2NQBB

Drosophila nucleosome structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 28
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbB00
3LELA 3REHA 5GT3D 1AOID 4JJNC 3AZJB 5B2JB 2PYOD 4KUDC 3LELD 3REHD 3WKJA 3WAAA 3AZMB 5B2IB 4XZQC 3WKJD 3WAAD 5B24D 4Z5TC 5B32C 3MGPC 3REIA 2NZDB 3AZNB 5B1LC 3REID 2YFVA 5B31C 4QLCA 3AZKA 3AYWC 3AZKD 2CV5C 5GSUA 1P3AB 4DRBA 4J8VB 3W96C 5AV8B 5GSUD 5CP6C 3AV1C 5AY8C 3AZJA 5B2JA 3AZJD 3AZMA 5B2JD 5B2IA 3REKC 5B32G 3AZMD 2HIOB 5B2ID 1EQZC 3KXBB 1P3FC 5B0YC 3AZNA 3O62B 2NZDA 5DNNC 5B40C 1HQ3C 5B31G 2NZDD 3AZND 1P3PB 4Z66B 3LZ1C 5AVBB 3MVDC 4J8VA 1P3AA 1AOIC 5AV8A 1P3AD 3LELC 4J8VD 3REHC 5AV8D 1WWIA 3WKJC 3WAAC 4G91B 2FJ7B 2BYMB 2HIOA 3REIC 3KXBA 2HIOD 3O62A 3KXBD 1P3MB 1A7WA 3O62D 3AZKC 4QLCC 1P3PA 4Z66A 3AZIB 1P3PD 5GSUC 4Z66D 5AVBA 5AVBD 3AZJC 5B2JC 5B2IC 3UTBB 4WU9B 2FJ7A 1WWSA 2BYMA 3NQUB 3C1BB 2FJ7D 2NZDC 2HUEB 3X1VB 1P3MA 1N1JB 4NE5A 3AZIA 1P3AC 3A6NB 4J8VC 4H9NB 3AZID 5BT1D 1Q9CA 3UTBA 4WU9A 5AVCC 3NQUA 3C1BA 4WU9D 3UTBD 3C1BD 4UUZB 4DRAA 3X1VA 1N1JA 1P3GC 3X1VD 4H9QB 3WTPB 3B0DC 5AVBC 3A6NA 3B6GB 4H9NA 3W97B 3X1UA 3A6ND 4WV4B 2YFWB 4J8WB 3X1UD 4ZBJB 4CSRB 1KX4C 1H3OB 5CP6B 4G91C 1ID3B 2FJ7C 1P3IC 4UUZA 5KDMB 3REKB 3AZEB 1P3MC 3AFAB 5E5AB 4KUDD 1EQZB 1P3FB 3MGPA 4H9QA 5DNNB 5B40B 3WTPA 3MGPD 3AZIC 1U35C 3WTPD 3B6GA 3W97A 1AOIA 5BT1C 3B6GD 3KWQB 2YFWA 4J8WA 3W97D 2BYKB 4CSRA 3AZLB 1H3OA 5CP6A 4J8WD 5CPKB 1BH8B 5BNXB 1ID3A 3W96D 3MGQC 5CP6D 3C1BC 1P3OB 3AV1D 1ID3D 1B6WA 5JRGB 3REKA 5KDMA 3X1VC 3AZEA 3AFAA 5E5AA 5BNVB 3TU4C 1EQZA 3REKD 5AV5B 1P3FA 3AFAD 5E5AD 3VH5T 3KUYB 5DNNA 5B1MB 5B40A 1P3FD 1EQZD 3A6NC 5DNND 5B40D 3AZHB 3KWQA 1KX3B 2BYKA 4NFTA 3KWQD 3RELC 5CPKA 1BH8A 1BH9B 5BNXA 1P3OA 5C3IB 5CPKD 1P3OD 3B0CT 4H9SA 5JRGA 5BNVA 5JRGD 5AV5A 3WTPC 3KUYA 5B1MA 5AV5D 3KUYD 3B6GC 5B1MD 3W97C 4QLCD 4J8WC 3AZHA 4ZBJC 1KX3A 4KGCB 3AZHD 5GT0C 1KX3D 1ID3C 1BH9A 1BFMA 3W98C 3AZEC 3AFAC 5E5AC 5AVCB 3AZFB 4LD9B 1P3GB 3B0DB 3KWQC 4YM6B 4HGAB 3AZLC 4KGCA 5CPKC 1P3KB 2AROB 4KGCD 1P3OC 1KX4B 3B6FB 4H9SC 5JRGC 1P3IB 5AVCA 5AV9B 3AZFA 5AV5C 3KUYC 5AVCD 4LD9A 2IO5B 5B1MC 3AZFD 1M1AB 1M18B 4LD9D 1P3GA 1U35B 3AZHC 1P3GD 4YM6A 1KX3C 4YM6D 1P3KA 2AROA 4WZSB 5C3IC 1P3KD 2AROD 1KX4A 4AWLC 3B6FA 3W99B 1KX4D 3MGQB 1P3IA 3B6FD 5AV9A 5CPIB 1P3ID 3VH6T 5AV9D 3V9RB 1M1AA 3TU4B 1M18A 1M1AD 4Z2MG 1P3MD 1B67A 4KHAB 1U35A 1ZLAB 3AZGB 3LZ0B 1U35D 4KGCC 3C1CB 2F8NB 3R45B 3RELB 3W99A 3MGQA 3UTAC 3AZFC 5CPIA 3MGQD 4LD9C 5CPID 3V9RA 3TU4A 5B33B 3TU4D 4NE3A 4KHAA 4YM6C 1ZLAA 3AZGA 3LZ0A 4HGAC 3C1CA 1P34B 1P3BB 1ZLAD 4NE6A 1P3KC 2AROC 2F8NA 3C1CD 4X23B 5FUGB 3R45A 3B6FC 2JSSA 2F8ND 5GT0B 3LJAB 3RELA 3RELD 5AV9C 1M19C 2IO5C 1M1AC 3W98B 2RVQC 1M18C 3X1SB 5B33A 3AN2C 1P3BA 1P34A 4H9OB 5CPJB 3WA9C 3REJC 1P3BD 1P34D 4X23A 5FUGA 2NQBC 3W99C 5GT0A 4X23D 3LJAA 3WTPE 5GT0D 5AV6B 3LJAD 5CPIC 3W98A 3W98D 3X1SA 3AZED 1JFIB 4R8PC 1KU5A 1KX5C 4E44A 4ZUXB 3X1SD 1ZLAC 3AZGC 3LZ0C 3MNNB 3C1CC 4H9OA 5CPJA 5CPJD 5F99B 3AZLA 3AZLD 5AV6A 4AWLB 1F1EA 5AV6D 5B33C 5B24B 4J8XB 1JFIA 4WU8C 4ZUXA 3MGRB 2LY8A 4ZUXD 3MNNA 4WNNB 1P34C 1P3BC 2F8NG 3MNND 1S32B 4X23C 3UT9C 5F99A 5BS7A 3LJAC 4Z2MH 5F99D 4EO5B 4H9PB 3UTAB 3X1SC 5B24A 4J8XA 1P3LB 4J8XD 3MGRA 3VH5W 4WNNA 3MGRD 5CPJC 4G92B 3X1TB 1S32A 1S32D 3VH5A 5AV6C 4H9PA 5CHLB 3B0BA 1HTAA 5GXQC 4XUJB 3UTAA 1M19B 3B0CW 1P3LA 3UTAD 4ZUXC 1P3LD 3MNNC 1TZYB 2CWEA 3AN2B 3X1TA 5B0ZB 5F99C 5BS7C 3X1TD 3WA9B 3REJB 5GT3C 2PYOC 2NQBB 4YS3B 1F66B 4XUJA 5B24C 4J8XC 1M19A 4XUJD 1M19D 3MGSB 3MGRC 3NQJB 2RVQD 4CAYB 3AV2B 1M18D 5JA4B 4R8PB 1KX5B 1TZYA 1S32C 3AN2A 5G49B 1TZYD 5B0ZA 3AN2D 5B0ZD 3WA9A 3REJA 4E45A 4EO5C 1R4VA 2NQBA 3REJD 3WA9D 4H9RB 4YS3A 2NQBD 1F66A 3W99D 4YS3D 3AZMC 1P3LC 1F66D 5BO0B 4J8UB 3MGSA 3NQJA 3AZNC 3MGSD 3AV2A 4CAYA 4WU8B 5JA4A 4R8PA 4G92C 1KX5A 3X1TC 3AV2D 4R8PD 5G49A 1KX5D 5DNMB 3AZGD 3LZ0D 5AV8C 3X1UB 3UT9B 4H9RA 2F8NH 2L5AA 4XUJC 2F8NK 1TAFB 4JJNB 5BO0A 4J8UA 2HIOC 4KUDB 3KXBC 4J8UD 3VH6W 3O62C 4XZQB 4WU8A 1TZYC 5B33D 4Z5TB 5B32B 3MGPB 1P3PC 4Z66C 4WU8D 5B0ZC 5B1LB 3VH6A 5DNMA 5B31B 5DNMD 3UT9A 3AYWB 2CV5B 4YS3C 1ULYA 3UT9D 3W96B 1F66C 3AV1B 5AY8B 1TAFA 4JJNA 5GXQB 3MGSC 4KUDA 4JJND 3AV2C 4XZQA 4Z5TA 5B32A 4XZQD 5B0YB 5B1LA 1HQ3B 4M6BA 4Z5TD 5B32D 5B1LD 5B31A 3LZ1B 3KSYA 3AYWA 5B31D 2CV5A 3MVDB 3W96A 5GT3B 3AYWD 2CV5D 1AOIB 2PYOB 3LELB 3REHB 3UTBC 3AV1A 4WU9C 5AY8A 4J8UC 5GXQA 3WKJB 3WAAB 5AY8D 2HUEC 5GXQD 3REIB 5B0YA 5DNMC 1HQ3A 2YFVB 5B0YD 3AZKB 4QLCB 1HQ3D 3X1UC 3LZ1A 5GSUB 3LZ1D 3MVDA 5GT3A 2PYOA 3MVDD
chains in the Genus database with same CATH superfamily
3LELA 3REHA 5GT3D 1AOID 4JJNC 3AZJB 5B2JB 2PYOD 4KUDC 3LELD 3REHD 3WKJA 3WAAA 3AZMB 5B2IB 4XZQC 3WKJD 3WAAD 5B24D 1T3UA 4Z5TC 5B32C 3MGPC 2ZM5A 3REIA 3AZNB 2NZDB 5B1LC 3EG5B 3REID 2YFVA 5B31C 4QLCA 3AZKA 3AYWC 3AZKD 2CV5C 5GSUA 1P3AB 4DRBA 4J8VB 3W96C 5CP6C 5AV8B 5GSUD 3AV1C 5AY8C 3AZJA 5B2JA 3AZJD 3AZMA 5B2JD 5B2IA 3REKC 5B32G 2DQNC 2HIOB 5B2ID 3AZMD 1EQZC 3KXBB 1P3FC 5B0YC 3AZNA 3O62B 2NZDA 5DNNC 5B40C 1HQ3C 5B31G 2NZDD 3AZND 1P3PB 4Z66B 2J8PA 3LZ1C 5AVBB 3MVDC 4J8VA 1P3AA 1AOIC 5AV8A 1P3AD 3LELC 4J8VD 3REHC 5AV8D 1WWIA 3WKJC 3WAAC 4G91B 2FJ7B 2BYMB 2HIOA 3REIC 3KXBA 2HIOD 3O62A 3KXBD 1P3MB 1A7WA 3O62D 3AZKC 4QLCC 1P3PA 4Z66A 3AZIB 1P3PD 5GSUC 4Z66D 2Y2OA 5AVBA 5AVBD 3AZJC 5B2JC 5B2IC 3UTBB 3H0RC 4WU9B 2FJ7A 1WWSA 2BYMA 3NQUB 3C1BB 2FJ7D 2NZDC 2HUEB 3X1VB 2DF4C 1P3MA 1N1JB 4NE5A 3AZIA 1P3AC 3A6NB 4J8VC 4H9NB 3AZID 5BT1D 2Y2PA 1Q9CA 3UTBA 4WU9A 5AVCC 3NQUA 3C1BA 4WU9D 3UTBD 3C1BD 4UUZB 4DRAA 3X1VA 1N1JA 1P3GC 3X1VD 4H9QB 3WTPB 3B0DC 2ZY5A 5AVBC 3A6NA 3B6GB 4H9NA 4UPKA 3W97B 3X1UA 3A6ND 4WV4B 2YFWB 4J8WB 3X1UD 4ZBJB 4CSRB 1KX4C 1H3OB 5CP6B 4G91C 1ID3B 2FJ7C 1P3IC 4UUZA 5KDMB 3REKB 3AZEB 1P3MC 3AFAB 5E5AB 4KUDD 1EQZB 1P3FB 3MGPA 4H9QA 5DNNB 5B40B 3WTPA 3MGPD 3AZIC 1U35C 3A1KA 3WTPD 3B6GA 3W97A 1AOIA 5BT1C 3B6GD 3KWQB 2YFWA 4J8WA 3W97D 2BYKB 4CSRA 3AZLB 1H3OA 5CP6A 4J8WD 5CPKB 1BH8B 5BNXB 1ID3A 3W96D 3MGQC 5CP6D 3C1BC 1P3OB 3AV1D 1ID3D 1B6WA 5JRGB 2ZY3A 3REKA 1W2EA 5KDMA 3X1VC 3AZEA 2W8SA 5E5AA 5BNVB 3AFAA 2Y2JA 3TU4C 3REKD 5AV5B 1P3FA 1EQZA 3AL0C 3AFAD 5E5AD 3VH5T 3KUYB 5DNNA 5B1MB 5B40A 1P3FD 1EQZD 3A6NC 5DNND 5B40D 2XD1A 3AZHB 3KWQA 1KX3B 2BYKA 4NFTA 4DQYB 3KWQD 3RELC 5CPKA 1BH8A 1BH9B 5BNXA 1P3OA 5C3IB 5CPKD 1P3OD 3B0CT 4H9SA 5JRGA 5BNVA 5JRGD 5AV5A 3WTPC 3KUYA 5B1MA 5AV5D 3KUYD 3B6GC 5B1MD 3W97C 4QLCD 4J8WC 3AZHA 4ZBJC 1KX3A 4KGCB 4WJ3C 3AZHD 5GT0C 1KX3D 1ID3C 1BH9A 1BFMA 3W98C 3AZEC 3AFAC 5E5AC 5AVCB 3AZFB 4LD9B 1PZRA 1P3GB 3B0DB 3KWQC 4YM6B 4HGAB 3AZLC 4KGCA 5CPKC 1P3KB 2AROB 4KGCD 1P3OC 1KX4B 3B6FB 4H9SC 5JRGC 1P3IB 5AVCA 5AV9B 3AZFA 5AV5C 3KUYC 5AVCD 4LD9A 2IO5B 5B1MC 3AZFD 1M1AB 1M18B 4LD9D 1P3GA 1U35B 3AZHC 1P3GD 4YM6A 1KX3C 4YM6D 1P3KA 2AROA 4WZSB 5C3IC 1P3KD 2AROD 1KX4A 4AWLC 3B6FA 3W99B 2XD5A 1KX4D 3MGQB 1P3IA 3B6FD 5AV9A 5CPIB 1P3ID 3VH6T 5AV9D 3V9RB 3A1IA 1M1AA 3TU4B 1M18A 1M1AD 4Z2MG 2Y2MA 1P3MD 1B67A 4KHAB 1U35A 1ZLAB 3AZGB 3LZ0B 1U35D 4KGCC 3C1CB 2F8NB 3R45B 3RELB 3W99A 3MGQA 3UTAC 3AZFC 5CPIA 3MGQD 4LD9C 5CPID 3V9RA 3TU4A 5B33B 3TU4D 4NE3A 4KHAA 3EPHA 4YM6C 1ZLAA 3AZGA 3LZ0A 4HGAC 3C1CA 1P34B 1P3BB 1ZLAD 4NE6A 1P3KC 2AROC 2F8NA 3C1CD 4X23B 5FUGB 3R45A 3B6FC 2JSSA 2F8ND 5GT0B 3LJAB 3RELA 3RELD 5AV9C 1M19C 2IO5C 1M1AC 3W98B 2RVQC 1M18C 3X1SB 5B33A 2JCHA 3AN2C 1P3BA 1P34A 4H9OB 5CPJB 3WA9C 3REJC 1P3BD 1P34D 4X23A 5FUGA 2NQBC 3W99C 5GT0A 4X23D 3LJAA 3WTPE 5GT0D 5AV6B 3LJAD 5CPIC 3W98A 3W98D 3X1SA 3AZED 1JFIB 4R8PC 1KU5A 1KX5C 4E44A 4ZUXB 3X1SD 1ZLAC 3AZGC 3LZ0C 3MNNB 3C1CC 4H9OA 5CPJA 5CPJD 5F99B 3AZLA 3AZLD 5AV6A 4AWLB 1F1EA 5AV6D 5B33C 5B24B 4J8XB 1JFIA 4WU8C 4ZUXA 3MGRB 2G5IC 2LY8A 4ZUXD 3MNNA 4WNNB 1P34C 1P3BC 2F8NG 3MNND 1S32B 4X23C 3UT9C 5F99A 5BS7A 3LJAC 4Z2MH 2Y2KA 5F99D 4EO5B 4H9PB 3H0MC 3UTAB 3X1SC 5B24A 4J8XA 1P3LB 4J8XD 3MGRA 3EPJA 2FFFB 3VH5W 4WNNA 3MGRD 5CPJC 3IP4C 4G92B 3X1TB 2RIQA 1S32A 2F2AC 3EPLA 1S32D 3VH5A 2BG1A 5AV6C 4H9PA 5CHLB 3B0BA 1HTAA 5GXQC 4XUJB 3UTAA 1M19B 3B0CW 1P3LA 3UTAD 4ZUXC 2VQRA 1P3LD 3KFUG 3EPKA 3MNNC 1TZYB 2CWEA 3AN2B 3X1TA 5B0ZB 5F99C 5BS7C 3X1TD 3WA9B 3REJB 5GT3C 2PYOC 2NQBB 4YS3B 1F66B 4XUJA 5B24C 4J8XC 1M19A 4XUJD 1M19D 3MGSB 3MGRC 3NQJB 2RVQD 4CAYB 3AV2B 1M18D 5JA4B 4R8PB 1KX5B 1TZYA 2Y2HA 1S32C 3AN2A 5G49B 1TZYD 5B0ZA 3AN2D 5B0ZD 3WA9A 3REJA 4E45A 4EO5C 1R4VA 2NQBA 3REJD 3WA9D 4H9RB 4YS3A 2NQBD 1F66A 3W99D 4YS3D 3AZMC 1P3LC 1F66D 5BO0B 4J8UB 3FDDA 3MGSA 3NQJA 3AZNC 2Y2GA 3MGSD 3AV2A 1Z2CB 4CAYA 4WU8B 5JA4A 4R8PA 4G92C 1KX5A 3X1TC 3AV2D 4R8PD 5G49A 1KX5D 5DNMB 3H0LC 3P5JB 3AZGD 3LZ0D 5AV8C 3X1UB 3UT9B 2Y2IA 4H9RA 2F8NH 2L5AA 4XUJC 2F8NK 1TAFB 4JJNB 5BO0A 4J8UA 2HIOC 4KUDB 3KXBC 4J8UD 3VH6W 3O62C 4XZQB 4WU8A 1TZYC 5B33D 4Z5TB 5B32B 3MGPB 1P3PC 4Z66C 4WU8D 5B0ZC 5B1LB 3VH6A 5DNMA 5B31B 5DNMD 3UT9A 3AYWB 2CV5B 4YS3C 1ULYA 3UT9D 3W96B 1F66C 3AV1B 5AY8B 1TAFA 4JJNA 5GXQB 3MGSC 4KUDA 2UWXA 4JJND 3AV2C 4XZQA 4Z5TA 5B32A 4XZQD 5B0YB 3F6TA 5B1LA 1HQ3B 4M6BA 4Z5TD 5B32D 2Y2LA 5B1LD 2Y2QA 5B31A 3LZ1B 3KSYA 3AYWA 5B31D 2CV5A 3MVDB 3W96A 5GT3B 3AYWD 2CV5D 1AOIB 2PYOB 3LELB 3REHB 3UTBC 3AV1A 4WU9C 5AY8A 4J8UC 5GXQA 3WKJB 3WAAB 5AY8D 2HUEC 2G5HC 5GXQD 2Y2NA 3REIB 5B0YA 5DNMC 1HQ3A 2YFVB 2ZY2A 5B0YD 3AZKB 4QLCB 1HQ3D 3X1UC 3LZ1A 5GSUB 3LZ1D 3MVDA 2ZY4A 5GT3A 2PYOA 2JE5A 3MVDD
chains in the Genus database with same CATH topology
3LELA 3REHA 5GT3D 1AOID 4JJNC 3AZJB 5B2JB 2PYOD 4KUDC 3LELD 3REHD 3WKJA 3WAAA 3AZMB 5B2IB 4XZQC 3WKJD 3WAAD 5B24D 1T3UA 4Z5TC 5B32C 3MGPC 2ZM5A 3REIA 3AZNB 2NZDB 5B1LC 3EG5B 3REID 2YFVA 5B31C 4QLCA 3AZKA 3AYWC 3AZKD 2CV5C 5GSUA 1P3AB 4DRBA 4J8VB 3W96C 5CP6C 5AV8B 5GSUD 3AV1C 5AY8C 3AZJA 5B2JA 3AZJD 3AZMA 5B2JD 5B2IA 3REKC 5B32G 2DQNC 2HIOB 5B2ID 3AZMD 1EQZC 3KXBB 1P3FC 5B0YC 3AZNA 3O62B 2NZDA 5DNNC 5B40C 1HQ3C 5B31G 2NZDD 3AZND 1P3PB 4Z66B 2J8PA 3LZ1C 5AVBB 3MVDC 4J8VA 1P3AA 1AOIC 5AV8A 1P3AD 3LELC 4J8VD 3REHC 5AV8D 1WWIA 3WKJC 3WAAC 4G91B 2FJ7B 2BYMB 2HIOA 3REIC 3KXBA 2HIOD 3O62A 3KXBD 1P3MB 1A7WA 3O62D 3AZKC 4QLCC 1P3PA 4Z66A 3AZIB 1P3PD 5GSUC 4Z66D 2Y2OA 5AVBA 5AVBD 3AZJC 5B2JC 5B2IC 3UTBB 3H0RC 4WU9B 2FJ7A 1WWSA 2BYMA 3NQUB 3C1BB 2FJ7D 2NZDC 2HUEB 3X1VB 2DF4C 1P3MA 1N1JB 4NE5A 3AZIA 1P3AC 3A6NB 4J8VC 4H9NB 3AZID 5BT1D 2Y2PA 1Q9CA 3UTBA 4WU9A 5AVCC 3NQUA 3C1BA 4WU9D 3UTBD 3C1BD 4UUZB 4DRAA 3X1VA 1N1JA 1P3GC 3X1VD 4H9QB 3WTPB 3B0DC 2ZY5A 5AVBC 3A6NA 3B6GB 4H9NA 4UPKA 3W97B 3X1UA 3A6ND 4WV4B 2YFWB 4J8WB 3X1UD 4ZBJB 4CSRB 1KX4C 1H3OB 5CP6B 4G91C 1ID3B 2FJ7C 1P3IC 4UUZA 5KDMB 3REKB 3AZEB 1P3MC 3AFAB 5E5AB 4KUDD 1EQZB 1P3FB 3MGPA 4H9QA 5DNNB 5B40B 3WTPA 3MGPD 3AZIC 1U35C 3A1KA 3WTPD 3B6GA 3W97A 1AOIA 5BT1C 3B6GD 3KWQB 2YFWA 4J8WA 3W97D 2BYKB 4CSRA 3AZLB 1H3OA 5CP6A 4J8WD 5CPKB 1BH8B 5BNXB 1ID3A 3W96D 3MGQC 5CP6D 3C1BC 1P3OB 3AV1D 1ID3D 1B6WA 5JRGB 2ZY3A 3REKA 1W2EA 5KDMA 3X1VC 3AZEA 2W8SA 5E5AA 5BNVB 3AFAA 2Y2JA 3TU4C 3REKD 5AV5B 1P3FA 1EQZA 3AL0C 3AFAD 5E5AD 3VH5T 3KUYB 5DNNA 5B1MB 5B40A 1P3FD 1EQZD 3A6NC 5DNND 5B40D 2XD1A 3AZHB 3KWQA 1KX3B 2BYKA 4NFTA 4DQYB 3KWQD 3RELC 5CPKA 1BH8A 1BH9B 5BNXA 1P3OA 5C3IB 5CPKD 1P3OD 3B0CT 4H9SA 5JRGA 5BNVA 5JRGD 5AV5A 3WTPC 3KUYA 5B1MA 5AV5D 3KUYD 3B6GC 5B1MD 3W97C 4QLCD 4J8WC 3AZHA 4ZBJC 1KX3A 4KGCB 4WJ3C 3AZHD 5GT0C 1KX3D 1ID3C 1BH9A 1BFMA 3W98C 3AZEC 3AFAC 5E5AC 5AVCB 3AZFB 4LD9B 1PZRA 1P3GB 3B0DB 3KWQC 4YM6B 4HGAB 3AZLC 4KGCA 5CPKC 1P3KB 2AROB 4KGCD 1P3OC 1KX4B 3B6FB 4H9SC 5JRGC 1P3IB 5AVCA 5AV9B 3AZFA 5AV5C 3KUYC 5AVCD 4LD9A 2IO5B 5B1MC 3AZFD 1M1AB 1M18B 4LD9D 1P3GA 1U35B 3AZHC 1P3GD 4YM6A 1KX3C 4YM6D 1P3KA 2AROA 4WZSB 5C3IC 1P3KD 2AROD 1KX4A 4AWLC 3B6FA 3W99B 2XD5A 1KX4D 3MGQB 1P3IA 3B6FD 5AV9A 5CPIB 1P3ID 3VH6T 5AV9D 3V9RB 3A1IA 1M1AA 3TU4B 1M18A 1M1AD 4Z2MG 2Y2MA 1P3MD 1B67A 4KHAB 1U35A 1ZLAB 3AZGB 3LZ0B 1U35D 4KGCC 3C1CB 2F8NB 3R45B 3RELB 3W99A 3MGQA 3UTAC 3AZFC 5CPIA 3MGQD 4LD9C 5CPID 3V9RA 3TU4A 5B33B 3TU4D 4NE3A 4KHAA 3EPHA 4YM6C 1ZLAA 3AZGA 3LZ0A 4HGAC 3C1CA 1P34B 1P3BB 1ZLAD 4NE6A 1P3KC 2AROC 2F8NA 3C1CD 4X23B 5FUGB 3R45A 3B6FC 2JSSA 2F8ND 5GT0B 3LJAB 3RELA 3RELD 5AV9C 1M19C 2IO5C 1M1AC 3W98B 2RVQC 1M18C 3X1SB 5B33A 2JCHA 3AN2C 1P3BA 1P34A 4H9OB 5CPJB 3WA9C 3REJC 1P3BD 1P34D 4X23A 5FUGA 2NQBC 3W99C 5GT0A 4X23D 3LJAA 3WTPE 5GT0D 5AV6B 3LJAD 5CPIC 3W98A 3W98D 3X1SA 3AZED 1JFIB 4R8PC 1KU5A 1KX5C 4E44A 4ZUXB 3X1SD 1ZLAC 3AZGC 3LZ0C 3MNNB 3C1CC 4H9OA 5CPJA 5CPJD 5F99B 3AZLA 3AZLD 5AV6A 4AWLB 1F1EA 5AV6D 5B33C 5B24B 4J8XB 1JFIA 4WU8C 4ZUXA 3MGRB 2G5IC 2LY8A 4ZUXD 3MNNA 4WNNB 1P34C 1P3BC 2F8NG 3MNND 1S32B 4X23C 3UT9C 5F99A 5BS7A 3LJAC 4Z2MH 2Y2KA 5F99D 4EO5B 4H9PB 3H0MC 3UTAB 3X1SC 5B24A 4J8XA 1P3LB 4J8XD 3MGRA 3EPJA 2FFFB 3VH5W 4WNNA 3MGRD 5CPJC 3IP4C 4G92B 3X1TB 2RIQA 1S32A 2F2AC 3EPLA 1S32D 3VH5A 2BG1A 5AV6C 4H9PA 5CHLB 3B0BA 1HTAA 5GXQC 4XUJB 3UTAA 1M19B 3B0CW 1P3LA 3UTAD 4ZUXC 2VQRA 1P3LD 3KFUG 3EPKA 3MNNC 1TZYB 2CWEA 3AN2B 3X1TA 5B0ZB 5F99C 5BS7C 3X1TD 3WA9B 3REJB 5GT3C 2PYOC 2NQBB 4YS3B 1F66B 4XUJA 5B24C 4J8XC 1M19A 4XUJD 1M19D 3MGSB 3MGRC 3NQJB 2RVQD 4CAYB 3AV2B 1M18D 5JA4B 4R8PB 1KX5B 1TZYA 2Y2HA 1S32C 3AN2A 5G49B 1TZYD 5B0ZA 3AN2D 5B0ZD 3WA9A 3REJA 4E45A 4EO5C 1R4VA 2NQBA 3REJD 3WA9D 4H9RB 4YS3A 2NQBD 1F66A 3W99D 4YS3D 3AZMC 1P3LC 1F66D 5BO0B 4J8UB 3FDDA 3MGSA 3NQJA 3AZNC 2Y2GA 3MGSD 3AV2A 1Z2CB 4CAYA 4WU8B 5JA4A 4R8PA 4G92C 1KX5A 3X1TC 3AV2D 4R8PD 5G49A 1KX5D 5DNMB 3H0LC 3P5JB 3AZGD 3LZ0D 5AV8C 3X1UB 3UT9B 2Y2IA 4H9RA 2F8NH 2L5AA 4XUJC 2F8NK 1TAFB 4JJNB 5BO0A 4J8UA 2HIOC 4KUDB 3KXBC 4J8UD 3VH6W 3O62C 4XZQB 4WU8A 1TZYC 5B33D 4Z5TB 5B32B 3MGPB 1P3PC 4Z66C 4WU8D 5B0ZC 5B1LB 3VH6A 5DNMA 5B31B 5DNMD 3UT9A 3AYWB 2CV5B 4YS3C 1ULYA 3UT9D 3W96B 1F66C 3AV1B 5AY8B 1TAFA 4JJNA 5GXQB 3MGSC 4KUDA 2UWXA 4JJND 3AV2C 4XZQA 4Z5TA 5B32A 4XZQD 5B0YB 3F6TA 5B1LA 1HQ3B 4M6BA 4Z5TD 5B32D 2Y2LA 5B1LD 2Y2QA 5B31A 3LZ1B 3KSYA 3AYWA 5B31D 2CV5A 3MVDB 3W96A 5GT3B 3AYWD 2CV5D 1AOIB 2PYOB 3LELB 3REHB 3UTBC 3AV1A 4WU9C 5AY8A 4J8UC 5GXQA 3WKJB 3WAAB 5AY8D 2HUEC 2G5HC 5GXQD 2Y2NA 3REIB 5B0YA 5DNMC 1HQ3A 2YFVB 2ZY2A 5B0YD 3AZKB 4QLCB 1HQ3D 3X1UC 3LZ1A 5GSUB 3LZ1D 3MVDA 2ZY4A 5GT3A 2PYOA 2JE5A 3MVDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL A;  3REH A;  5GT3 D;  1AOI D;  4JJN C;  3AZJ B;  5B2J B;  2PYO D;  4KUD C;  3LEL D;  3REH D;  3WKJ A;  3WAA A;  3AZM B;  5B2I B;  4XZQ C;  3WKJ D;  3WAA D;  5B24 D;  4Z5T C;  5B32 C;  3MGP C;  3REI A;  2NZD B;  3AZN B;  5B1L C;  3REI D;  2YFV A;  5B31 C;  4QLC A;  3AZK A;  3AYW C;  3AZK D;  2CV5 C;  5GSU A;  1P3A B;  4DRB A;  4J8V B;  3W96 C;  5AV8 B;  5GSU D;  5CP6 C;  3AV1 C;  5AY8 C;  3AZJ A;  5B2J A;  3AZJ D;  3AZM A;  5B2J D;  5B2I A;  3REK C;  5B32 G;  3AZM D;  2HIO B;  5B2I D;  1EQZ C;  3KXB B;  1P3F C;  5B0Y C;  3AZN A;  3O62 B;  2NZD A;  5DNN C;  5B40 C;  1HQ3 C;  5B31 G;  2NZD D;  3AZN D;  1P3P B;  4Z66 B;  3LZ1 C;  5AVB B;  3MVD C;  4J8V A;  1P3A A;  1AOI C;  5AV8 A;  1P3A D;  3LEL C;  4J8V D;  3REH C;  5AV8 D;  1WWI A;  3WKJ C;  3WAA C;  4G91 B;  2FJ7 B;  2BYM B;  2HIO A;  3REI C;  3KXB A;  2HIO D;  3O62 A;  3KXB D;  1P3M B;  1A7W A;  3O62 D;  3AZK C;  4QLC C;  1P3P A;  4Z66 A;  3AZI B;  1P3P D;  5GSU C;  4Z66 D;  5AVB A;  5AVB D;  3AZJ C;  5B2J C;  5B2I C;  3UTB B;  4WU9 B;  2FJ7 A;  1WWS A;  2BYM A;  3NQU B;  3C1B B;  2FJ7 D;  2NZD C;  2HUE B;  3X1V B;  1P3M A;  1N1J B;  4NE5 A;  3AZI A;  1P3A C;  3A6N B;  4J8V C;  4H9N B;  3AZI D;  5BT1 D;  1Q9C A;  3UTB A;  4WU9 A;  5AVC C;  3NQU A;  3C1B A;  4WU9 D;  3UTB D;  3C1B D;  4UUZ B;  4DRA A;  3X1V A;  1N1J A;  1P3G C;  3X1V D;  4H9Q B;  3WTP B;  3B0D C;  5AVB C;  3A6N A;  3B6G B;  4H9N A;  3W97 B;  3X1U A;  3A6N D;  4WV4 B;  2YFW B;  4J8W B;  3X1U D;  4ZBJ B;  4CSR B;  1KX4 C;  1H3O B;  5CP6 B;  4G91 C;  1ID3 B;  2FJ7 C;  1P3I C;  4UUZ A;  5KDM B;  3REK B;  3AZE B;  1P3M C;  3AFA B;  5E5A B;  4KUD D;  1EQZ B;  1P3F B;  3MGP A;  4H9Q A;  5DNN B;  5B40 B;  3WTP A;  3MGP D;  3AZI C;  1U35 C;  3WTP D;  3B6G A;  3W97 A;  1AOI A;  5BT1 C;  3B6G D;  3KWQ B;  2YFW A;  4J8W A;  3W97 D;  2BYK B;  4CSR A;  3AZL B;  1H3O A;  5CP6 A;  4J8W D;  5CPK B;  1BH8 B;  5BNX B;  1ID3 A;  3W96 D;  3MGQ C;  5CP6 D;  3C1B C;  1P3O B;  3AV1 D;  1ID3 D;  1B6W A;  5JRG B;  3REK A;  5KDM A;  3X1V C;  3AZE A;  3AFA A;  5E5A A;  5BNV B;  3TU4 C;  1EQZ A;  3REK D;  5AV5 B;  1P3F A;  3AFA D;  5E5A D;  3VH5 T;  3KUY B;  5DNN A;  5B1M B;  5B40 A;  1P3F D;  1EQZ D;  3A6N C;  5DNN D;  5B40 D;  3AZH B;  3KWQ A;  1KX3 B;  2BYK A;  4NFT A;  3KWQ D;  3REL C;  5CPK A;  1BH8 A;  1BH9 B;  5BNX A;  1P3O A;  5C3I B;  5CPK D;  1P3O D;  3B0C T;  4H9S A;  5JRG A;  5BNV A;  5JRG D;  5AV5 A;  3WTP C;  3KUY A;  5B1M A;  5AV5 D;  3KUY D;  3B6G C;  5B1M D;  3W97 C;  4QLC D;  4J8W C;  3AZH A;  4ZBJ C;  1KX3 A;  4KGC B;  3AZH D;  5GT0 C;  1KX3 D;  1ID3 C;  1BH9 A;  1BFM A;  3W98 C;  3AZE C;  3AFA C;  5E5A C;  5AVC B;  3AZF B;  4LD9 B;  1P3G B;  3B0D B;  3KWQ C;  4YM6 B;  4HGA B;  3AZL C;  4KGC A;  5CPK C;  1P3K B;  2ARO B;  4KGC D;  1P3O C;  1KX4 B;  3B6F B;  4H9S C;  5JRG C;  1P3I B;  5AVC A;  5AV9 B;  3AZF A;  5AV5 C;  3KUY C;  5AVC D;  4LD9 A;  2IO5 B;  5B1M C;  3AZF D;  1M1A B;  1M18 B;  4LD9 D;  1P3G A;  1U35 B;  3AZH C;  1P3G D;  4YM6 A;  1KX3 C;  4YM6 D;  1P3K A;  2ARO A;  4WZS B;  5C3I C;  1P3K D;  2ARO D;  1KX4 A;  4AWL C;  3B6F A;  3W99 B;  1KX4 D;  3MGQ B;  1P3I A;  3B6F D;  5AV9 A;  5CPI B;  1P3I D;  3VH6 T;  5AV9 D;  3V9R B;  1M1A A;  3TU4 B;  1M18 A;  1M1A D;  4Z2M G;  1P3M D;  1B67 A;  4KHA B;  1U35 A;  1ZLA B;  3AZG B;  3LZ0 B;  1U35 D;  4KGC C;  3C1C B;  2F8N B;  3R45 B;  3REL B;  3W99 A;  3MGQ A;  3UTA C;  3AZF C;  5CPI A;  3MGQ D;  4LD9 C;  5CPI D;  3V9R A;  3TU4 A;  5B33 B;  3TU4 D;  4NE3 A;  4KHA A;  4YM6 C;  1ZLA A;  3AZG A;  3LZ0 A;  4HGA C;  3C1C A;  1P34 B;  1P3B B;  1ZLA D;  4NE6 A;  1P3K C;  2ARO C;  2F8N A;  3C1C D;  4X23 B;  5FUG B;  3R45 A;  3B6F C;  2JSS A;  2F8N D;  5GT0 B;  3LJA B;  3REL A;  3REL D;  5AV9 C;  1M19 C;  2IO5 C;  1M1A C;  3W98 B;  2RVQ C;  1M18 C;  3X1S B;  5B33 A;  3AN2 C;  1P3B A;  1P34 A;  4H9O B;  5CPJ B;  3WA9 C;  3REJ C;  1P3B D;  1P34 D;  4X23 A;  5FUG A;  2NQB C;  3W99 C;  5GT0 A;  4X23 D;  3LJA A;  3WTP E;  5GT0 D;  5AV6 B;  3LJA D;  5CPI C;  3W98 A;  3W98 D;  3X1S A;  3AZE D;  1JFI B;  4R8P C;  1KU5 A;  1KX5 C;  4E44 A;  4ZUX B;  3X1S D;  1ZLA C;  3AZG C;  3LZ0 C;  3MNN B;  3C1C C;  4H9O A;  5CPJ A;  5CPJ D;  5F99 B;  3AZL A;  3AZL D;  5AV6 A;  4AWL B;  1F1E A;  5AV6 D;  5B33 C;  5B24 B;  4J8X B;  1JFI A;  4WU8 C;  4ZUX A;  3MGR B;  2LY8 A;  4ZUX D;  3MNN A;  4WNN B;  1P34 C;  1P3B C;  2F8N G;  3MNN D;  1S32 B;  4X23 C;  3UT9 C;  5F99 A;  5BS7 A;  3LJA C;  4Z2M H;  5F99 D;  4EO5 B;  4H9P B;  3UTA B;  3X1S C;  5B24 A;  4J8X A;  1P3L B;  4J8X D;  3MGR A;  3VH5 W;  4WNN A;  3MGR D;  5CPJ C;  4G92 B;  3X1T B;  1S32 A;  1S32 D;  3VH5 A;  5AV6 C;  4H9P A;  5CHL B;  3B0B A;  1HTA A;  5GXQ C;  4XUJ B;  3UTA A;  1M19 B;  3B0C W;  1P3L A;  3UTA D;  4ZUX C;  1P3L D;  3MNN C;  1TZY B;  2CWE A;  3AN2 B;  3X1T A;  5B0Z B;  5F99 C;  5BS7 C;  3X1T D;  3WA9 B;  3REJ B;  5GT3 C;  2PYO C;  2NQB B;  4YS3 B;  1F66 B;  4XUJ A;  5B24 C;  4J8X C;  1M19 A;  4XUJ D;  1M19 D;  3MGS B;  3MGR C;  3NQJ B;  2RVQ D;  4CAY B;  3AV2 B;  1M18 D;  5JA4 B;  4R8P B;  1KX5 B;  1TZY A;  1S32 C;  3AN2 A;  5G49 B;  1TZY D;  5B0Z A;  3AN2 D;  5B0Z D;  3WA9 A;  3REJ A;  4E45 A;  4EO5 C;  1R4V A;  2NQB A;  3REJ D;  3WA9 D;  4H9R B;  4YS3 A;  2NQB D;  1F66 A;  3W99 D;  4YS3 D;  3AZM C;  1P3L C;  1F66 D;  5BO0 B;  4J8U B;  3MGS A;  3NQJ A;  3AZN C;  3MGS D;  3AV2 A;  4CAY A;  4WU8 B;  5JA4 A;  4R8P A;  4G92 C;  1KX5 A;  3X1T C;  3AV2 D;  4R8P D;  5G49 A;  1KX5 D;  5DNM B;  3AZG D;  3LZ0 D;  5AV8 C;  3X1U B;  3UT9 B;  4H9R A;  2F8N H;  2L5A A;  4XUJ C;  2F8N K;  1TAF B;  4JJN B;  5BO0 A;  4J8U A;  2HIO C;  4KUD B;  3KXB C;  4J8U D;  3VH6 W;  3O62 C;  4XZQ B;  4WU8 A;  1TZY C;  5B33 D;  4Z5T B;  5B32 B;  3MGP B;  1P3P C;  4Z66 C;  4WU8 D;  5B0Z C;  5B1L B;  3VH6 A;  5DNM A;  5B31 B;  5DNM D;  3UT9 A;  3AYW B;  2CV5 B;  4YS3 C;  1ULY A;  3UT9 D;  3W96 B;  1F66 C;  3AV1 B;  5AY8 B;  1TAF A;  4JJN A;  5GXQ B;  3MGS C;  4KUD A;  4JJN D;  3AV2 C;  4XZQ A;  4Z5T A;  5B32 A;  4XZQ D;  5B0Y B;  5B1L A;  1HQ3 B;  4M6B A;  4Z5T D;  5B32 D;  5B1L D;  5B31 A;  3LZ1 B;  3KSY A;  3AYW A;  5B31 D;  2CV5 A;  3MVD B;  3W96 A;  5GT3 B;  3AYW D;  2CV5 D;  1AOI B;  2PYO B;  3LEL B;  3REH B;  3UTB C;  3AV1 A;  4WU9 C;  5AY8 A;  4J8U C;  5GXQ A;  3WKJ B;  3WAA B;  5AY8 D;  2HUE C;  5GXQ D;  3REI B;  5B0Y A;  5DNM C;  1HQ3 A;  2YFV B;  5B0Y D;  3AZK B;  4QLC B;  1HQ3 D;  3X1U C;  3LZ1 A;  5GSU B;  3LZ1 D;  3MVD A;  5GT3 A;  2PYO A;  3MVD D; 
#chains in the Genus database with same CATH topology
 3LEL A;  3REH A;  5GT3 D;  1AOI D;  4JJN C;  3AZJ B;  5B2J B;  2PYO D;  4KUD C;  3LEL D;  3REH D;  3WKJ A;  3WAA A;  3AZM B;  5B2I B;  4XZQ C;  3WKJ D;  3WAA D;  5B24 D;  1T3U A;  4Z5T C;  5B32 C;  3MGP C;  2ZM5 A;  3REI A;  3AZN B;  2NZD B;  5B1L C;  3EG5 B;  3REI D;  2YFV A;  5B31 C;  4QLC A;  3AZK A;  3AYW C;  3AZK D;  2CV5 C;  5GSU A;  1P3A B;  4DRB A;  4J8V B;  3W96 C;  5CP6 C;  5AV8 B;  5GSU D;  3AV1 C;  5AY8 C;  3AZJ A;  5B2J A;  3AZJ D;  3AZM A;  5B2J D;  5B2I A;  3REK C;  5B32 G;  2DQN C;  2HIO B;  5B2I D;  3AZM D;  1EQZ C;  3KXB B;  1P3F C;  5B0Y C;  3AZN A;  3O62 B;  2NZD A;  5DNN C;  5B40 C;  1HQ3 C;  5B31 G;  2NZD D;  3AZN D;  1P3P B;  4Z66 B;  2J8P A;  3LZ1 C;  5AVB B;  3MVD C;  4J8V A;  1P3A A;  1AOI C;  5AV8 A;  1P3A D;  3LEL C;  4J8V D;  3REH C;  5AV8 D;  1WWI A;  3WKJ C;  3WAA C;  4G91 B;  2FJ7 B;  2BYM B;  2HIO A;  3REI C;  3KXB A;  2HIO D;  3O62 A;  3KXB D;  1P3M B;  1A7W A;  3O62 D;  3AZK C;  4QLC C;  1P3P A;  4Z66 A;  3AZI B;  1P3P D;  5GSU C;  4Z66 D;  2Y2O A;  5AVB A;  5AVB D;  3AZJ C;  5B2J C;  5B2I C;  3UTB B;  3H0R C;  4WU9 B;  2FJ7 A;  1WWS A;  2BYM A;  3NQU B;  3C1B B;  2FJ7 D;  2NZD C;  2HUE B;  3X1V B;  2DF4 C;  1P3M A;  1N1J B;  4NE5 A;  3AZI A;  1P3A C;  3A6N B;  4J8V C;  4H9N B;  3AZI D;  5BT1 D;  2Y2P A;  1Q9C A;  3UTB A;  4WU9 A;  5AVC C;  3NQU A;  3C1B A;  4WU9 D;  3UTB D;  3C1B D;  4UUZ B;  4DRA A;  3X1V A;  1N1J A;  1P3G C;  3X1V D;  4H9Q B;  3WTP B;  3B0D C;  2ZY5 A;  5AVB C;  3A6N A;  3B6G B;  4H9N A;  4UPK A;  3W97 B;  3X1U A;  3A6N D;  4WV4 B;  2YFW B;  4J8W B;  3X1U D;  4ZBJ B;  4CSR B;  1KX4 C;  1H3O B;  5CP6 B;  4G91 C;  1ID3 B;  2FJ7 C;  1P3I C;  4UUZ A;  5KDM B;  3REK B;  3AZE B;  1P3M C;  3AFA B;  5E5A B;  4KUD D;  1EQZ B;  1P3F B;  3MGP A;  4H9Q A;  5DNN B;  5B40 B;  3WTP A;  3MGP D;  3AZI C;  1U35 C;  3A1K A;  3WTP D;  3B6G A;  3W97 A;  1AOI A;  5BT1 C;  3B6G D;  3KWQ B;  2YFW A;  4J8W A;  3W97 D;  2BYK B;  4CSR A;  3AZL B;  1H3O A;  5CP6 A;  4J8W D;  5CPK B;  1BH8 B;  5BNX B;  1ID3 A;  3W96 D;  3MGQ C;  5CP6 D;  3C1B C;  1P3O B;  3AV1 D;  1ID3 D;  1B6W A;  5JRG B;  2ZY3 A;  3REK A;  1W2E A;  5KDM A;  3X1V C;  3AZE A;  2W8S A;  5E5A A;  5BNV B;  3AFA A;  2Y2J A;  3TU4 C;  3REK D;  5AV5 B;  1P3F A;  1EQZ A;  3AL0 C;  3AFA D;  5E5A D;  3VH5 T;  3KUY B;  5DNN A;  5B1M B;  5B40 A;  1P3F D;  1EQZ D;  3A6N C;  5DNN D;  5B40 D;  2XD1 A;  3AZH B;  3KWQ A;  1KX3 B;  2BYK A;  4NFT A;  4DQY B;  3KWQ D;  3REL C;  5CPK A;  1BH8 A;  1BH9 B;  5BNX A;  1P3O A;  5C3I B;  5CPK D;  1P3O D;  3B0C T;  4H9S A;  5JRG A;  5BNV A;  5JRG D;  5AV5 A;  3WTP C;  3KUY A;  5B1M A;  5AV5 D;  3KUY D;  3B6G C;  5B1M D;  3W97 C;  4QLC D;  4J8W C;  3AZH A;  4ZBJ C;  1KX3 A;  4KGC B;  4WJ3 C;  3AZH D;  5GT0 C;  1KX3 D;  1ID3 C;  1BH9 A;  1BFM A;  3W98 C;  3AZE C;  3AFA C;  5E5A C;  5AVC B;  3AZF B;  4LD9 B;  1PZR A;  1P3G B;  3B0D B;  3KWQ C;  4YM6 B;  4HGA B;  3AZL C;  4KGC A;  5CPK C;  1P3K B;  2ARO B;  4KGC D;  1P3O C;  1KX4 B;  3B6F B;  4H9S C;  5JRG C;  1P3I B;  5AVC A;  5AV9 B;  3AZF A;  5AV5 C;  3KUY C;  5AVC D;  4LD9 A;  2IO5 B;  5B1M C;  3AZF D;  1M1A B;  1M18 B;  4LD9 D;  1P3G A;  1U35 B;  3AZH C;  1P3G D;  4YM6 A;  1KX3 C;  4YM6 D;  1P3K A;  2ARO A;  4WZS B;  5C3I C;  1P3K D;  2ARO D;  1KX4 A;  4AWL C;  3B6F A;  3W99 B;  2XD5 A;  1KX4 D;  3MGQ B;  1P3I A;  3B6F D;  5AV9 A;  5CPI B;  1P3I D;  3VH6 T;  5AV9 D;  3V9R B;  3A1I A;  1M1A A;  3TU4 B;  1M18 A;  1M1A D;  4Z2M G;  2Y2M A;  1P3M D;  1B67 A;  4KHA B;  1U35 A;  1ZLA B;  3AZG B;  3LZ0 B;  1U35 D;  4KGC C;  3C1C B;  2F8N B;  3R45 B;  3REL B;  3W99 A;  3MGQ A;  3UTA C;  3AZF C;  5CPI A;  3MGQ D;  4LD9 C;  5CPI D;  3V9R A;  3TU4 A;  5B33 B;  3TU4 D;  4NE3 A;  4KHA A;  3EPH A;  4YM6 C;  1ZLA A;  3AZG A;  3LZ0 A;  4HGA C;  3C1C A;  1P34 B;  1P3B B;  1ZLA D;  4NE6 A;  1P3K C;  2ARO C;  2F8N A;  3C1C D;  4X23 B;  5FUG B;  3R45 A;  3B6F C;  2JSS A;  2F8N D;  5GT0 B;  3LJA B;  3REL A;  3REL D;  5AV9 C;  1M19 C;  2IO5 C;  1M1A C;  3W98 B;  2RVQ C;  1M18 C;  3X1S B;  5B33 A;  2JCH A;  3AN2 C;  1P3B A;  1P34 A;  4H9O B;  5CPJ B;  3WA9 C;  3REJ C;  1P3B D;  1P34 D;  4X23 A;  5FUG A;  2NQB C;  3W99 C;  5GT0 A;  4X23 D;  3LJA A;  3WTP E;  5GT0 D;  5AV6 B;  3LJA D;  5CPI C;  3W98 A;  3W98 D;  3X1S A;  3AZE D;  1JFI B;  4R8P C;  1KU5 A;  1KX5 C;  4E44 A;  4ZUX B;  3X1S D;  1ZLA C;  3AZG C;  3LZ0 C;  3MNN B;  3C1C C;  4H9O A;  5CPJ A;  5CPJ D;  5F99 B;  3AZL A;  3AZL D;  5AV6 A;  4AWL B;  1F1E A;  5AV6 D;  5B33 C;  5B24 B;  4J8X B;  1JFI A;  4WU8 C;  4ZUX A;  3MGR B;  2G5I C;  2LY8 A;  4ZUX D;  3MNN A;  4WNN B;  1P34 C;  1P3B C;  2F8N G;  3MNN D;  1S32 B;  4X23 C;  3UT9 C;  5F99 A;  5BS7 A;  3LJA C;  4Z2M H;  2Y2K A;  5F99 D;  4EO5 B;  4H9P B;  3H0M C;  3UTA B;  3X1S C;  5B24 A;  4J8X A;  1P3L B;  4J8X D;  3MGR A;  3EPJ A;  2FFF B;  3VH5 W;  4WNN A;  3MGR D;  5CPJ C;  3IP4 C;  4G92 B;  3X1T B;  2RIQ A;  1S32 A;  2F2A C;  3EPL A;  1S32 D;  3VH5 A;  2BG1 A;  5AV6 C;  4H9P A;  5CHL B;  3B0B A;  1HTA A;  5GXQ C;  4XUJ B;  3UTA A;  1M19 B;  3B0C W;  1P3L A;  3UTA D;  4ZUX C;  2VQR A;  1P3L D;  3KFU G;  3EPK A;  3MNN C;  1TZY B;  2CWE A;  3AN2 B;  3X1T A;  5B0Z B;  5F99 C;  5BS7 C;  3X1T D;  3WA9 B;  3REJ B;  5GT3 C;  2PYO C;  2NQB B;  4YS3 B;  1F66 B;  4XUJ A;  5B24 C;  4J8X C;  1M19 A;  4XUJ D;  1M19 D;  3MGS B;  3MGR C;  3NQJ B;  2RVQ D;  4CAY B;  3AV2 B;  1M18 D;  5JA4 B;  4R8P B;  1KX5 B;  1TZY A;  2Y2H A;  1S32 C;  3AN2 A;  5G49 B;  1TZY D;  5B0Z A;  3AN2 D;  5B0Z D;  3WA9 A;  3REJ A;  4E45 A;  4EO5 C;  1R4V A;  2NQB A;  3REJ D;  3WA9 D;  4H9R B;  4YS3 A;  2NQB D;  1F66 A;  3W99 D;  4YS3 D;  3AZM C;  1P3L C;  1F66 D;  5BO0 B;  4J8U B;  3FDD A;  3MGS A;  3NQJ A;  3AZN C;  2Y2G A;  3MGS D;  3AV2 A;  1Z2C B;  4CAY A;  4WU8 B;  5JA4 A;  4R8P A;  4G92 C;  1KX5 A;  3X1T C;  3AV2 D;  4R8P D;  5G49 A;  1KX5 D;  5DNM B;  3H0L C;  3P5J B;  3AZG D;  3LZ0 D;  5AV8 C;  3X1U B;  3UT9 B;  2Y2I A;  4H9R A;  2F8N H;  2L5A A;  4XUJ C;  2F8N K;  1TAF B;  4JJN B;  5BO0 A;  4J8U A;  2HIO C;  4KUD B;  3KXB C;  4J8U D;  3VH6 W;  3O62 C;  4XZQ B;  4WU8 A;  1TZY C;  5B33 D;  4Z5T B;  5B32 B;  3MGP B;  1P3P C;  4Z66 C;  4WU8 D;  5B0Z C;  5B1L B;  3VH6 A;  5DNM A;  5B31 B;  5DNM D;  3UT9 A;  3AYW B;  2CV5 B;  4YS3 C;  1ULY A;  3UT9 D;  3W96 B;  1F66 C;  3AV1 B;  5AY8 B;  1TAF A;  4JJN A;  5GXQ B;  3MGS C;  4KUD A;  2UWX A;  4JJN D;  3AV2 C;  4XZQ A;  4Z5T A;  5B32 A;  4XZQ D;  5B0Y B;  3F6T A;  5B1L A;  1HQ3 B;  4M6B A;  4Z5T D;  5B32 D;  2Y2L A;  5B1L D;  2Y2Q A;  5B31 A;  3LZ1 B;  3KSY A;  3AYW A;  5B31 D;  2CV5 A;  3MVD B;  3W96 A;  5GT3 B;  3AYW D;  2CV5 D;  1AOI B;  2PYO B;  3LEL B;  3REH B;  3UTB C;  3AV1 A;  4WU9 C;  5AY8 A;  4J8U C;  5GXQ A;  3WKJ B;  3WAA B;  5AY8 D;  2HUE C;  2G5H C;  5GXQ D;  2Y2N A;  3REI B;  5B0Y A;  5DNM C;  1HQ3 A;  2YFV B;  2ZY2 A;  5B0Y D;  3AZK B;  4QLC B;  1HQ3 D;  3X1U C;  3LZ1 A;  5GSU B;  3LZ1 D;  3MVD A;  2ZY4 A;  5GT3 A;  2PYO A;  2JE5 A;  3MVD D; 
#chains in the Genus database with same CATH homology
 3LEL A;  3REH A;  5GT3 D;  1AOI D;  4JJN C;  3AZJ B;  5B2J B;  2PYO D;  4KUD C;  3LEL D;  3REH D;  3WKJ A;  3WAA A;  3AZM B;  5B2I B;  4XZQ C;  3WKJ D;  3WAA D;  5B24 D;  1T3U A;  4Z5T C;  5B32 C;  3MGP C;  2ZM5 A;  3REI A;  3AZN B;  2NZD B;  5B1L C;  3EG5 B;  3REI D;  2YFV A;  5B31 C;  4QLC A;  3AZK A;  3AYW C;  3AZK D;  2CV5 C;  5GSU A;  1P3A B;  4DRB A;  4J8V B;  3W96 C;  5CP6 C;  5AV8 B;  5GSU D;  3AV1 C;  5AY8 C;  3AZJ A;  5B2J A;  3AZJ D;  3AZM A;  5B2J D;  5B2I A;  3REK C;  5B32 G;  2DQN C;  2HIO B;  5B2I D;  3AZM D;  1EQZ C;  3KXB B;  1P3F C;  5B0Y C;  3AZN A;  3O62 B;  2NZD A;  5DNN C;  5B40 C;  1HQ3 C;  5B31 G;  2NZD D;  3AZN D;  1P3P B;  4Z66 B;  2J8P A;  3LZ1 C;  5AVB B;  3MVD C;  4J8V A;  1P3A A;  1AOI C;  5AV8 A;  1P3A D;  3LEL C;  4J8V D;  3REH C;  5AV8 D;  1WWI A;  3WKJ C;  3WAA C;  4G91 B;  2FJ7 B;  2BYM B;  2HIO A;  3REI C;  3KXB A;  2HIO D;  3O62 A;  3KXB D;  1P3M B;  1A7W A;  3O62 D;  3AZK C;  4QLC C;  1P3P A;  4Z66 A;  3AZI B;  1P3P D;  5GSU C;  4Z66 D;  2Y2O A;  5AVB A;  5AVB D;  3AZJ C;  5B2J C;  5B2I C;  3UTB B;  3H0R C;  4WU9 B;  2FJ7 A;  1WWS A;  2BYM A;  3NQU B;  3C1B B;  2FJ7 D;  2NZD C;  2HUE B;  3X1V B;  2DF4 C;  1P3M A;  1N1J B;  4NE5 A;  3AZI A;  1P3A C;  3A6N B;  4J8V C;  4H9N B;  3AZI D;  5BT1 D;  2Y2P A;  1Q9C A;  3UTB A;  4WU9 A;  5AVC C;  3NQU A;  3C1B A;  4WU9 D;  3UTB D;  3C1B D;  4UUZ B;  4DRA A;  3X1V A;  1N1J A;  1P3G C;  3X1V D;  4H9Q B;  3WTP B;  3B0D C;  2ZY5 A;  5AVB C;  3A6N A;  3B6G B;  4H9N A;  4UPK A;  3W97 B;  3X1U A;  3A6N D;  4WV4 B;  2YFW B;  4J8W B;  3X1U D;  4ZBJ B;  4CSR B;  1KX4 C;  1H3O B;  5CP6 B;  4G91 C;  1ID3 B;  2FJ7 C;  1P3I C;  4UUZ A;  5KDM B;  3REK B;  3AZE B;  1P3M C;  3AFA B;  5E5A B;  4KUD D;  1EQZ B;  1P3F B;  3MGP A;  4H9Q A;  5DNN B;  5B40 B;  3WTP A;  3MGP D;  3AZI C;  1U35 C;  3A1K A;  3WTP D;  3B6G A;  3W97 A;  1AOI A;  5BT1 C;  3B6G D;  3KWQ B;  2YFW A;  4J8W A;  3W97 D;  2BYK B;  4CSR A;  3AZL B;  1H3O A;  5CP6 A;  4J8W D;  5CPK B;  1BH8 B;  5BNX B;  1ID3 A;  3W96 D;  3MGQ C;  5CP6 D;  3C1B C;  1P3O B;  3AV1 D;  1ID3 D;  1B6W A;  5JRG B;  2ZY3 A;  3REK A;  1W2E A;  5KDM A;  3X1V C;  3AZE A;  2W8S A;  5E5A A;  5BNV B;  3AFA A;  2Y2J A;  3TU4 C;  3REK D;  5AV5 B;  1P3F A;  1EQZ A;  3AL0 C;  3AFA D;  5E5A D;  3VH5 T;  3KUY B;  5DNN A;  5B1M B;  5B40 A;  1P3F D;  1EQZ D;  3A6N C;  5DNN D;  5B40 D;  2XD1 A;  3AZH B;  3KWQ A;  1KX3 B;  2BYK A;  4NFT A;  4DQY B;  3KWQ D;  3REL C;  5CPK A;  1BH8 A;  1BH9 B;  5BNX A;  1P3O A;  5C3I B;  5CPK D;  1P3O D;  3B0C T;  4H9S A;  5JRG A;  5BNV A;  5JRG D;  5AV5 A;  3WTP C;  3KUY A;  5B1M A;  5AV5 D;  3KUY D;  3B6G C;  5B1M D;  3W97 C;  4QLC D;  4J8W C;  3AZH A;  4ZBJ C;  1KX3 A;  4KGC B;  4WJ3 C;  3AZH D;  5GT0 C;  1KX3 D;  1ID3 C;  1BH9 A;  1BFM A;  3W98 C;  3AZE C;  3AFA C;  5E5A C;  5AVC B;  3AZF B;  4LD9 B;  1PZR A;  1P3G B;  3B0D B;  3KWQ C;  4YM6 B;  4HGA B;  3AZL C;  4KGC A;  5CPK C;  1P3K B;  2ARO B;  4KGC D;  1P3O C;  1KX4 B;  3B6F B;  4H9S C;  5JRG C;  1P3I B;  5AVC A;  5AV9 B;  3AZF A;  5AV5 C;  3KUY C;  5AVC D;  4LD9 A;  2IO5 B;  5B1M C;  3AZF D;  1M1A B;  1M18 B;  4LD9 D;  1P3G A;  1U35 B;  3AZH C;  1P3G D;  4YM6 A;  1KX3 C;  4YM6 D;  1P3K A;  2ARO A;  4WZS B;  5C3I C;  1P3K D;  2ARO D;  1KX4 A;  4AWL C;  3B6F A;  3W99 B;  2XD5 A;  1KX4 D;  3MGQ B;  1P3I A;  3B6F D;  5AV9 A;  5CPI B;  1P3I D;  3VH6 T;  5AV9 D;  3V9R B;  3A1I A;  1M1A A;  3TU4 B;  1M18 A;  1M1A D;  4Z2M G;  2Y2M A;  1P3M D;  1B67 A;  4KHA B;  1U35 A;  1ZLA B;  3AZG B;  3LZ0 B;  1U35 D;  4KGC C;  3C1C B;  2F8N B;  3R45 B;  3REL B;  3W99 A;  3MGQ A;  3UTA C;  3AZF C;  5CPI A;  3MGQ D;  4LD9 C;  5CPI D;  3V9R A;  3TU4 A;  5B33 B;  3TU4 D;  4NE3 A;  4KHA A;  3EPH A;  4YM6 C;  1ZLA A;  3AZG A;  3LZ0 A;  4HGA C;  3C1C A;  1P34 B;  1P3B B;  1ZLA D;  4NE6 A;  1P3K C;  2ARO C;  2F8N A;  3C1C D;  4X23 B;  5FUG B;  3R45 A;  3B6F C;  2JSS A;  2F8N D;  5GT0 B;  3LJA B;  3REL A;  3REL D;  5AV9 C;  1M19 C;  2IO5 C;  1M1A C;  3W98 B;  2RVQ C;  1M18 C;  3X1S B;  5B33 A;  2JCH A;  3AN2 C;  1P3B A;  1P34 A;  4H9O B;  5CPJ B;  3WA9 C;  3REJ C;  1P3B D;  1P34 D;  4X23 A;  5FUG A;  2NQB C;  3W99 C;  5GT0 A;  4X23 D;  3LJA A;  3WTP E;  5GT0 D;  5AV6 B;  3LJA D;  5CPI C;  3W98 A;  3W98 D;  3X1S A;  3AZE D;  1JFI B;  4R8P C;  1KU5 A;  1KX5 C;  4E44 A;  4ZUX B;  3X1S D;  1ZLA C;  3AZG C;  3LZ0 C;  3MNN B;  3C1C C;  4H9O A;  5CPJ A;  5CPJ D;  5F99 B;  3AZL A;  3AZL D;  5AV6 A;  4AWL B;  1F1E A;  5AV6 D;  5B33 C;  5B24 B;  4J8X B;  1JFI A;  4WU8 C;  4ZUX A;  3MGR B;  2G5I C;  2LY8 A;  4ZUX D;  3MNN A;  4WNN B;  1P34 C;  1P3B C;  2F8N G;  3MNN D;  1S32 B;  4X23 C;  3UT9 C;  5F99 A;  5BS7 A;  3LJA C;  4Z2M H;  2Y2K A;  5F99 D;  4EO5 B;  4H9P B;  3H0M C;  3UTA B;  3X1S C;  5B24 A;  4J8X A;  1P3L B;  4J8X D;  3MGR A;  3EPJ A;  2FFF B;  3VH5 W;  4WNN A;  3MGR D;  5CPJ C;  3IP4 C;  4G92 B;  3X1T B;  2RIQ A;  1S32 A;  2F2A C;  3EPL A;  1S32 D;  3VH5 A;  2BG1 A;  5AV6 C;  4H9P A;  5CHL B;  3B0B A;  1HTA A;  5GXQ C;  4XUJ B;  3UTA A;  1M19 B;  3B0C W;  1P3L A;  3UTA D;  4ZUX C;  2VQR A;  1P3L D;  3KFU G;  3EPK A;  3MNN C;  1TZY B;  2CWE A;  3AN2 B;  3X1T A;  5B0Z B;  5F99 C;  5BS7 C;  3X1T D;  3WA9 B;  3REJ B;  5GT3 C;  2PYO C;  2NQB B;  4YS3 B;  1F66 B;  4XUJ A;  5B24 C;  4J8X C;  1M19 A;  4XUJ D;  1M19 D;  3MGS B;  3MGR C;  3NQJ B;  2RVQ D;  4CAY B;  3AV2 B;  1M18 D;  5JA4 B;  4R8P B;  1KX5 B;  1TZY A;  2Y2H A;  1S32 C;  3AN2 A;  5G49 B;  1TZY D;  5B0Z A;  3AN2 D;  5B0Z D;  3WA9 A;  3REJ A;  4E45 A;  4EO5 C;  1R4V A;  2NQB A;  3REJ D;  3WA9 D;  4H9R B;  4YS3 A;  2NQB D;  1F66 A;  3W99 D;  4YS3 D;  3AZM C;  1P3L C;  1F66 D;  5BO0 B;  4J8U B;  3FDD A;  3MGS A;  3NQJ A;  3AZN C;  2Y2G A;  3MGS D;  3AV2 A;  1Z2C B;  4CAY A;  4WU8 B;  5JA4 A;  4R8P A;  4G92 C;  1KX5 A;  3X1T C;  3AV2 D;  4R8P D;  5G49 A;  1KX5 D;  5DNM B;  3H0L C;  3P5J B;  3AZG D;  3LZ0 D;  5AV8 C;  3X1U B;  3UT9 B;  2Y2I A;  4H9R A;  2F8N H;  2L5A A;  4XUJ C;  2F8N K;  1TAF B;  4JJN B;  5BO0 A;  4J8U A;  2HIO C;  4KUD B;  3KXB C;  4J8U D;  3VH6 W;  3O62 C;  4XZQ B;  4WU8 A;  1TZY C;  5B33 D;  4Z5T B;  5B32 B;  3MGP B;  1P3P C;  4Z66 C;  4WU8 D;  5B0Z C;  5B1L B;  3VH6 A;  5DNM A;  5B31 B;  5DNM D;  3UT9 A;  3AYW B;  2CV5 B;  4YS3 C;  1ULY A;  3UT9 D;  3W96 B;  1F66 C;  3AV1 B;  5AY8 B;  1TAF A;  4JJN A;  5GXQ B;  3MGS C;  4KUD A;  2UWX A;  4JJN D;  3AV2 C;  4XZQ A;  4Z5T A;  5B32 A;  4XZQ D;  5B0Y B;  3F6T A;  5B1L A;  1HQ3 B;  4M6B A;  4Z5T D;  5B32 D;  2Y2L A;  5B1L D;  2Y2Q A;  5B31 A;  3LZ1 B;  3KSY A;  3AYW A;  5B31 D;  2CV5 A;  3MVD B;  3W96 A;  5GT3 B;  3AYW D;  2CV5 D;  1AOI B;  2PYO B;  3LEL B;  3REH B;  3UTB C;  3AV1 A;  4WU9 C;  5AY8 A;  4J8U C;  5GXQ A;  3WKJ B;  3WAA B;  5AY8 D;  2HUE C;  2G5H C;  5GXQ D;  2Y2N A;  3REI B;  5B0Y A;  5DNM C;  1HQ3 A;  2YFV B;  2ZY2 A;  5B0Y D;  3AZK B;  4QLC B;  1HQ3 D;  3X1U C;  3LZ1 A;  5GSU B;  3LZ1 D;  3MVD A;  2ZY4 A;  5GT3 A;  2PYO A;  2JE5 A;  3MVD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...