C;  3LEL B;  1H3O A;  5GT0 C;  4J8V D;  5AVC B;  4Z5T A;  3NQJ B;  5DNM A;  4DRA A;  5AV5 B;  3MGS C;  5B33 C;  5CPI D;  3W99 C;  5AVB D;  2RIQ A;  3W96 D;  4KGC B;  3LZ1 C;  4WU9 D;  1H3O B;  3B6F A;  4KUD C;  3B6G A;  4Z5T B;  5DNM B;  3NQU A;  3REI D;  5CPJ C;  2ZY5 A;  3KFU G;  1P3F D;  4YS3 D;  5B24 C;  3B6F B;  3B6G B;  3A6N C;  4J8U C;  4WV4 B;  3AYW D;  3REJ C;  3MNN A;  3NQU B;  5B1M A;  2L5A A;  1F66 A;  1KX5 D;  3AZI A;  4YM6 A;  4ZUX C;  3TU4 A;  2HIO D;  3MNN B;  2F8N A;  3UTB A;  5B1M B;  1F66 B;  4E45 A;  4X23 D;  3KSY A;  3AZI B;  1EQZ C;  4YM6 B;  1P3O D;  3TU4 B;  5GSU D;  1KX3 C;  2HUE B;  2Y2N A;  4H9S A;  4H9N A;  3UTB B;  2F8N B;  3LZ0 A;  1P3K A;  4XUJ A;  2Y2I A;  3LJA C;  5C3I B;  1P3M D;  3VH5 A;  3REH A;  5AV8 A;  4CAY A;  4H9N B;  5BS7 C;  5B2I A;  1P3B A;  3LZ0 B;  3KWQ A;  3W98 C;  1P3K B;  4XUJ B;  3MVD A;  2W8S A;  2Y2P A;  4LD9 A;  1S32 A;  3REH B;  5AV8 B;  4DQY B;  3AZH C;  3WA9 A;  4CAY B;  3UTA D;  4WNN A;  5B2I B;  3MGR A;  1P3B B;  2NQB D;  3KWQ B;  5GT3 C;  5BT1 D;  5CPK A;  3AZE D;  1Z2C B;  3AZK A;  3MVD B;  4LD9 B;  4AWL B;  5B31 A;  1S32 B;  4JJN C;  3X1V A;  4H9R A;  3WA9 B;  4KHA A;  4DRB A;  1P3I A;  4WNN B;  3MGR B;  1TZY D;  4XUJ C;  5CPK B;  4XZQ C;  3KUY D;  3AZK B;  2CV5 C;  1PZR A;  5B31 B;  3X1V B;  5JRG D;  3AZN A;  4H9R B;  2FJ7 D;  4KHA B;  3MGQ D;  1T3U A;  1P3I B;  3WTP C;  3X1S D;  3C1B A;  3REK A;  1M18 D;  1ZLA D;  5GXQ C;  3C1C C;  1P34 A;  1P3G D;  3AZN B;  3B0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...