1BFMA

Histone b from methanothermus fervidus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histone protein
molecule keywords HISTONE B
publication title NMR structure of HMfB from the hyperthermophile, Methanothermus fervidus, confirms that this archaeal protein is a histone.
pubmed doi rcsb
source organism Methanothermus fervidus
total genus 20
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bfmA00
3UTBD 3AN2A 1P3OC 4H9RA 3WTPE 1KU5A 4WV4B 4EO5B 5AV6B 4CSRA 4WU9C 3REIC 4KGCC 2HIOC 3WTPA 3X1UB 5B0ZB 3X1TB 1S32A 2CV5D 1M19A 3WA9D 3O62A 2IO5B 5CPJC 4WU8D 5GSUA 4YM6D 3UT9A 4XZQC 4R8PB 1KX5B 3A6NA 5B31D 5DNND 1M1AD 3W98C 5BNVA 3AZKB 3NQJB 5JRGA 2FJ7C 4EO5C 2F8ND 5AV6C 3KWQA 5CHLB 5B0YA 1AOID 3AZHC 1P3LD 4J8VA 5GT0C 4J8XD 5B0ZC 4WU8B 4LD9C 1F66A 1P3MA 4YM6B 3B6FD 5KDMA 3LJAC 2NZDA 3KUYA 1BH8A 5AY8A 1P34A 3UTBC 4KHAB 5B31B 1M1AB 2IO5C 3MGQA 2PYOB 5AV8C 4M6BA 1KX3B 3MGSB 4UUZA 2BYMA 3B0DC 1M18C 1AOIB 5GXQA 4G91B 3AFAD 1P3FA 4Z66D 4J8XB 3AZGA 3B6FB 2CV5C 2RVQD 5AVCC 3WA9C 1ZLAA 1P3PA 4JJNA 5DNNC 3KUYD 5AV9C 3MNND 1M1AC 1H3OB 5B33A 3RELD 3AFAB 1ID3B 4Z66B 4YS3A 4G91C 5FUGA 4G92B 5B1LB 1P3LC 5B2ID 4J8XC 3V9RA 1HTAA 3MGPA 5E5AA 3B6FC 1TAFA 5DNMD 1S32C 1P3ID 5B2JA 1M19C 1KX4D 3MNNB 3KSYA 3REKA 3MVDA 3REHD 4J8WD 1P3KD 1EQZA 5GSUC 4Z5TD 3AZLB 3UT9C 3AZNA 5B32A 3AV1D 3A6NC 3NQUA 5AVBD 3B0CW 3B0BA 3AFAC 1P3OD 4Z2MG 1U35A 5B2IB 3UTAA 3AZMA 5JA4B 3B0CT 3C1CA 4AWLB 4H9NB 4WU9D 3X1SA 5B0YC 1P3IB 5B1MA 3W96D 3AV2A 3REHB 4J8WB 1P3KB 1P3AD 1F66C 4Z5TB 3AV1B 3KUYC 5CPJD 4H9QA 3RELC 4NE6A 1P3OB 4XZQD 3AYWA 4WNNA 5CPID 1N1JB 5GT3A 3W98D 4WU9B 5BO0B 3B6GD 3REIB 4HGAC 1P3FC 2FJ7D 2HIOB 4DRBA 4X23D 3AZMD 1P3AB 3X1UA 1BH9B 5DNMC 1P3IC 2YFVB 3X1TA 1KX4C 5GT0D 5CPJB 3REHC 4J8WC 1P3KC 5CPKA 1ZLAC 3LJAD 4XZQB 3AV1C 5CPIB 5AVBC 4R8PA 1KX5A 3W98B 5AV8D 5CP6A 3AZKA 4KUDD 5B40A 2FJ7B 4XUJD 4ZBJC 4NE5A 4J8UA 1M18D 3W99A 3AZHB 4NFTA 3AZED 3W96C 5GT0B 2F8NK 4LD9B 3W97A 1P3AC 3LJAB 5AVCD 3UTBB 5G49B 3REKC 5AV8B 1EQZC 4KUDB 5CPIC 3AZNC 1P3GA 1KX3A 5AV9D 3MGSA 4H9PB 3B0DB 1M18B 3B6GC 5F99A 3AN2D 5CP6D 3AZEB 3UTAC 1TZYA 4X23C 3AZMC 2CV5B 5AVCB 3REJA 3WA9B 2AROA 2NQBA 3WKJA 3WTPD 3AZIA 1S32D 1M19D 3AZFA 5DNNB 5AV9B 5BT1D 5B32G 3O62D 5GSUD 3AN2B 4KUDC 3UT9D 2CWEA 4H9SA 4H9RB 4XUJC 3A6ND 2F8NB 1ID3A 4E44A 1R4VA 5GT3C 4CSRB 3WAAA 1P3LB 4CAYA 3AZEC 5JRGD 3KWQD 5B0YD 3LELA 5BNXA 1S32B 1M19B 1ULYA 4J8VD 3O62B 3X1VA 5B24A 1B6WA 3WKJD 5GSUB 5CPKC 1F66D 1HQ3A 2LY8A 3UT9B 1P3MD 2NZDD 1P34D 5AY8D 5BS7A 3A6NB 3AZLA 5BNVB 1JFIA 3MGQD 3AN2C 5AV5A 5CP6C 3C1BA 5JRGB 5B40C 1P3BA 3KWQB 5B0YB 3KXBA 4J8UC 5GXQD 1P3FD 2YFWB 3AZJA 3WTPC 3MGRA 4ZUXA 3AZGD 1F66B 3W97C 1P3MB 2NZDB 5KDMB 4QLCA 4H9OB 1BH8B 5AY8B 5BT1C 3KUYB 1P34B 3O62C 3RELB 1ZLAD 3MGQB 2BYKA 1P3PD 5B24D 4JJND 4UUZB 5C3IC 2BYMB 1N1JA 3R45A 5B33D 3TU4A 5F99C 4HGAB 1P3FB 5JRGC 3REIA 2F8NH 4YS3D 2HIOA 2HUEC 3KWQC 4KGCA 1TZYC 4WZSB 3AZGB 5DNMB 3LZ0A 1KX4B 3LZ1A 4J8VC 2AROC 3WKJC 1ZLAB 3MGPD 1P3PB 5E5AD 1P3MC 2NZDC 4JJNB 1P34C 5AY8C 5AVBB 5B2JD 3REKD 3MVDD 3MGQC 5B33B 1EQZD 3VH6A 3AZND 5B32D 4ZBJB 4YS3B 5AV6A 3VH6W 5GXQC 5FUGB 3AZHA 3W96B 1U35D 3V9RB 3UTAD 3C1CD 3MGPB 3AZGC 5B0ZA 4LD9A 3X1SD 1TAFB 3VH6T 5B2JB 5B1MD 3REKB 3UTBA 3AV2D 1P3PC 3X1VC 5B24C 1EQZB 3VH5T 4JJNC 1HQ3C 3AZNB 5B32B 3NQUB 1WWIA 3B6GB 5B33C 3NQJA 5AV5C 3AYWD 1U35B 4YS3C 3UTAB 4X23B 5GT3D 3AZMB 3KXBC 2CV5A 5B1MB 3WA9A 3AZJC 3AV2B 3MGPC 5E5AC 4WU8A 3MGRC 4ZUXC 3X1UD 4YM6A 5B2JC 3X1TD 4KHAA 5B31A 3MVDC 5DNNA 1M1AA 4H9QB 5CPKD 2PYOA 4XUJB 3AYWB 5B32C 4WNNB 4R8PD 5GT3B 1KX5D 2F8NA 1AOIA 3TU4C 3AZKD 5B40D 1U35C 1P3LA 4J8XA 3C1CC 3X1SC 4J8UD 3W99D 3B6FA 3LZ0C 5B1MC 3LZ1C 3AV2C 5CPKB 3W97D 1WWSA 1H3OA 5CP6B 5B40B 3AFAA 3AYWC 2PYOD 1P3GD 1KX3D 3MGSD 4Z66A 4J8UB 3W99B 5F99D 5B1LA 1F1EA 3WTPB 2YFWA 4NE3A 1TZYD 3W97B 3X1UC 3REJD 3X1TC 2AROD 4H9OA 2NQBD 3MNNA 3RELA 3AZID 3AZFD 1P3GB 4R8PC 5C3IB 1KX5C 5F99B 3AZKC 2HUEB 5B2IA 1ID3D 4E45A 1TZYB 5JA4A 3W99C 3WAAD 4H9NA 1Q9CA 5DNMA 3REJB 4J8VB 1P3IA 5B1LD 2AROB 1KX4A 2NQBB 3WKJB 3REHA 4J8WA 1P3KA 4WU8C 3AZIB 3LELD 4Z5TA 4YM6C 3AZFB 3AV1A 5AVBA 5B31C 3X1VD 1HQ3D 1P3OA 2PYOC 1P3GC 3AZLD 3MGSC 1KX3C 3WAAB 5GXQB 4WU9A 5BO0A 1B67A 4CAYB 5AV5D 1AOIC 3C1BD 1P3BD 3W96A 4Z2MH 3KXBD 1P3AA 3LELB 5BNXB 1BH9A 3REJC 2YFVA 3AZJD 2NQBC 5B31G 3MGRD 3X1VB 5B24B 5CPJA 4ZUXD 3AZIC 1HQ3B 4XZQA 4QLCD 3AZFC 5CPIA 3W98A 1JFIB 2F8NG 3B6GA 5AV5B 1BFMA 4H9SC 3C1BB 1P3BB 2FJ7A 1ID3C 4DRAA 4Z66C 3WAAC 4X23A 3KXBB 3TU4D 3VH5A 2RVQC 4G92C 1A7WA 5B1LC 3AZJB 5GT0A 3REID 4KGCD 5E5AB 2HIOD 3VH5W 3MGRB 4ZUXB 2JSSA 3LELC 3LJAA 4QLCB 3LZ0D 3LZ1D 3MVDB 5G49A 3MNNC 2BYKB 5AV8A 4KUDA 5BS7C 3AZLC 4XUJA 4H9PA 3R45B 3TU4B 1M18A 3C1BC 1P3BC 3AZEA 3C1CB 4KGCB 5B2IC 3X1SB 5AV6D 4AWLC 5AVCA 3LZ0B 3AZHD 3LZ1B 2L5AA 5B0ZD 4LD9D 4QLCC 4Z5TC 5AV9A
chains in the Genus database with same CATH superfamily
3UTBD 3AN2A 2W8SA 2Y2LA 1P3OC 4H9RA 3WTPE 1KU5A 2ZM5A 4WV4B 4EO5B 5AV6B 4CSRA 4WU9C 3REIC 4KGCC 2HIOC 3WTPA 3X1UB 5B0ZB 3X1TB 1S32A 2CV5D 1M19A 3WA9D 3O62A 2IO5B 5CPJC 4WU8D 5GSUA 4YM6D 3UT9A 4XZQC 4R8PB 1KX5B 3A6NA 5B31D 5DNND 1M1AD 3W98C 5BNVA 3AZKB 3NQJB 2JCHA 5JRGA 2FJ7C 4EO5C 2F8ND 5AV6C 3KWQA 5CHLB 5B0YA 1AOID 3AZHC 2VQRA 1P3LD 4J8VA 5GT0C 4J8XD 5B0ZC 4WU8B 4LD9C 1F66A 1P3MA 4YM6B 3B6FD 5KDMA 3LJAC 2NZDA 3KUYA 1BH8A 5AY8A 1P34A 3UTBC 4KHAB 5B31B 1M1AB 2IO5C 3H0MC 3MGQA 2PYOB 5AV8C 4M6BA 1KX3B 3MGSB 4UUZA 2BYMA 3B0DC 1M18C 1AOIB 5GXQA 4G91B 3AFAD 1P3FA 4Z66D 4J8XB 3AZGA 3B6FB 2CV5C 2RVQD 5AVCC 3WA9C 1ZLAA 2Y2MA 1P3PA 4JJNA 5DNNC 3KUYD 5AV9C 3MNND 1M1AC 1H3OB 5B33A 3RELD 3AFAB 1ID3B 4Z66B 4YS3A 2G5IC 4G91C 5FUGA 4G92B 5B1LB 1P3LC 5B2ID 4J8XC 3V9RA 1HTAA 3MGPA 5E5AA 3B6FC 1TAFA 5DNMD 1S32C 2F2AC 1P3ID 5B2JA 1M19C 1KX4D 3MNNB 3KSYA 3REKA 3MVDA 3REHD 4J8WD 1P3KD 1EQZA 5GSUC 2Y2PA 4Z5TD 3AZLB 3UT9C 3AZNA 5B32A 3AV1D 3A6NC 3NQUA 5AVBD 3B0CW 2Y2NA 3B0BA 3AFAC 1P3OD 4Z2MG 1U35A 5B2IB 3UTAA 3AZMA 5JA4B 3B0CT 3C1CA 4AWLB 4H9NB 4WU9D 3X1SA 3AL0C 5B0YC 1P3IB 5B1MA 3W96D 3AV2A 3REHB 4J8WB 1P3KB 1P3AD 1F66C 4Z5TB 3AV1B 3KUYC 5CPJD 4H9QA 3RELC 2ZY3A 4NE6A 1P3OB 4XZQD 3AYWA 4WNNA 5CPID 1N1JB 2ZY4A 5GT3A 3W98D 3IP4C 4WU9B 5BO0B 3B6GD 3REIB 4HGAC 1P3FC 2FJ7D 2HIOB 4DRBA 4X23D 3AZMD 1P3AB 3X1UA 1BH9B 5DNMC 1P3IC 2YFVB 3X1TA 1KX4C 5GT0D 5CPJB 3REHC 4J8WC 1P3KC 5CPKA 1ZLAC 3LJAD 2UWXA 4XZQB 3AV1C 5CPIB 5AVBC 4R8PA 1KX5A 3W98B 5AV8D 5CP6A 3AZKA 4KUDD 5B40A 2FJ7B 4XUJD 4DQYB 4ZBJC 4NE5A 4J8UA 1M18D 3W99A 3AZHB 4NFTA 3AZED 3W96C 5GT0B 2F8NK 4LD9B 3W97A 1P3AC 3LJAB 5AVCD 3UTBB 5G49B 3EPLA 3REKC 5AV8B 1EQZC 4KUDB 5CPIC 3AZNC 1P3GA 1KX3A 5AV9D 3MGSA 4H9PB 3B0DB 1M18B 3B6GC 5F99A 3AN2D 5CP6D 3AZEB 4WJ3C 3UTAC 1TZYA 4X23C 3AZMC 2CV5B 5AVCB 3REJA 3WA9B 2BG1A 2AROA 2NQBA 3WKJA 3WTPD 2XD1A 3AZIA 1S32D 1M19D 3AZFA 2Y2KA 5DNNB 5AV9B 5BT1D 5B32G 3O62D 5GSUD 3AN2B 4KUDC 3UT9D 2CWEA 2DQNC 4H9SA 4H9RB 4XUJC 2ZY5A 3A6ND 2F8NB 1ID3A 4E44A 2Y2OA 1R4VA 5GT3C 4CSRB 3WAAA 1P3LB 4CAYA 3AZEC 5JRGD 3KWQD 5B0YD 3LELA 5BNXA 1S32B 1M19B 1ULYA 4J8VD 3O62B 3X1VA 5B24A 1B6WA 3WKJD 5GSUB 5CPKC 1F66D 1HQ3A 2LY8A 3UT9B 3F6TA 1P3MD 2NZDD 2RIQA 1P34D 5AY8D 5BS7A 3A6NB 3AZLA 5BNVB 1JFIA 3MGQD 3AN2C 5AV5A 5CP6C 3C1BA 5JRGB 5B40C 1P3BA 3KWQB 5B0YB 3KXBA 4J8UC 5GXQD 1W2EA 1P3FD 2YFWB 3AZJA 3WTPC 3MGRA 4ZUXA 3AZGD 1F66B 3W97C 1P3MB 2NZDB 5KDMB 4QLCA 4H9OB 1BH8B 5AY8B 5BT1C 3KUYB 1P34B 3O62C 3EPKA 3RELB 1ZLAD 3MGQB 2BYKA 1P3PD 5B24D 4JJND 2G5HC 4UUZB 5C3IC 2BYMB 1N1JA 3R45A 5B33D 3TU4A 5F99C 4HGAB 1P3FB 5JRGC 3REIA 2F8NH 4YS3D 2HIOA 2HUEC 3KWQC 4KGCA 1TZYC 4WZSB 3AZGB 5DNMB 3LZ0A 1KX4B 2Y2GA 3LZ1A 4J8VC 2AROC 2Y2JA 3WKJC 1ZLAB 3MGPD 1P3PB 5E5AD 1Z2CB 2XD5A 1P3MC 4JJNB 2NZDC 1P34C 5AY8C 5AVBB 5B2JD 3REKD 3MVDD 3MGQC 5B33B 1EQZD 3VH6A 3AZND 5B32D 4ZBJB 4YS3B 5AV6A 3VH6W 5GXQC 5FUGB 2ZY2A 3AZHA 3W96B 1U35D 3V9RB 3UTAD 3C1CD 3MGPB 3AZGC 5B0ZA 4LD9A 3X1SD 1TAFB 3VH6T 5B2JB 1T3UA 5B1MD 3REKB 3UTBA 3AV2D 2Y2HA 1P3PC 3X1VC 2DF4C 5B24C 3A1IA 3VH5T 4JJNC 1EQZB 1HQ3C 3AZNB 3KFUG 5B32B 3NQUB 1WWIA 3B6GB 5B33C 3NQJA 5AV5C 3AYWD 1U35B 4YS3C 3UTAB 4X23B 5GT3D 3AZMB 3KXBC 2CV5A 3EPHA 5B1MB 3WA9A 3AZJC 3AV2B 3MGPC 5E5AC 4WU8A 3MGRC 4ZUXC 3X1UD 4YM6A 5B2JC 3X1TD 4KHAA 5B31A 3MVDC 5DNNA 1M1AA 4H9QB 5CPKD 2PYOA 4XUJB 3AYWB 5B32C 4WNNB 4R8PD 5GT3B 1KX5D 2F8NA 1AOIA 3TU4C 3AZKD 5B40D 1U35C 1P3LA 4J8XA 3C1CC 3X1SC 4J8UD 3W99D 3B6FA 3LZ0C 5B1MC 4UPKA 3LZ1C 3AV2C 5CPKB 3W97D 2Y2IA 1WWSA 1H3OA 5CP6B 5B40B 3AFAA 3AYWC 2PYOD 1P3GD 1KX3D 3MGSD 4Z66A 4J8UB 3W99B 5F99D 5B1LA 1F1EA 3WTPB 2YFWA 4NE3A 1TZYD 3P5JB 3W97B 3X1UC 3REJD 3X1TC 2AROD 4H9OA 2NQBD 3MNNA 3RELA 3AZID 3AZFD 1P3GB 4R8PC 5C3IB 1KX5C 5F99B 3AZKC 3FDDA 2HUEB 5B2IA 1ID3D 4E45A 1TZYB 5JA4A 3W99C 3WAAD 4H9NA 1Q9CA 5DNMA 3REJB 4J8VB 1P3IA 5B1LD 2AROB 1KX4A 2NQBB 3WKJB 3REHA 4J8WA 1P3KA 4WU8C 3AZIB 3LELD 4Z5TA 4YM6C 3AZFB 3AV1A 5AVBA 5B31C 2Y2QA 3X1VD 1HQ3D 1P3OA 2PYOC 2JE5A 1P3GC 3A1KA 3MGSC 3AZLD 1KX3C 1PZRA 3WAAB 5GXQB 4WU9A 5BO0A 1B67A 4CAYB 5AV5D 1AOIC 3C1BD 1P3BD 3W96A 4Z2MH 3KXBD 1P3AA 3LELB 5BNXB 1BH9A 3REJC 2YFVA 3AZJD 2NQBC 3H0RC 5B31G 3MGRD 3X1VB 5B24B 5CPJA 4ZUXD 3AZIC 1HQ3B 4XZQA 4QLCD 3AZFC 5CPIA 3W98A 1JFIB 2F8NG 3B6GA 5AV5B 1BFMA 4H9SC 3C1BB 1P3BB 2FJ7A 1ID3C 4DRAA 4Z66C 3WAAC 4X23A 3KXBB 3TU4D 3VH5A 3H0LC 2RVQC 4G92C 1A7WA 5B1LC 3AZJB 5GT0A 3REID 4KGCD 5E5AB 2HIOD 3VH5W 3MGRB 4ZUXB 2JSSA 3LELC 3LJAA 4QLCB 3EPJA 3LZ0D 3LZ1D 3MVDB 5G49A 3MNNC 2BYKB 5AV8A 4KUDA 5BS7C 3AZLC 4XUJA 4H9PA 2J8PA 3R45B 3TU4B 1M18A 3C1BC 1P3BC 3AZEA 3C1CB 4KGCB 5B2IC 3X1SB 5AV6D 4AWLC 5AVCA 3LZ0B 3AZHD 3LZ1B 2L5AA 5B0ZD 4LD9D 2FFFB 4QLCC 3EG5B 4Z5TC 5AV9A
chains in the Genus database with same CATH topology
3UTBD 3AN2A 2W8SA 2Y2LA 1P3OC 4H9RA 3WTPE 1KU5A 2ZM5A 4WV4B 4EO5B 5AV6B 4CSRA 4WU9C 3REIC 4KGCC 2HIOC 3WTPA 3X1UB 5B0ZB 3X1TB 1S32A 2CV5D 1M19A 3WA9D 3O62A 2IO5B 5CPJC 4WU8D 5GSUA 4YM6D 3UT9A 4XZQC 4R8PB 1KX5B 3A6NA 5B31D 5DNND 1M1AD 3W98C 5BNVA 3AZKB 3NQJB 2JCHA 5JRGA 2FJ7C 4EO5C 2F8ND 5AV6C 3KWQA 5CHLB 5B0YA 1AOID 3AZHC 2VQRA 1P3LD 4J8VA 5GT0C 4J8XD 5B0ZC 4WU8B 4LD9C 1F66A 1P3MA 4YM6B 3B6FD 5KDMA 3LJAC 2NZDA 3KUYA 1BH8A 5AY8A 1P34A 3UTBC 4KHAB 5B31B 1M1AB 2IO5C 3H0MC 3MGQA 2PYOB 5AV8C 4M6BA 1KX3B 3MGSB 4UUZA 2BYMA 3B0DC 1M18C 1AOIB 5GXQA 4G91B 3AFAD 1P3FA 4Z66D 4J8XB 3AZGA 3B6FB 2CV5C 2RVQD 5AVCC 3WA9C 1ZLAA 2Y2MA 1P3PA 4JJNA 5DNNC 3KUYD 5AV9C 3MNND 1M1AC 1H3OB 5B33A 3RELD 3AFAB 1ID3B 4Z66B 4YS3A 2G5IC 4G91C 5FUGA 4G92B 5B1LB 1P3LC 5B2ID 4J8XC 3V9RA 1HTAA 3MGPA 5E5AA 3B6FC 1TAFA 5DNMD 1S32C 2F2AC 1P3ID 5B2JA 1M19C 1KX4D 3MNNB 3KSYA 3REKA 3MVDA 3REHD 4J8WD 1P3KD 1EQZA 5GSUC 2Y2PA 4Z5TD 3AZLB 3UT9C 3AZNA 5B32A 3AV1D 3A6NC 3NQUA 5AVBD 3B0CW 2Y2NA 3B0BA 3AFAC 1P3OD 4Z2MG 1U35A 5B2IB 3UTAA 3AZMA 5JA4B 3B0CT 3C1CA 4AWLB 4H9NB 4WU9D 3X1SA 3AL0C 5B0YC 1P3IB 5B1MA 3W96D 3AV2A 3REHB 4J8WB 1P3KB 1P3AD 1F66C 4Z5TB 3AV1B 3KUYC 5CPJD 4H9QA 3RELC 2ZY3A 4NE6A 1P3OB 4XZQD 3AYWA 4WNNA 5CPID 1N1JB 2ZY4A 5GT3A 3W98D 3IP4C 4WU9B 5BO0B 3B6GD 3REIB 4HGAC 1P3FC 2FJ7D 2HIOB 4DRBA 4X23D 3AZMD 1P3AB 3X1UA 1BH9B 5DNMC 1P3IC 2YFVB 3X1TA 1KX4C 5GT0D 5CPJB 3REHC 4J8WC 1P3KC 5CPKA 1ZLAC 3LJAD 2UWXA 4XZQB 3AV1C 5CPIB 5AVBC 4R8PA 1KX5A 3W98B 5AV8D 5CP6A 3AZKA 4KUDD 5B40A 2FJ7B 4XUJD 4DQYB 4ZBJC 4NE5A 4J8UA 1M18D 3W99A 3AZHB 4NFTA 3AZED 3W96C 5GT0B 2F8NK 4LD9B 3W97A 1P3AC 3LJAB 5AVCD 3UTBB 5G49B 3EPLA 3REKC 5AV8B 1EQZC 4KUDB 5CPIC 3AZNC 1P3GA 1KX3A 5AV9D 3MGSA 4H9PB 3B0DB 1M18B 3B6GC 5F99A 3AN2D 5CP6D 3AZEB 4WJ3C 3UTAC 1TZYA 4X23C 3AZMC 2CV5B 5AVCB 3REJA 3WA9B 2BG1A 2AROA 2NQBA 3WKJA 3WTPD 2XD1A 3AZIA 1S32D 1M19D 3AZFA 2Y2KA 5DNNB 5AV9B 5BT1D 5B32G 3O62D 5GSUD 3AN2B 4KUDC 3UT9D 2CWEA 2DQNC 4H9SA 4H9RB 4XUJC 2ZY5A 3A6ND 2F8NB 1ID3A 4E44A 2Y2OA 1R4VA 5GT3C 4CSRB 3WAAA 1P3LB 4CAYA 3AZEC 5JRGD 3KWQD 5B0YD 3LELA 5BNXA 1S32B 1M19B 1ULYA 4J8VD 3O62B 3X1VA 5B24A 1B6WA 3WKJD 5GSUB 5CPKC 1F66D 1HQ3A 2LY8A 3UT9B 3F6TA 1P3MD 2NZDD 2RIQA 1P34D 5AY8D 5BS7A 3A6NB 3AZLA 5BNVB 1JFIA 3MGQD 3AN2C 5AV5A 5CP6C 3C1BA 5JRGB 5B40C 1P3BA 3KWQB 5B0YB 3KXBA 4J8UC 5GXQD 1W2EA 1P3FD 2YFWB 3AZJA 3WTPC 3MGRA 4ZUXA 3AZGD 1F66B 3W97C 1P3MB 2NZDB 5KDMB 4QLCA 4H9OB 1BH8B 5AY8B 5BT1C 3KUYB 1P34B 3O62C 3EPKA 3RELB 1ZLAD 3MGQB 2BYKA 1P3PD 5B24D 4JJND 2G5HC 4UUZB 5C3IC 2BYMB 1N1JA 3R45A 5B33D 3TU4A 5F99C 4HGAB 1P3FB 5JRGC 3REIA 2F8NH 4YS3D 2HIOA 2HUEC 3KWQC 4KGCA 1TZYC 4WZSB 3AZGB 5DNMB 3LZ0A 1KX4B 2Y2GA 3LZ1A 4J8VC 2AROC 2Y2JA 3WKJC 1ZLAB 3MGPD 1P3PB 5E5AD 1Z2CB 2XD5A 1P3MC 4JJNB 2NZDC 1P34C 5AY8C 5AVBB 5B2JD 3REKD 3MVDD 3MGQC 5B33B 1EQZD 3VH6A 3AZND 5B32D 4ZBJB 4YS3B 5AV6A 3VH6W 5GXQC 5FUGB 2ZY2A 3AZHA 3W96B 1U35D 3V9RB 3UTAD 3C1CD 3MGPB 3AZGC 5B0ZA 4LD9A 3X1SD 1TAFB 3VH6T 5B2JB 1T3UA 5B1MD 3REKB 3UTBA 3AV2D 2Y2HA 1P3PC 3X1VC 2DF4C 5B24C 3A1IA 3VH5T 4JJNC 1EQZB 1HQ3C 3AZNB 3KFUG 5B32B 3NQUB 1WWIA 3B6GB 5B33C 3NQJA 5AV5C 3AYWD 1U35B 4YS3C 3UTAB 4X23B 5GT3D 3AZMB 3KXBC 2CV5A 3EPHA 5B1MB 3WA9A 3AZJC 3AV2B 3MGPC 5E5AC 4WU8A 3MGRC 4ZUXC 3X1UD 4YM6A 5B2JC 3X1TD 4KHAA 5B31A 3MVDC 5DNNA 1M1AA 4H9QB 5CPKD 2PYOA 4XUJB 3AYWB 5B32C 4WNNB 4R8PD 5GT3B 1KX5D 2F8NA 1AOIA 3TU4C 3AZKD 5B40D 1U35C 1P3LA 4J8XA 3C1CC 3X1SC 4J8UD 3W99D 3B6FA 3LZ0C 5B1MC 4UPKA 3LZ1C 3AV2C 5CPKB 3W97D 2Y2IA 1WWSA 1H3OA 5CP6B 5B40B 3AFAA 3AYWC 2PYOD 1P3GD 1KX3D 3MGSD 4Z66A 4J8UB 3W99B 5F99D 5B1LA 1F1EA 3WTPB 2YFWA 4NE3A 1TZYD 3P5JB 3W97B 3X1UC 3REJD 3X1TC 2AROD 4H9OA 2NQBD 3MNNA 3RELA 3AZID 3AZFD 1P3GB 4R8PC 5C3IB 1KX5C 5F99B 3AZKC 3FDDA 2HUEB 5B2IA 1ID3D 4E45A 1TZYB 5JA4A 3W99C 3WAAD 4H9NA 1Q9CA 5DNMA 3REJB 4J8VB 1P3IA 5B1LD 2AROB 1KX4A 2NQBB 3WKJB 3REHA 4J8WA 1P3KA 4WU8C 3AZIB 3LELD 4Z5TA 4YM6C 3AZFB 3AV1A 5AVBA 5B31C 2Y2QA 3X1VD 1HQ3D 1P3OA 2PYOC 2JE5A 1P3GC 3A1KA 3MGSC 3AZLD 1KX3C 1PZRA 3WAAB 5GXQB 4WU9A 5BO0A 1B67A 4CAYB 5AV5D 1AOIC 3C1BD 1P3BD 3W96A 4Z2MH 3KXBD 1P3AA 3LELB 5BNXB 1BH9A 3REJC 2YFVA 3AZJD 2NQBC 3H0RC 5B31G 3MGRD 3X1VB 5B24B 5CPJA 4ZUXD 3AZIC 1HQ3B 4XZQA 4QLCD 3AZFC 5CPIA 3W98A 1JFIB 2F8NG 3B6GA 5AV5B 1BFMA 4H9SC 3C1BB 1P3BB 2FJ7A 1ID3C 4DRAA 4Z66C 3WAAC 4X23A 3KXBB 3TU4D 3VH5A 3H0LC 2RVQC 4G92C 1A7WA 5B1LC 3AZJB 5GT0A 3REID 4KGCD 5E5AB 2HIOD 3VH5W 3MGRB 4ZUXB 2JSSA 3LELC 3LJAA 4QLCB 3EPJA 3LZ0D 3LZ1D 3MVDB 5G49A 3MNNC 2BYKB 5AV8A 4KUDA 5BS7C 3AZLC 4XUJA 4H9PA 2J8PA 3R45B 3TU4B 1M18A 3C1BC 1P3BC 3AZEA 3C1CB 4KGCB 5B2IC 3X1SB 5AV6D 4AWLC 5AVCA 3LZ0B 3AZHD 3LZ1B 2L5AA 5B0ZD 4LD9D 2FFFB 4QLCC 3EG5B 4Z5TC 5AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB D;  3AN2 A;  1P3O C;  4H9R A;  3WTP E;  1KU5 A;  4WV4 B;  4EO5 B;  5AV6 B;  4CSR A;  4WU9 C;  3REI C;  4KGC C;  2HIO C;  3WTP A;  3X1U B;  5B0Z B;  3X1T B;  1S32 A;  2CV5 D;  1M19 A;  3WA9 D;  3O62 A;  2IO5 B;  5CPJ C;  4WU8 D;  5GSU A;  4YM6 D;  3UT9 A;  4XZQ C;  4R8P B;  1KX5 B;  3A6N A;  5B31 D;  5DNN D;  1M1A D;  3W98 C;  5BNV A;  3AZK B;  3NQJ B;  5JRG A;  2FJ7 C;  4EO5 C;  2F8N D;  5AV6 C;  3KWQ A;  5CHL B;  5B0Y A;  1AOI D;  3AZH C;  1P3L D;  4J8V A;  5GT0 C;  4J8X D;  5B0Z C;  4WU8 B;  4LD9 C;  1F66 A;  1P3M A;  4YM6 B;  3B6F D;  5KDM A;  3LJA C;  2NZD A;  3KUY A;  1BH8 A;  5AY8 A;  1P34 A;  3UTB C;  4KHA B;  5B31 B;  1M1A B;  2IO5 C;  3MGQ A;  2PYO B;  5AV8 C;  4M6B A;  1KX3 B;  3MGS B;  4UUZ A;  2BYM A;  3B0D C;  1M18 C;  1AOI B;  5GXQ A;  4G91 B;  3AFA D;  1P3F A;  4Z66 D;  4J8X B;  3AZG A;  3B6F B;  2CV5 C;  2RVQ D;  5AVC C;  3WA9 C;  1ZLA A;  1P3P A;  4JJN A;  5DNN C;  3KUY D;  5AV9 C;  3MNN D;  1M1A C;  1H3O B;  5B33 A;  3REL D;  3AFA B;  1ID3 B;  4Z66 B;  4YS3 A;  4G91 C;  5FUG A;  4G92 B;  5B1L B;  1P3L C;  5B2I D;  4J8X C;  3V9R A;  1HTA A;  3MGP A;  5E5A A;  3B6F C;  1TAF A;  5DNM D;  1S32 C;  1P3I D;  5B2J A;  1M19 C;  1KX4 D;  3MNN B;  3KSY A;  3REK A;  3MVD A;  3REH D;  4J8W D;  1P3K D;  1EQZ A;  5GSU C;  4Z5T D;  3AZL B;  3UT9 C;  3AZN A;  5B32 A;  3AV1 D;  3A6N C;  3NQU A;  5AVB D;  3B0C W;  3B0B A;  3AFA C;  1P3O D;  4Z2M G;  1U35 A;  5B2I B;  3UTA A;  3AZM A;  5JA4 B;  3B0C T;  3C1C A;  4AWL B;  4H9N B;  4WU9 D;  3X1S A;  5B0Y C;  1P3I B;  5B1M A;  3W96 D;  3AV2 A;  3REH B;  4J8W B;  1P3K B;  1P3A D;  1F66 C;  4Z5T B;  3AV1 B;  3KUY C;  5CPJ D;  4H9Q A;  3REL C;  4NE6 A;  1P3O B;  4XZQ D;  3AYW A;  4WNN A;  5CPI D;  1N1J B;  5GT3 A;  3W98 D;  4WU9 B;  5BO0 B;  3B6G D;  3REI B;  4HGA C;  1P3F C;  2FJ7 D;  2HIO B;  4DRB A;  4X23 D;  3AZM D;  1P3A B;  3X1U A;  1BH9 B;  5DNM C;  1P3I C;  2YFV B;  3X1T A;  1KX4 C;  5GT0 D;  5CPJ B;  3REH C;  4J8W C;  1P3K C;  5CPK A;  1ZLA C;  3LJA D;  4XZQ B;  3AV1 C;  5CPI B;  5AVB C;  4R8P A;  1KX5 A;  3W98 B;  5AV8 D;  5CP6 A;  3AZK A;  4KUD D;  5B40 A;  2FJ7 B;  4XUJ D;  4ZBJ C;  4NE5 A;  4J8U A;  1M18 D;  3W99 A;  3AZH B;  4NFT A;  3AZE D;  3W96 C;  5GT0 B;  2F8N K;  4LD9 B;  3W97 A;  1P3A C;  3LJA B;  5AVC D;  3UTB B;  5G49 B;  3REK C;  5AV8 B;  1EQZ C;  4KUD B;  5CPI C;  3AZN C;  1P3G A;  1KX3 A;  5AV9 D;  3MGS A;  4H9P B;  3B0D B;  1M18 B;  3B6G C;  5F99 A;  3AN2 D;  5CP6 D;  3AZE B;  3UTA C;  1TZY A;  4X23 C;  3AZM C;  2CV5 B;  5AVC B;  3REJ A;  3WA9 B;  2ARO A;  2NQB A;  3WKJ A;  3WTP D;  3AZI A;  1S32 D;  1M19 D;  3AZF A;  5DNN B;  5AV9 B;  5BT1 D;  5B32 G;  3O62 D;  5GSU D;  3AN2 B;  4KUD C;  3UT9 D;  2CWE A;  4H9S A;  4H9R B;  4XUJ C;  3A6N D;  2F8N B;  1ID3 A;  4E44 A;  1R4V A;  5GT3 C;  4CSR B;  3WAA A;  1P3L B;  4CAY A;  3AZE C;  5JRG D;  3KWQ D;  5B0Y D;  3LEL A;  5BNX A;  1S32 B;  1M19 B;  1ULY A;  4J8V D;  3O62 B;  3X1V A;  5B24 A;  1B6W A;  3WKJ D;  5GSU B;  5CPK C;  1F66 D;  1HQ3 A;  2LY8 A;  3UT9 B;  1P3M D;  2NZD D;  1P34 D;  5AY8 D;  5BS7 A;  3A6N B;  3AZL A;  5BNV B;  1JFI A;  3MGQ D;  3AN2 C;  5AV5 A;  5CP6 C;  3C1B A;  5JRG B;  5B40 C;  1P3B A;  3KWQ B;  5B0Y B;  3KXB A;  4J8U C;  5GXQ D;  1P3F D;  2YFW B;  3AZJ A;  3WTP C;  3MGR A;  4ZUX A;  3AZG D;  1F66 B;  3W97 C;  1P3M B;  2NZD B;  5KDM B;  4QLC A;  4H9O B;  1BH8 B;  5AY8 B;  5BT1 C;  3KUY B;  1P34 B;  3O62 C;  3REL B;  1ZLA D;  3MGQ B;  2BYK A;  1P3P D;  5B24 D;  4JJN D;  4UUZ B;  5C3I C;  2BYM B;  1N1J A;  3R45 A;  5B33 D;  3TU4 A;  5F99 C;  4HGA B;  1P3F B;  5JRG C;  3REI A;  2F8N H;  4YS3 D;  2HIO A;  2HUE C;  3KWQ C;  4KGC A;  1TZY C;  4WZS B;  3AZG B;  5DNM B;  3LZ0 A;  1KX4 B;  3LZ1 A;  4J8V C;  2ARO C;  3WKJ C;  1ZLA B;  3MGP D;  1P3P B;  5E5A D;  1P3M C;  2NZD C;  4JJN B;  1P34 C;  5AY8 C;  5AVB B;  5B2J D;  3REK D;  3MVD D;  3MGQ C;  5B33 B;  1EQZ D;  3VH6 A;  3AZN D;  5B32 D;  4ZBJ B;  4YS3 B;  5AV6 A;  3VH6 W;  5GXQ C;  5FUG B;  3AZH A;  3W96 B;  1U35 D;  3V9R B;  3UTA D;  3C1C D;  3MGP B;  3AZG C;  5B0Z A;  4LD9 A;  3X1S D;  1TAF B;  3VH6 T;  5B2J B;  5B1M D;  3REK B;  3UTB A;  3AV2 D;  1P3P C;  3X1V C;  5B24 C;  1EQZ B;  3VH5 T;  4JJN C;  1HQ3 C;  3AZN B;  5B32 B;  3NQU B;  1WWI A;  3B6G B;  5B33 C;  3NQJ A;  5AV5 C;  3AYW D;  1U35 B;  4YS3 C;  3UTA B;  4X23 B;  5GT3 D;  3AZM B;  3KXB C;  2CV5 A;  5B1M B;  3WA9 A;  3AZJ C;  3AV2 B;  3MGP C;  5E5A C;  4WU8 A;  3MGR C;  4ZUX C;  3X1U D;  4YM6 A;  5B2J C;  3X1T D;  4KHA A;  5B31 A;  3MVD C;  5DNN A;  1M1A A;  4H9Q B;  5CPK D;  2PYO A;  4XUJ B;  3AYW B;  5B32 C;  4WNN B;  4R8P D;  5GT3 B;  1KX5 D;  2F8N A;  1AOI A;  3TU4 C;  3AZK D;  5B40 D;  1U35 C;  1P3L A;  4J8X A;  3C1C C;  3X1S C;  4J8U D;  3W99 D;  3B6F A;  3LZ0 C;  5B1M C;  3LZ1 C;  3AV2 C;  5CPK B;  3W97 D;  1WWS A;  1H3O A;  5CP6 B;  5B40 B;  3AFA A;  3AYW C;  2PYO D;  1P3G D;  1KX3 D;  3MGS D;  4Z66 A;  4J8U B;  3W99 B;  5F99 D;  5B1L A;  1F1E A;  3WTP B;  2YFW A;  4NE3 A;  1TZY D;  3W97 B;  3X1U C;  3REJ D;  3X1T C;  2ARO D;  4H9O A;  2NQB D;  3MNN A;  3REL A;  3AZI D;  3AZF D;  1P3G B;  4R8P C;  5C3I B;  1KX5 C;  5F99 B;  3AZK C;  2HUE B;  5B2I A;  1ID3 D;  4E45 A;  1TZY B;  5JA4 A;  3W99 C;  3WAA D;  4H9N A;  1Q9C A;  5DNM A;  3REJ B;  4J8V B;  1P3I A;  5B1L D;  2ARO B;  1KX4 A;  2NQB B;  3WKJ B;  3REH A;  4J8W A;  1P3K A;  4WU8 C;  3AZI B;  3LEL D;  4Z5T A;  4YM6 C;  3AZF B;  3AV1 A;  5AVB A;  5B31 C;  3X1V D;  1HQ3 D;  1P3O A;  2PYO C;  1P3G C;  3AZL D;  3MGS C;  1KX3 C;  3WAA B;  5GXQ B;  4WU9 A;  5BO0 A;  1B67 A;  4CAY B;  5AV5 D;  1AOI C;  3C1B D;  1P3B D;  3W96 A;  4Z2M H;  3KXB D;  1P3A A;  3LEL B;  5BNX B;  1BH9 A;  3REJ C;  2YFV A;  3AZJ D;  2NQB C;  5B31 G;  3MGR D;  3X1V B;  5B24 B;  5CPJ A;  4ZUX D;  3AZI C;  1HQ3 B;  4XZQ A;  4QLC D;  3AZF C;  5CPI A;  3W98 A;  1JFI B;  2F8N G;  3B6G A;  5AV5 B;  1BFM A;  4H9S C;  3C1B B;  1P3B B;  2FJ7 A;  1ID3 C;  4DRA A;  4Z66 C;  3WAA C;  4X23 A;  3KXB B;  3TU4 D;  3VH5 A;  2RVQ C;  4G92 C;  1A7W A;  5B1L C;  3AZJ B;  5GT0 A;  3REI D;  4KGC D;  5E5A B;  2HIO D;  3VH5 W;  3MGR B;  4ZUX B;  2JSS A;  3LEL C;  3LJA A;  4QLC B;  3LZ0 D;  3LZ1 D;  3MVD B;  5G49 A;  3MNN C;  2BYK B;  5AV8 A;  4KUD A;  5BS7 C;  3AZL C;  4XUJ A;  4H9P A;  3R45 B;  3TU4 B;  1M18 A;  3C1B C;  1P3B C;  3AZE A;  3C1C B;  4KGC B;  5B2I C;  3X1S B;  5AV6 D;  4AWL C;  5AVC A;  3LZ0 B;  3AZH D;  3LZ1 B;  2L5A A;  5B0Z D;  4LD9 D;  4QLC C;  4Z5T C;  5AV9 A; 
#chains in the Genus database with same CATH topology
 3UTB D;  3AN2 A;  2W8S A;  2Y2L A;  1P3O C;  4H9R A;  3WTP E;  1KU5 A;  2ZM5 A;  4WV4 B;  4EO5 B;  5AV6 B;  4CSR A;  4WU9 C;  3REI C;  4KGC C;  2HIO C;  3WTP A;  3X1U B;  5B0Z B;  3X1T B;  1S32 A;  2CV5 D;  1M19 A;  3WA9 D;  3O62 A;  2IO5 B;  5CPJ C;  4WU8 D;  5GSU A;  4YM6 D;  3UT9 A;  4XZQ C;  4R8P B;  1KX5 B;  3A6N A;  5B31 D;  5DNN D;  1M1A D;  3W98 C;  5BNV A;  3AZK B;  3NQJ B;  2JCH A;  5JRG A;  2FJ7 C;  4EO5 C;  2F8N D;  5AV6 C;  3KWQ A;  5CHL B;  5B0Y A;  1AOI D;  3AZH C;  2VQR A;  1P3L D;  4J8V A;  5GT0 C;  4J8X D;  5B0Z C;  4WU8 B;  4LD9 C;  1F66 A;  1P3M A;  4YM6 B;  3B6F D;  5KDM A;  3LJA C;  2NZD A;  3KUY A;  1BH8 A;  5AY8 A;  1P34 A;  3UTB C;  4KHA B;  5B31 B;  1M1A B;  2IO5 C;  3H0M C;  3MGQ A;  2PYO B;  5AV8 C;  4M6B A;  1KX3 B;  3MGS B;  4UUZ A;  2BYM A;  3B0D C;  1M18 C;  1AOI B;  5GXQ A;  4G91 B;  3AFA D;  1P3F A;  4Z66 D;  4J8X B;  3AZG A;  3B6F B;  2CV5 C;  2RVQ D;  5AVC C;  3WA9 C;  1ZLA A;  2Y2M A;  1P3P A;  4JJN A;  5DNN C;  3KUY D;  5AV9 C;  3MNN D;  1M1A C;  1H3O B;  5B33 A;  3REL D;  3AFA B;  1ID3 B;  4Z66 B;  4YS3 A;  2G5I C;  4G91 C;  5FUG A;  4G92 B;  5B1L B;  1P3L C;  5B2I D;  4J8X C;  3V9R A;  1HTA A;  3MGP A;  5E5A A;  3B6F C;  1TAF A;  5DNM D;  1S32 C;  2F2A C;  1P3I D;  5B2J A;  1M19 C;  1KX4 D;  3MNN B;  3KSY A;  3REK A;  3MVD A;  3REH D;  4J8W D;  1P3K D;  1EQZ A;  5GSU C;  2Y2P A;  4Z5T D;  3AZL B;  3UT9 C;  3AZN A;  5B32 A;  3AV1 D;  3A6N C;  3NQU A;  5AVB D;  3B0C W;  2Y2N A;  3B0B A;  3AFA C;  1P3O D;  4Z2M G;  1U35 A;  5B2I B;  3UTA A;  3AZM A;  5JA4 B;  3B0C T;  3C1C A;  4AWL B;  4H9N B;  4WU9 D;  3X1S A;  3AL0 C;  5B0Y C;  1P3I B;  5B1M A;  3W96 D;  3AV2 A;  3REH B;  4J8W B;  1P3K B;  1P3A D;  1F66 C;  4Z5T B;  3AV1 B;  3KUY C;  5CPJ D;  4H9Q A;  3REL C;  2ZY3 A;  4NE6 A;  1P3O B;  4XZQ D;  3AYW A;  4WNN A;  5CPI D;  1N1J B;  2ZY4 A;  5GT3 A;  3W98 D;  3IP4 C;  4WU9 B;  5BO0 B;  3B6G D;  3REI B;  4HGA C;  1P3F C;  2FJ7 D;  2HIO B;  4DRB A;  4X23 D;  3AZM D;  1P3A B;  3X1U A;  1BH9 B;  5DNM C;  1P3I C;  2YFV B;  3X1T A;  1KX4 C;  5GT0 D;  5CPJ B;  3REH C;  4J8W C;  1P3K C;  5CPK A;  1ZLA C;  3LJA D;  2UWX A;  4XZQ B;  3AV1 C;  5CPI B;  5AVB C;  4R8P A;  1KX5 A;  3W98 B;  5AV8 D;  5CP6 A;  3AZK A;  4KUD D;  5B40 A;  2FJ7 B;  4XUJ D;  4DQY B;  4ZBJ C;  4NE5 A;  4J8U A;  1M18 D;  3W99 A;  3AZH B;  4NFT A;  3AZE D;  3W96 C;  5GT0 B;  2F8N K;  4LD9 B;  3W97 A;  1P3A C;  3LJA B;  5AVC D;  3UTB B;  5G49 B;  3EPL A;  3REK C;  5AV8 B;  1EQZ C;  4KUD B;  5CPI C;  3AZN C;  1P3G A;  1KX3 A;  5AV9 D;  3MGS A;  4H9P B;  3B0D B;  1M18 B;  3B6G C;  5F99 A;  3AN2 D;  5CP6 D;  3AZE B;  4WJ3 C;  3UTA C;  1TZY A;  4X23 C;  3AZM C;  2CV5 B;  5AVC B;  3REJ A;  3WA9 B;  2BG1 A;  2ARO A;  2NQB A;  3WKJ A;  3WTP D;  2XD1 A;  3AZI A;  1S32 D;  1M19 D;  3AZF A;  2Y2K A;  5DNN B;  5AV9 B;  5BT1 D;  5B32 G;  3O62 D;  5GSU D;  3AN2 B;  4KUD C;  3UT9 D;  2CWE A;  2DQN C;  4H9S A;  4H9R B;  4XUJ C;  2ZY5 A;  3A6N D;  2F8N B;  1ID3 A;  4E44 A;  2Y2O A;  1R4V A;  5GT3 C;  4CSR B;  3WAA A;  1P3L B;  4CAY A;  3AZE C;  5JRG D;  3KWQ D;  5B0Y D;  3LEL A;  5BNX A;  1S32 B;  1M19 B;  1ULY A;  4J8V D;  3O62 B;  3X1V A;  5B24 A;  1B6W A;  3WKJ D;  5GSU B;  5CPK C;  1F66 D;  1HQ3 A;  2LY8 A;  3UT9 B;  3F6T A;  1P3M D;  2NZD D;  2RIQ A;  1P34 D;  5AY8 D;  5BS7 A;  3A6N B;  3AZL A;  5BNV B;  1JFI A;  3MGQ D;  3AN2 C;  5AV5 A;  5CP6 C;  3C1B A;  5JRG B;  5B40 C;  1P3B A;  3KWQ B;  5B0Y B;  3KXB A;  4J8U C;  5GXQ D;  1W2E A;  1P3F D;  2YFW B;  3AZJ A;  3WTP C;  3MGR A;  4ZUX A;  3AZG D;  1F66 B;  3W97 C;  1P3M B;  2NZD B;  5KDM B;  4QLC A;  4H9O B;  1BH8 B;  5AY8 B;  5BT1 C;  3KUY B;  1P34 B;  3O62 C;  3EPK A;  3REL B;  1ZLA D;  3MGQ B;  2BYK A;  1P3P D;  5B24 D;  4JJN D;  2G5H C;  4UUZ B;  5C3I C;  2BYM B;  1N1J A;  3R45 A;  5B33 D;  3TU4 A;  5F99 C;  4HGA B;  1P3F B;  5JRG C;  3REI A;  2F8N H;  4YS3 D;  2HIO A;  2HUE C;  3KWQ C;  4KGC A;  1TZY C;  4WZS B;  3AZG B;  5DNM B;  3LZ0 A;  1KX4 B;  2Y2G A;  3LZ1 A;  4J8V C;  2ARO C;  2Y2J A;  3WKJ C;  1ZLA B;  3MGP D;  1P3P B;  5E5A D;  1Z2C B;  2XD5 A;  1P3M C;  4JJN B;  2NZD C;  1P34 C;  5AY8 C;  5AVB B;  5B2J D;  3REK D;  3MVD D;  3MGQ C;  5B33 B;  1EQZ D;  3VH6 A;  3AZN D;  5B32 D;  4ZBJ B;  4YS3 B;  5AV6 A;  3VH6 W;  5GXQ C;  5FUG B;  2ZY2 A;  3AZH A;  3W96 B;  1U35 D;  3V9R B;  3UTA D;  3C1C D;  3MGP B;  3AZG C;  5B0Z A;  4LD9 A;  3X1S D;  1TAF B;  3VH6 T;  5B2J B;  1T3U A;  5B1M D;  3REK B;  3UTB A;  3AV2 D;  2Y2H A;  1P3P C;  3X1V C;  2DF4 C;  5B24 C;  3A1I A;  3VH5 T;  4JJN C;  1EQZ B;  1HQ3 C;  3AZN B;  3KFU G;  5B32 B;  3NQU B;  1WWI A;  3B6G B;  5B33 C;  3NQJ A;  5AV5 C;  3AYW D;  1U35 B;  4YS3 C;  3UTA B;  4X23 B;  5GT3 D;  3AZM B;  3KXB C;  2CV5 A;  3EPH A;  5B1M B;  3WA9 A;  3AZJ C;  3AV2 B;  3MGP C;  5E5A C;  4WU8 A;  3MGR C;  4ZUX C;  3X1U D;  4YM6 A;  5B2J C;  3X1T D;  4KHA A;  5B31 A;  3MVD C;  5DNN A;  1M1A A;  4H9Q B;  5CPK D;  2PYO A;  4XUJ B;  3AYW B;  5B32 C;  4WNN B;  4R8P D;  5GT3 B;  1KX5 D;  2F8N A;  1AOI A;  3TU4 C;  3AZK D;  5B40 D;  1U35 C;  1P3L A;  4J8X A;  3C1C C;  3X1S C;  4J8U D;  3W99 D;  3B6F A;  3LZ0 C;  5B1M C;  4UPK A;  3LZ1 C;  3AV2 C;  5CPK B;  3W97 D;  2Y2I A;  1WWS A;  1H3O A;  5CP6 B;  5B40 B;  3AFA A;  3AYW C;  2PYO D;  1P3G D;  1KX3 D;  3MGS D;  4Z66 A;  4J8U B;  3W99 B;  5F99 D;  5B1L A;  1F1E A;  3WTP B;  2YFW A;  4NE3 A;  1TZY D;  3P5J B;  3W97 B;  3X1U C;  3REJ D;  3X1T C;  2ARO D;  4H9O A;  2NQB D;  3MNN A;  3REL A;  3AZI D;  3AZF D;  1P3G B;  4R8P C;  5C3I B;  1KX5 C;  5F99 B;  3AZK C;  3FDD A;  2HUE B;  5B2I A;  1ID3 D;  4E45 A;  1TZY B;  5JA4 A;  3W99 C;  3WAA D;  4H9N A;  1Q9C A;  5DNM A;  3REJ B;  4J8V B;  1P3I A;  5B1L D;  2ARO B;  1KX4 A;  2NQB B;  3WKJ B;  3REH A;  4J8W A;  1P3K A;  4WU8 C;  3AZI B;  3LEL D;  4Z5T A;  4YM6 C;  3AZF B;  3AV1 A;  5AVB A;  5B31 C;  2Y2Q A;  3X1V D;  1HQ3 D;  1P3O A;  2PYO C;  2JE5 A;  1P3G C;  3A1K A;  3MGS C;  3AZL D;  1KX3 C;  1PZR A;  3WAA B;  5GXQ B;  4WU9 A;  5BO0 A;  1B67 A;  4CAY B;  5AV5 D;  1AOI C;  3C1B D;  1P3B D;  3W96 A;  4Z2M H;  3KXB D;  1P3A A;  3LEL B;  5BNX B;  1BH9 A;  3REJ C;  2YFV A;  3AZJ D;  2NQB C;  3H0R C;  5B31 G;  3MGR D;  3X1V B;  5B24 B;  5CPJ A;  4ZUX D;  3AZI C;  1HQ3 B;  4XZQ A;  4QLC D;  3AZF C;  5CPI A;  3W98 A;  1JFI B;  2F8N G;  3B6G A;  5AV5 B;  1BFM A;  4H9S C;  3C1B B;  1P3B B;  2FJ7 A;  1ID3 C;  4DRA A;  4Z66 C;  3WAA C;  4X23 A;  3KXB B;  3TU4 D;  3VH5 A;  3H0L C;  2RVQ C;  4G92 C;  1A7W A;  5B1L C;  3AZJ B;  5GT0 A;  3REI D;  4KGC D;  5E5A B;  2HIO D;  3VH5 W;  3MGR B;  4ZUX B;  2JSS A;  3LEL C;  3LJA A;  4QLC B;  3EPJ A;  3LZ0 D;  3LZ1 D;  3MVD B;  5G49 A;  3MNN C;  2BYK B;  5AV8 A;  4KUD A;  5BS7 C;  3AZL C;  4XUJ A;  4H9P A;  2J8P A;  3R45 B;  3TU4 B;  1M18 A;  3C1B C;  1P3B C;  3AZE A;  3C1C B;  4KGC B;  5B2I C;  3X1S B;  5AV6 D;  4AWL C;  5AVC A;  3LZ0 B;  3AZH D;  3LZ1 B;  2L5A A;  5B0Z D;  4LD9 D;  2FFF B;  4QLC C;  3EG5 B;  4Z5T C;  5AV9 A; 
#chains in the Genus database with same CATH homology
 3UTB D;  3AN2 A;  2W8S A;  2Y2L A;  1P3O C;  4H9R A;  3WTP E;  1KU5 A;  2ZM5 A;  4WV4 B;  4EO5 B;  5AV6 B;  4CSR A;  4WU9 C;  3REI C;  4KGC C;  2HIO C;  3WTP A;  3X1U B;  5B0Z B;  3X1T B;  1S32 A;  2CV5 D;  1M19 A;  3WA9 D;  3O62 A;  2IO5 B;  5CPJ C;  4WU8 D;  5GSU A;  4YM6 D;  3UT9 A;  4XZQ C;  4R8P B;  1KX5 B;  3A6N A;  5B31 D;  5DNN D;  1M1A D;  3W98 C;  5BNV A;  3AZK B;  3NQJ B;  2JCH A;  5JRG A;  2FJ7 C;  4EO5 C;  2F8N D;  5AV6 C;  3KWQ A;  5CHL B;  5B0Y A;  1AOI D;  3AZH C;  2VQR A;  1P3L D;  4J8V A;  5GT0 C;  4J8X D;  5B0Z C;  4WU8 B;  4LD9 C;  1F66 A;  1P3M A;  4YM6 B;  3B6F D;  5KDM A;  3LJA C;  2NZD A;  3KUY A;  1BH8 A;  5AY8 A;  1P34 A;  3UTB C;  4KHA B;  5B31 B;  1M1A B;  2IO5 C;  3H0M C;  3MGQ A;  2PYO B;  5AV8 C;  4M6B A;  1KX3 B;  3MGS B;  4UUZ A;  2BYM A;  3B0D C;  1M18 C;  1AOI B;  5GXQ A;  4G91 B;  3AFA D;  1P3F A;  4Z66 D;  4J8X B;  3AZG A;  3B6F B;  2CV5 C;  2RVQ D;  5AVC C;  3WA9 C;  1ZLA A;  2Y2M A;  1P3P A;  4JJN A;  5DNN C;  3KUY D;  5AV9 C;  3MNN D;  1M1A C;  1H3O B;  5B33 A;  3REL D;  3AFA B;  1ID3 B;  4Z66 B;  4YS3 A;  2G5I C;  4G91 C;  5FUG A;  4G92 B;  5B1L B;  1P3L C;  5B2I D;  4J8X C;  3V9R A;  1HTA A;  3MGP A;  5E5A A;  3B6F C;  1TAF A;  5DNM D;  1S32 C;  2F2A C;  1P3I D;  5B2J A;  1M19 C;  1KX4 D;  3MNN B;  3KSY A;  3REK A;  3MVD A;  3REH D;  4J8W D;  1P3K D;  1EQZ A;  5GSU C;  2Y2P A;  4Z5T D;  3AZL B;  3UT9 C;  3AZN A;  5B32 A;  3AV1 D;  3A6N C;  3NQU A;  5AVB D;  3B0C W;  2Y2N A;  3B0B A;  3AFA C;  1P3O D;  4Z2M G;  1U35 A;  5B2I B;  3UTA A;  3AZM A;  5JA4 B;  3B0C T;  3C1C A;  4AWL B;  4H9N B;  4WU9 D;  3X1S A;  3AL0 C;  5B0Y C;  1P3I B;  5B1M A;  3W96 D;  3AV2 A;  3REH B;  4J8W B;  1P3K B;  1P3A D;  1F66 C;  4Z5T B;  3AV1 B;  3KUY C;  5CPJ D;  4H9Q A;  3REL C;  2ZY3 A;  4NE6 A;  1P3O B;  4XZQ D;  3AYW A;  4WNN A;  5CPI D;  1N1J B;  2ZY4 A;  5GT3 A;  3W98 D;  3IP4 C;  4WU9 B;  5BO0 B;  3B6G D;  3REI B;  4HGA C;  1P3F C;  2FJ7 D;  2HIO B;  4DRB A;  4X23 D;  3AZM D;  1P3A B;  3X1U A;  1BH9 B;  5DNM C;  1P3I C;  2YFV B;  3X1T A;  1KX4 C;  5GT0 D;  5CPJ B;  3REH C;  4J8W C;  1P3K C;  5CPK A;  1ZLA C;  3LJA D;  2UWX A;  4XZQ B;  3AV1 C;  5CPI B;  5AVB C;  4R8P A;  1KX5 A;  3W98 B;  5AV8 D;  5CP6 A;  3AZK A;  4KUD D;  5B40 A;  2FJ7 B;  4XUJ D;  4DQY B;  4ZBJ C;  4NE5 A;  4J8U A;  1M18 D;  3W99 A;  3AZH B;  4NFT A;  3AZE D;  3W96 C;  5GT0 B;  2F8N K;  4LD9 B;  3W97 A;  1P3A C;  3LJA B;  5AVC D;  3UTB B;  5G49 B;  3EPL A;  3REK C;  5AV8 B;  1EQZ C;  4KUD B;  5CPI C;  3AZN C;  1P3G A;  1KX3 A;  5AV9 D;  3MGS A;  4H9P B;  3B0D B;  1M18 B;  3B6G C;  5F99 A;  3AN2 D;  5CP6 D;  3AZE B;  4WJ3 C;  3UTA C;  1TZY A;  4X23 C;  3AZM C;  2CV5 B;  5AVC B;  3REJ A;  3WA9 B;  2BG1 A;  2ARO A;  2NQB A;  3WKJ A;  3WTP D;  2XD1 A;  3AZI A;  1S32 D;  1M19 D;  3AZF A;  2Y2K A;  5DNN B;  5AV9 B;  5BT1 D;  5B32 G;  3O62 D;  5GSU D;  3AN2 B;  4KUD C;  3UT9 D;  2CWE A;  2DQN C;  4H9S A;  4H9R B;  4XUJ C;  2ZY5 A;  3A6N D;  2F8N B;  1ID3 A;  4E44 A;  2Y2O A;  1R4V A;  5GT3 C;  4CSR B;  3WAA A;  1P3L B;  4CAY A;  3AZE C;  5JRG D;  3KWQ D;  5B0Y D;  3LEL A;  5BNX A;  1S32 B;  1M19 B;  1ULY A;  4J8V D;  3O62 B;  3X1V A;  5B24 A;  1B6W A;  3WKJ D;  5GSU B;  5CPK C;  1F66 D;  1HQ3 A;  2LY8 A;  3UT9 B;  3F6T A;  1P3M D;  2NZD D;  2RIQ A;  1P34 D;  5AY8 D;  5BS7 A;  3A6N B;  3AZL A;  5BNV B;  1JFI A;  3MGQ D;  3AN2 C;  5AV5 A;  5CP6 C;  3C1B A;  5JRG B;  5B40 C;  1P3B A;  3KWQ B;  5B0Y B;  3KXB A;  4J8U C;  5GXQ D;  1W2E A;  1P3F D;  2YFW B;  3AZJ A;  3WTP C;  3MGR A;  4ZUX A;  3AZG D;  1F66 B;  3W97 C;  1P3M B;  2NZD B;  5KDM B;  4QLC A;  4H9O B;  1BH8 B;  5AY8 B;  5BT1 C;  3KUY B;  1P34 B;  3O62 C;  3EPK A;  3REL B;  1ZLA D;  3MGQ B;  2BYK A;  1P3P D;  5B24 D;  4JJN D;  2G5H C;  4UUZ B;  5C3I C;  2BYM B;  1N1J A;  3R45 A;  5B33 D;  3TU4 A;  5F99 C;  4HGA B;  1P3F B;  5JRG C;  3REI A;  2F8N H;  4YS3 D;  2HIO A;  2HUE C;  3KWQ C;  4KGC A;  1TZY C;  4WZS B;  3AZG B;  5DNM B;  3LZ0 A;  1KX4 B;  2Y2G A;  3LZ1 A;  4J8V C;  2ARO C;  2Y2J A;  3WKJ C;  1ZLA B;  3MGP D;  1P3P B;  5E5A D;  1Z2C B;  2XD5 A;  1P3M C;  4JJN B;  2NZD C;  1P34 C;  5AY8 C;  5AVB B;  5B2J D;  3REK D;  3MVD D;  3MGQ C;  5B33 B;  1EQZ D;  3VH6 A;  3AZN D;  5B32 D;  4ZBJ B;  4YS3 B;  5AV6 A;  3VH6 W;  5GXQ C;  5FUG B;  2ZY2 A;  3AZH A;  3W96 B;  1U35 D;  3V9R B;  3UTA D;  3C1C D;  3MGP B;  3AZG C;  5B0Z A;  4LD9 A;  3X1S D;  1TAF B;  3VH6 T;  5B2J B;  1T3U A;  5B1M D;  3REK B;  3UTB A;  3AV2 D;  2Y2H A;  1P3P C;  3X1V C;  2DF4 C;  5B24 C;  3A1I A;  3VH5 T;  4JJN C;  1EQZ B;  1HQ3 C;  3AZN B;  3KFU G;  5B32 B;  3NQU B;  1WWI A;  3B6G B;  5B33 C;  3NQJ A;  5AV5 C;  3AYW D;  1U35 B;  4YS3 C;  3UTA B;  4X23 B;  5GT3 D;  3AZM B;  3KXB C;  2CV5 A;  3EPH A;  5B1M B;  3WA9 A;  3AZJ C;  3AV2 B;  3MGP C;  5E5A C;  4WU8 A;  3MGR C;  4ZUX C;  3X1U D;  4YM6 A;  5B2J C;  3X1T D;  4KHA A;  5B31 A;  3MVD C;  5DNN A;  1M1A A;  4H9Q B;  5CPK D;  2PYO A;  4XUJ B;  3AYW B;  5B32 C;  4WNN B;  4R8P D;  5GT3 B;  1KX5 D;  2F8N A;  1AOI A;  3TU4 C;  3AZK D;  5B40 D;  1U35 C;  1P3L A;  4J8X A;  3C1C C;  3X1S C;  4J8U D;  3W99 D;  3B6F A;  3LZ0 C;  5B1M C;  4UPK A;  3LZ1 C;  3AV2 C;  5CPK B;  3W97 D;  2Y2I A;  1WWS A;  1H3O A;  5CP6 B;  5B40 B;  3AFA A;  3AYW C;  2PYO D;  1P3G D;  1KX3 D;  3MGS D;  4Z66 A;  4J8U B;  3W99 B;  5F99 D;  5B1L A;  1F1E A;  3WTP B;  2YFW A;  4NE3 A;  1TZY D;  3P5J B;  3W97 B;  3X1U C;  3REJ D;  3X1T C;  2ARO D;  4H9O A;  2NQB D;  3MNN A;  3REL A;  3AZI D;  3AZF D;  1P3G B;  4R8P C;  5C3I B;  1KX5 C;  5F99 B;  3AZK C;  3FDD A;  2HUE B;  5B2I A;  1ID3 D;  4E45 A;  1TZY B;  5JA4 A;  3W99 C;  3WAA D;  4H9N A;  1Q9C A;  5DNM A;  3REJ B;  4J8V B;  1P3I A;  5B1L D;  2ARO B;  1KX4 A;  2NQB B;  3WKJ B;  3REH A;  4J8W A;  1P3K A;  4WU8 C;  3AZI B;  3LEL D;  4Z5T A;  4YM6 C;  3AZF B;  3AV1 A;  5AVB A;  5B31 C;  2Y2Q A;  3X1V D;  1HQ3 D;  1P3O A;  2PYO C;  2JE5 A;  1P3G C;  3A1K A;  3MGS C;  3AZL D;  1KX3 C;  1PZR A;  3WAA B;  5GXQ B;  4WU9 A;  5BO0 A;  1B67 A;  4CAY B;  5AV5 D;  1AOI C;  3C1B D;  1P3B D;  3W96 A;  4Z2M H;  3KXB D;  1P3A A;  3LEL B;  5BNX B;  1BH9 A;  3REJ C;  2YFV A;  3AZJ D;  2NQB C;  3H0R C;  5B31 G;  3MGR D;  3X1V B;  5B24 B;  5CPJ A;  4ZUX D;  3AZI C;  1HQ3 B;  4XZQ A;  4QLC D;  3AZF C;  5CPI A;  3W98 A;  1JFI B;  2F8N G;  3B6G A;  5AV5 B;  1BFM A;  4H9S C;  3C1B B;  1P3B B;  2FJ7 A;  1ID3 C;  4DRA A;  4Z66 C;  3WAA C;  4X23 A;  3KXB B;  3TU4 D;  3VH5 A;  3H0L C;  2RVQ C;  4G92 C;  1A7W A;  5B1L C;  3AZJ B;  5GT0 A;  3REI D;  4KGC D;  5E5A B;  2HIO D;  3VH5 W;  3MGR B;  4ZUX B;  2JSS A;  3LEL C;  3LJA A;  4QLC B;  3EPJ A;  3LZ0 D;  3LZ1 D;  3MVD B;  5G49 A;  3MNN C;  2BYK B;  5AV8 A;  4KUD A;  5BS7 C;  3AZL C;  4XUJ A;  4H9P A;  2J8P A;  3R45 B;  3TU4 B;  1M18 A;  3C1B C;  1P3B C;  3AZE A;  3C1C B;  4KGC B;  5B2I C;  3X1S B;  5AV6 D;  4AWL C;  5AVC A;  3LZ0 B;  3AZH D;  3LZ1 B;  2L5A A;  5B0Z D;  4LD9 D;  2FFF B;  4QLC C;  3EG5 B;  4Z5T C;  5AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...