2NQBC

Drosophila nucleosome structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbC00
1M19C 4YS3C 4Z5TD 1P3OA 4YS3B 3W99D 3KUYB 3WAAC 3X1UC 3MNNB 3RELA 4WU9B 1M1AD 3C1BC 3W96B 5B33D 4XZQB 3AZJB 1F66C 2BYKA 4Z2MG 5AVCA 3REHC 5AV5A 1F66B 3UT9C 3A6ND 3X1TB 3KSYA 4Z5TC 4ZUXB 3B0CW 3W99C 4DRBA 3O62B 4J8XD 1M1AC 1WWIA 5CPJA 5CPIC 4KUDA 5B0YB 3UTAC 5B33C 1P3BD 3AZHA 1P3MB 3UTAB 3B6FB 4R8PB 4J8WD 2CWEA 3MGPD 5GSUA 3A6NC 4KHAB 3AZIA 3LZ1B 4J8UA 4YM6C 5B31A 1BH8A 3KUYA 4J8XC 4YM6B 3MNNA 3LJAD 3AV1D 5B1LC 3W96A 5B2JB 3AZND 2PYOD 5B31G 4XZQA 3AZJA 3MGRD 4J8WC 1M18B 3MGPC 2NQBD 1P3LA 2HUEB 3X1SD 3X1TA 2AROC 4JJNB 3O62A 2AROB 1TZYD 3AZEB 2F8ND 3LJAC 3LELA 1KU5A 3AV1C 5AVBC 5JRGC 1P3PB 5G49B 4NE6A 5F99C 3REKD 5F99B 3AZNC 5B0YA 4Z66D 1KX5D 2PYOC 1P3MA 1P3AD 3MGRC 3B6FA 4KGCB 5E5AC 3VH6W 5E5AB 4X23B 3AN2D 3X1SC 1KX4C 4G92B 5B2IB 1KX4B 5GT0D 4CAYB 3W98B 3MGQD 3X1VB 2HIOB 4QLCD 4LD9A 5B0ZD 3REKC 1KX3B 5B2JA 5CP6A 4Z66C 4J8VB 1P3AC 3VH5W 3KXBB 2BYMB 1M18A 3RELD 3AZMB 3AN2C 3REJC 2IO5C 3REJB 5KDMA 4G91B 5BNVA 5GT0C 3KWQD 3MGQC 1P3FD 4QLCC 4WU8B 5B1MB 5AV5D 3AV2D 3WA9B 1P3OB 4KGCA 3UTBD 3RELC 2LY8A 2FJ7A 3B0DC 4XUJB 5B2IA 5AV9D 4KUDD 4CAYA 3AZHD 3W98A 2RVQD 3KWQC 3AZKA 1P3KD 3X1VA 5AVCC 3AFAB 5AV5C 2BYKB 1KX3A 5AVCB 5GSUD 1S32B 5C3IC 1P34A 4YS3D 2CV5B 3B6GA 5C3IB 3KUYD 3UTBC 4WNNA 3MNND 4WU9D 3AZMA 5CPJC 3MVDB 3WAAD 3TU4A 3W97A 4WV4B 4KUDC 3W96D 3AZHC 5GXQB 4XZQD 1B67A 2RVQC 3AZJD 1P3KC 4M6BA 5DNNB 1F66D 3V9RA 5GSUC 3WA9A 3X1TD 3AZIC 4ZUXD 3AZIB 3O62D 3KUYC 4J8UB 3MNNC 5B31B 1BH8B 4WU9C 1U35A 1ZLAA 5BT1D 2F8NG 4XUJA 3W96C 5CPID 5B0YD 3B0CT 4XZQC 3AZJC 3UTAD 3B6FD 5GT3A 4R8PD 3AFAA 1EQZB 1S32A 3X1TC 4ZUXC 1P3LB 3LZ1D 2CV5A 2YFWA 3O62C 3MGSA 4H9RA 4YM6D 3LELC 5BT1C 5BS7A 3MVDA 3LELB 5DNMB 5B1LD 5B2JD 5B0YC 1ID3B 1P3MC 3R45B 5GXQA 3B6FC 4R8PC 5DNNA 1M18D 3LZ1C 4JJND 1B6WA 1P3IB 3REIA 2AROD 4HGAB 5AV6A 3AZED 4CSRB 1P3PD 5AVBD 4LD9B 5AY8A 1BH9A 5JRGD 5B2JC 5F99D 2NZDB 5CP6B 5B32G 1M18C 4KGCD 1EQZA 1HQ3B 5E5AD 4X23D 2HUEC 4JJNC 1KX4D 3AZEC 1TAFA 5KDMB 3W98D 5BNVB 2HIOD 5DNMA 1M19A 3VH6T 1P3PC 1KX3D 4H9NB 1ID3A 4J8VD 3R45A 4DRAA 3C1CB 3X1UA 3KXBD 1R4VA 4KGCC 3AZMD 4X23C 1P3IA 4G92C 5B2IC 3VH5T 3REJD 2FJ7B 4CSRA 3REHA 3W98C 3AZKC 2YFVB 3X1VC 3UT9A 2HIOC 4Z2MH 4WU8D 5B1MD 3AZKB 1KX3C 2NZDA 2L5AA 3WA9D 4J8VC 3KXBC 1P3OD 1P34B 3B6GB 3WKJB 3AZMC 4WNNB 1HQ3A 2F8NK 5B33A 4XUJD 3TU4B 4G91C 5CHLB 5JA4B 3W97B 1H3OB 4WU8C 5B1MC 3AFAD 2NQBB 5CPKB 3A6NA 4H9NA 5AVCD 3AZLB 1S32D 3WA9C 3V9RB 1JFIA 4J8XA 5FUGA 3C1CA 2CV5D 1P3OC 5B24B 3WTPB 1ZLAC 3MVDD 1U35B 1ZLAB 4EO5B 5CPJD 1P3BA 4XUJC 4J8WA 5GXQD 2YFVA 3MGPA 5DNND 3AFAC 1P3GB 5GT3B 1S32C 3AYWB 2CV5C 1N1JB 3AZID 3MGSC 3AV1A 2YFWB 4J8UD 3WKJA 5B31D 4H9SA 5AV8B 4H9RB 5BS7C 3MGSB 3MVDC 3VH6A 5JA4A 3MGRA 3AZFB 1H3OA 5GXQC 4AWLB 3NQJA 5DNNC 2NQBA 5CPKA 3X1SA 3AZLA 4H9QB 3LZ0B 1TZYA 1P3LD 2F8NA 4H9OA 3REIC 2JSSA 5B24A 4J8UC 3WTPA 3VH5A 5B31C 3REIB 3AZGB 5AV6B 3LELD 5DNMD 1Q9CA 5B32B 1KX5A 1BFMA 5AY8C 1P3AA 1ID3D 5AY8B 4NE3A 1BH9B 5B40B 1ULYA 1P3MD 1P3GA 1EQZC 1AOIB 3AYWA 1P3LC 5GT0A 1P3ID 1N1JA 3MGQA 5B0ZA 5AV8A 4UUZA 1TAFB 5DNMC 4LD9D 1M19B 2NZDD 3AZFA 1ID3C 4E45A 5CP6D 3WAAB 3X1UB 3WTPE 1HQ3D 4H9QA 5BNXB 3LZ0A 1P3IC 3C1BB 3KWQA 1P3FA 4HGAC 3AZGA 3REHB 3AV2A 3UT9B 4NFTA 5B32A 4LD9C 2NZDC 4Z5TB 5CP6C 5B40A 3UTBA 3C1CD 3W99B 1M1AB 1AOIA 1HQ3C 1WWSA 5AV9A 5CPIB 3NQUB 2FJ7D 5B33B 1P3KA 5B2ID 3AZKD 3X1VD 3A6NB 4YS3A 3C1CC 1JFIB 4H9PB 4J8XB 4WU9A 1P34D 5FUGB 3B6GD 3WAAA 3WKJD 5B1LB 5BNXA 2F8NH 1P3BC 3TU4D 2FJ7C 3C1BA 1P3BB 3W97D 1A7WA 1F66A 4J8WB 3MGPB 5CPKD 5BO0B 3AZLD 4ZUXA 4Z5TA 3W99A 1P34C 5B24D 4WZSB 1M1AA 3LJAB 3B6GC 3WTPD 3WKJC 4H9SC 3AV1B 5AVBB 1U35D 1ZLAD 5JRGB 5CPIA 3TU4C 3NQUA 3AZNB 3UTAA 2PYOB 3W97C 4R8PA 3MGRB 2NQBC 3NQJB 1P3GD 5CPKC 4KHAA 5GT3D 3AZLC 3LZ1A 3X1SB 3AYWD 1TZYC 4YM6A 1TZYB 4H9PA 5B24C 2F8NB 4H9OB 3WTPC 5AV8D 3MGSD 5B1LA 1U35C 4EO5C 3REKB 1KX5C 1KX5B 4Z66B 3AZFD 3B0BA 1P3AB 4E44A 1P3GC 5GT3C 5BO0A 4JJNA 3AN2B 3AYWC 3LZ0D 2AROA 2IO5B 3AZEA 1F1EA 5GT0B 1HTAA 3LJAA 3REID 5B0ZC 5AV8C 3MGQB 3AZGD 1P3PA 5G49A 5AVBA 5AV6D 4QLCB 5B0ZB 4UUZB 5JRGA 5F99A 5B32D 2PYOA 3AZNA 3AZFC 5AY8D 4AWLC 5B40D 5E5AA 4X23A 3RELB 1AOID 1EQZD 3LZ0C 3B0DB 1KX4A 4ZBJC 1P3FC 4ZBJB 2HIOA 3AZGC 3KWQB 1P3FB 5AV6C 3AV2C 5AV5B 3REKA 5B32C 4J8VA 3AV2B 1M19D 4Z66A 3KXBA 5B40C 2BYMA 3UTBB 3X1UD 1AOIC 5CPJB 3AN2A 5AV9C 3REJA 5AV9B 4KUDB 3C1BD 4NE5A 3AZHB 4WU8A 5B1MA 1P3KB 4QLCA 3REHD 3UT9D 5GSUB
chains in the Genus database with same CATH superfamily
1M19C 3A1KA 4YS3C 4WJ3C 4Z5TD 1P3OA 3EPJA 4YS3B 3W99D 3KUYB 3WAAC 3X1UC 3MNNB 3RELA 4WU9B 1M1AD 3P5JB 3C1BC 3W96B 5B33D 4XZQB 3AZJB 1F66C 2BYKA 4Z2MG 5AVCA 3REHC 5AV5A 1F66B 3UT9C 3A6ND 3X1TB 3KSYA 4Z5TC 4ZUXB 3B0CW 3W99C 4DRBA 3O62B 4J8XD 1M1AC 1WWIA 5CPJA 2Y2QA 5CPIC 4KUDA 5B0YB 3UTAC 5B33C 1P3BD 3AZHA 1P3MB 2XD1A 3UTAB 3B6FB 4R8PB 4J8WD 2CWEA 3MGPD 5GSUA 3F6TA 3A6NC 4KHAB 3AZIA 3LZ1B 4J8UA 4YM6C 5B31A 1BH8A 3KUYA 4J8XC 4YM6B 3MNNA 3LJAD 3AV1D 5B1LC 3W96A 5B2JB 3AZND 2PYOD 5B31G 4XZQA 3AZJA 2ZY4A 3MGRD 4J8WC 1M18B 3MGPC 2NQBD 1P3LA 3AL0C 2HUEB 3X1SD 3X1TA 2AROC 4JJNB 3O62A 2AROB 1TZYD 3AZEB 2F8ND 3LJAC 3LELA 1KU5A 3AV1C 5AVBC 5JRGC 1P3PB 5G49B 4NE6A 5F99C 3REKD 5F99B 3AZNC 5B0YA 4Z66D 1KX5D 2PYOC 1P3MA 1P3AD 3MGRC 3B6FA 4KGCB 5E5AC 3VH6W 5E5AB 4X23B 3AN2D 3X1SC 1KX4C 4G92B 5B2IB 2Y2NA 2DQNC 1KX4B 5GT0D 4CAYB 3W98B 3MGQD 3X1VB 2HIOB 4QLCD 4LD9A 5B0ZD 3REKC 1KX3B 5B2JA 5CP6A 4Z66C 4J8VB 1P3AC 3VH5W 2F2AC 3KXBB 2BYMB 2ZY2A 1M18A 3RELD 3AZMB 3AN2C 2XD5A 3REJC 2G5IC 2IO5C 3REJB 5KDMA 4G91B 5BNVA 5GT0C 3KWQD 3MGQC 1P3FD 4QLCC 4WU8B 5B1MB 5AV5D 3AV2D 3WA9B 1P3OB 4KGCA 3UTBD 3RELC 2LY8A 2FJ7A 3B0DC 4XUJB 2W8SA 5B2IA 5AV9D 4KUDD 4CAYA 3AZHD 3W98A 2RVQD 3KWQC 3AZKA 1P3KD 3X1VA 5AVCC 3AFAB 5AV5C 2BYKB 1KX3A 5AVCB 5GSUD 1S32B 3EPHA 5C3IC 1P34A 4YS3D 2CV5B 3B6GA 5C3IB 3KUYD 3UTBC 4WNNA 3MNND 2Y2OA 4WU9D 3AZMA 5CPJC 3MVDB 3WAAD 3TU4A 3W97A 4WV4B 4KUDC 3W96D 3AZHC 5GXQB 4XZQD 1B67A 2RVQC 3AZJD 1P3KC 4DQYB 4M6BA 5DNNB 1F66D 3V9RA 5GSUC 3WA9A 3X1TD 3AZIC 4ZUXD 3AZIB 3O62D 3KUYC 4J8UB 3MNNC 5B31B 1BH8B 4WU9C 1U35A 1ZLAA 5BT1D 2F8NG 4XUJA 3W96C 5CPID 5B0YD 3B0CT 4XZQC 3AZJC 3UTAD 3B6FD 5GT3A 4R8PD 3AFAA 1EQZB 2BG1A 1S32A 3X1TC 2FFFB 4ZUXC 1P3LB 3LZ1D 2CV5A 2YFWA 3O62C 2Y2LA 3MGSA 4H9RA 4YM6D 3LELC 5BT1C 5BS7A 3MVDA 3LELB 5DNMB 2Y2MA 5B1LD 2JE5A 5B2JD 5B0YC 1ID3B 1P3MC 3R45B 5GXQA 3B6FC 4R8PC 5DNNA 1M18D 2RIQA 3LZ1C 2DF4C 1B6WA 4JJND 1P3IB 3REIA 2AROD 4HGAB 5AV6A 3AZED 4CSRB 1P3PD 5AVBD 4LD9B 5AY8A 1BH9A 5JRGD 5B2JC 5F99D 2NZDB 5CP6B 5B32G 1M18C 4KGCD 1EQZA 1HQ3B 5E5AD 4X23D 2HUEC 4JJNC 1KX4D 3AZEC 1TAFA 5KDMB 3W98D 5BNVB 2HIOD 5DNMA 1M19A 3VH6T 1P3PC 1KX3D 4H9NB 1ID3A 4J8VD 2Y2GA 3R45A 4DRAA 3C1CB 2UWXA 3X1UA 3KXBD 1R4VA 4KGCC 3H0RC 3AZMD 4X23C 1P3IA 4G92C 5B2IC 3VH5T 3REJD 2FJ7B 4CSRA 3REHA 3W98C 3AZKC 2YFVB 3X1VC 3UT9A 2HIOC 4Z2MH 4WU8D 5B1MD 3AZKB 1KX3C 2NZDA 2L5AA 3H0LC 4J8VC 3WA9D 1W2EA 3KXBC 1P3OD 1P34B 3B6GB 3WKJB 3AZMC 4WNNB 1HQ3A 2F8NK 3IP4C 5B33A 4XUJD 3TU4B 2ZM5A 4G91C 5CHLB 5JA4B 3W97B 1H3OB 4WU8C 5B1MC 3AFAD 2NQBB 5CPKB 3A6NA 4H9NA 5AVCD 3AZLB 1S32D 3WA9C 3V9RB 1JFIA 4J8XA 5FUGA 3C1CA 2CV5D 1P3OC 5B24B 2Y2JA 3WTPB 1ZLAC 3MVDD 1U35B 3H0MC 4EO5B 1ZLAB 5CPJD 1P3BA 4XUJC 4J8WA 5GXQD 2YFVA 3MGPA 5DNND 3AFAC 1P3GB 5GT3B 1S32C 3AYWB 2CV5C 1N1JB 3AZID 3MGSC 3AV1A 2YFWB 4J8UD 3WKJA 5B31D 4H9SA 5AV8B 4H9RB 5BS7C 3MGSB 3MVDC 3VH6A 5JA4A 3MGRA 3AZFB 1H3OA 5GXQC 4AWLB 3NQJA 5DNNC 2NQBA 5CPKA 3EPLA 3X1SA 3AZLA 4H9QB 3LZ0B 1TZYA 1P3LD 3EG5B 2F8NA 4H9OA 3REIC 2JSSA 5B24A 4J8UC 3WTPA 3VH5A 5B31C 3REIB 3AZGB 5AV6B 3LELD 5DNMD 1Q9CA 5B32B 1KX5A 1BFMA 5AY8C 1P3AA 1ID3D 5AY8B 4NE3A 1BH9B 1T3UA 5B40B 2VQRA 1ULYA 1P3MD 1P3GA 1EQZC 1AOIB 3EPKA 3AYWA 1P3LC 5GT0A 2ZY3A 1P3ID 1N1JA 3MGQA 5B0ZA 5AV8A 4UUZA 1TAFB 5DNMC 4LD9D 1M19B 2NZDD 3AZFA 1ID3C 3KFUG 4E45A 5CP6D 2Y2PA 3WAAB 3X1UB 3WTPE 1HQ3D 4H9QA 5BNXB 3LZ0A 1P3IC 3C1BB 3KWQA 1P3FA 4HGAC 3AZGA 1Z2CB 3REHB 3AV2A 3UT9B 4NFTA 5B32A 4LD9C 2NZDC 4Z5TB 2J8PA 5CP6C 5B40A 3UTBA 3C1CD 3W99B 1M1AB 1AOIA 1HQ3C 1WWSA 5AV9A 5CPIB 3NQUB 2FJ7D 5B33B 1P3KA 5B2ID 3AZKD 3X1VD 3A6NB 4YS3A 3C1CC 1JFIB 4H9PB 4J8XB 4WU9A 1P34D 5FUGB 3B6GD 3WAAA 3WKJD 5B1LB 5BNXA 2JCHA 2F8NH 1P3BC 3TU4D 2FJ7C 3C1BA 1P3BB 3W97D 1A7WA 3A1IA 1F66A 4J8WB 2Y2HA 3MGPB 5CPKD 5BO0B 3AZLD 4ZUXA 4Z5TA 3W99A 1P34C 5B24D 4WZSB 1M1AA 3LJAB 3B6GC 3WTPD 3WKJC 4H9SC 3AV1B 5AVBB 1U35D 1ZLAD 5JRGB 5CPIA 3TU4C 3NQUA 3AZNB 3UTAA 2PYOB 3W97C 4R8PA 3MGRB 2G5HC 2NQBC 3NQJB 1P3GD 5CPKC 1PZRA 4KHAA 5GT3D 3AZLC 3LZ1A 3X1SB 3AYWD 1TZYC 4YM6A 1TZYB 4H9PA 2Y2IA 5B24C 2F8NB 4H9OB 3WTPC 5AV8D 3MGSD 5B1LA 1U35C 4EO5C 3REKB 1KX5C 1KX5B 4Z66B 3AZFD 3B0BA 1P3AB 4E44A 1P3GC 5GT3C 5BO0A 4JJNA 3AN2B 3AYWC 3LZ0D 2AROA 2IO5B 3AZEA 1F1EA 5GT0B 1HTAA 3LJAA 3REID 5B0ZC 5AV8C 3MGQB 3AZGD 1P3PA 5G49A 5AVBA 5AV6D 4QLCB 5B0ZB 4UUZB 5JRGA 5F99A 3FDDA 5B32D 2PYOA 3AZNA 3AZFC 5AY8D 4AWLC 5B40D 5E5AA 4X23A 3RELB 1AOID 1EQZD 3LZ0C 3B0DB 1KX4A 4ZBJC 4UPKA 1P3FC 4ZBJB 2HIOA 3AZGC 3KWQB 1P3FB 5AV6C 3AV2C 5AV5B 3REKA 5B32C 4J8VA 3AV2B 1M19D 4Z66A 2Y2KA 3KXBA 5B40C 2BYMA 3UTBB 3X1UD 1AOIC 5CPJB 3AN2A 5AV9C 3REJA 5AV9B 4KUDB 2ZY5A 3C1BD 4NE5A 3AZHB 4WU8A 5B1MA 1P3KB 4QLCA 3REHD 3UT9D 5GSUB
chains in the Genus database with same CATH topology
1M19C 3A1KA 4YS3C 4WJ3C 4Z5TD 1P3OA 3EPJA 4YS3B 3W99D 3KUYB 3WAAC 3X1UC 3MNNB 3RELA 4WU9B 1M1AD 3P5JB 3C1BC 3W96B 5B33D 4XZQB 3AZJB 1F66C 2BYKA 4Z2MG 5AVCA 3REHC 5AV5A 1F66B 3UT9C 3A6ND 3X1TB 3KSYA 4Z5TC 4ZUXB 3B0CW 3W99C 4DRBA 3O62B 4J8XD 1M1AC 1WWIA 5CPJA 2Y2QA 5CPIC 4KUDA 5B0YB 3UTAC 5B33C 1P3BD 3AZHA 1P3MB 2XD1A 3UTAB 3B6FB 4R8PB 4J8WD 2CWEA 3MGPD 5GSUA 3F6TA 3A6NC 4KHAB 3AZIA 3LZ1B 4J8UA 4YM6C 5B31A 1BH8A 3KUYA 4J8XC 4YM6B 3MNNA 3LJAD 3AV1D 5B1LC 3W96A 5B2JB 3AZND 2PYOD 5B31G 4XZQA 3AZJA 2ZY4A 3MGRD 4J8WC 1M18B 3MGPC 2NQBD 1P3LA 3AL0C 2HUEB 3X1SD 3X1TA 2AROC 4JJNB 3O62A 2AROB 1TZYD 3AZEB 2F8ND 3LJAC 3LELA 1KU5A 3AV1C 5AVBC 5JRGC 1P3PB 5G49B 4NE6A 5F99C 3REKD 5F99B 3AZNC 5B0YA 4Z66D 1KX5D 2PYOC 1P3MA 1P3AD 3MGRC 3B6FA 4KGCB 5E5AC 3VH6W 5E5AB 4X23B 3AN2D 3X1SC 1KX4C 4G92B 5B2IB 2Y2NA 2DQNC 1KX4B 5GT0D 4CAYB 3W98B 3MGQD 3X1VB 2HIOB 4QLCD 4LD9A 5B0ZD 3REKC 1KX3B 5B2JA 5CP6A 4Z66C 4J8VB 1P3AC 3VH5W 2F2AC 3KXBB 2BYMB 2ZY2A 1M18A 3RELD 3AZMB 3AN2C 2XD5A 3REJC 2G5IC 2IO5C 3REJB 5KDMA 4G91B 5BNVA 5GT0C 3KWQD 3MGQC 1P3FD 4QLCC 4WU8B 5B1MB 5AV5D 3AV2D 3WA9B 1P3OB 4KGCA 3UTBD 3RELC 2LY8A 2FJ7A 3B0DC 4XUJB 2W8SA 5B2IA 5AV9D 4KUDD 4CAYA 3AZHD 3W98A 2RVQD 3KWQC 3AZKA 1P3KD 3X1VA 5AVCC 3AFAB 5AV5C 2BYKB 1KX3A 5AVCB 5GSUD 1S32B 3EPHA 5C3IC 1P34A 4YS3D 2CV5B 3B6GA 5C3IB 3KUYD 3UTBC 4WNNA 3MNND 2Y2OA 4WU9D 3AZMA 5CPJC 3MVDB 3WAAD 3TU4A 3W97A 4WV4B 4KUDC 3W96D 3AZHC 5GXQB 4XZQD 1B67A 2RVQC 3AZJD 1P3KC 4DQYB 4M6BA 5DNNB 1F66D 3V9RA 5GSUC 3WA9A 3X1TD 3AZIC 4ZUXD 3AZIB 3O62D 3KUYC 4J8UB 3MNNC 5B31B 1BH8B 4WU9C 1U35A 1ZLAA 5BT1D 2F8NG 4XUJA 3W96C 5CPID 5B0YD 3B0CT 4XZQC 3AZJC 3UTAD 3B6FD 5GT3A 4R8PD 3AFAA 1EQZB 2BG1A 1S32A 3X1TC 2FFFB 4ZUXC 1P3LB 3LZ1D 2CV5A 2YFWA 3O62C 2Y2LA 3MGSA 4H9RA 4YM6D 3LELC 5BT1C 5BS7A 3MVDA 3LELB 5DNMB 2Y2MA 5B1LD 2JE5A 5B2JD 5B0YC 1ID3B 1P3MC 3R45B 5GXQA 3B6FC 4R8PC 5DNNA 1M18D 2RIQA 3LZ1C 2DF4C 1B6WA 4JJND 1P3IB 3REIA 2AROD 4HGAB 5AV6A 3AZED 4CSRB 1P3PD 5AVBD 4LD9B 5AY8A 1BH9A 5JRGD 5B2JC 5F99D 2NZDB 5CP6B 5B32G 1M18C 4KGCD 1EQZA 1HQ3B 5E5AD 4X23D 2HUEC 4JJNC 1KX4D 3AZEC 1TAFA 5KDMB 3W98D 5BNVB 2HIOD 5DNMA 1M19A 3VH6T 1P3PC 1KX3D 4H9NB 1ID3A 4J8VD 2Y2GA 3R45A 4DRAA 3C1CB 2UWXA 3X1UA 3KXBD 1R4VA 4KGCC 3H0RC 3AZMD 4X23C 1P3IA 4G92C 5B2IC 3VH5T 3REJD 2FJ7B 4CSRA 3REHA 3W98C 3AZKC 2YFVB 3X1VC 3UT9A 2HIOC 4Z2MH 4WU8D 5B1MD 3AZKB 1KX3C 2NZDA 2L5AA 3H0LC 4J8VC 3WA9D 1W2EA 3KXBC 1P3OD 1P34B 3B6GB 3WKJB 3AZMC 4WNNB 1HQ3A 2F8NK 3IP4C 5B33A 4XUJD 3TU4B 2ZM5A 4G91C 5CHLB 5JA4B 3W97B 1H3OB 4WU8C 5B1MC 3AFAD 2NQBB 5CPKB 3A6NA 4H9NA 5AVCD 3AZLB 1S32D 3WA9C 3V9RB 1JFIA 4J8XA 5FUGA 3C1CA 2CV5D 1P3OC 5B24B 2Y2JA 3WTPB 1ZLAC 3MVDD 1U35B 3H0MC 4EO5B 1ZLAB 5CPJD 1P3BA 4XUJC 4J8WA 5GXQD 2YFVA 3MGPA 5DNND 3AFAC 1P3GB 5GT3B 1S32C 3AYWB 2CV5C 1N1JB 3AZID 3MGSC 3AV1A 2YFWB 4J8UD 3WKJA 5B31D 4H9SA 5AV8B 4H9RB 5BS7C 3MGSB 3MVDC 3VH6A 5JA4A 3MGRA 3AZFB 1H3OA 5GXQC 4AWLB 3NQJA 5DNNC 2NQBA 5CPKA 3EPLA 3X1SA 3AZLA 4H9QB 3LZ0B 1TZYA 1P3LD 3EG5B 2F8NA 4H9OA 3REIC 2JSSA 5B24A 4J8UC 3WTPA 3VH5A 5B31C 3REIB 3AZGB 5AV6B 3LELD 5DNMD 1Q9CA 5B32B 1KX5A 1BFMA 5AY8C 1P3AA 1ID3D 5AY8B 4NE3A 1BH9B 1T3UA 5B40B 2VQRA 1ULYA 1P3MD 1P3GA 1EQZC 1AOIB 3EPKA 3AYWA 1P3LC 5GT0A 2ZY3A 1P3ID 1N1JA 3MGQA 5B0ZA 5AV8A 4UUZA 1TAFB 5DNMC 4LD9D 1M19B 2NZDD 3AZFA 1ID3C 3KFUG 4E45A 5CP6D 2Y2PA 3WAAB 3X1UB 3WTPE 1HQ3D 4H9QA 5BNXB 3LZ0A 1P3IC 3C1BB 3KWQA 1P3FA 4HGAC 3AZGA 1Z2CB 3REHB 3AV2A 3UT9B 4NFTA 5B32A 4LD9C 2NZDC 4Z5TB 2J8PA 5CP6C 5B40A 3UTBA 3C1CD 3W99B 1M1AB 1AOIA 1HQ3C 1WWSA 5AV9A 5CPIB 3NQUB 2FJ7D 5B33B 1P3KA 5B2ID 3AZKD 3X1VD 3A6NB 4YS3A 3C1CC 1JFIB 4H9PB 4J8XB 4WU9A 1P34D 5FUGB 3B6GD 3WAAA 3WKJD 5B1LB 5BNXA 2JCHA 2F8NH 1P3BC 3TU4D 2FJ7C 3C1BA 1P3BB 3W97D 1A7WA 3A1IA 1F66A 4J8WB 2Y2HA 3MGPB 5CPKD 5BO0B 3AZLD 4ZUXA 4Z5TA 3W99A 1P34C 5B24D 4WZSB 1M1AA 3LJAB 3B6GC 3WTPD 3WKJC 4H9SC 3AV1B 5AVBB 1U35D 1ZLAD 5JRGB 5CPIA 3TU4C 3NQUA 3AZNB 3UTAA 2PYOB 3W97C 4R8PA 3MGRB 2G5HC 2NQBC 3NQJB 1P3GD 5CPKC 1PZRA 4KHAA 5GT3D 3AZLC 3LZ1A 3X1SB 3AYWD 1TZYC 4YM6A 1TZYB 4H9PA 2Y2IA 5B24C 2F8NB 4H9OB 3WTPC 5AV8D 3MGSD 5B1LA 1U35C 4EO5C 3REKB 1KX5C 1KX5B 4Z66B 3AZFD 3B0BA 1P3AB 4E44A 1P3GC 5GT3C 5BO0A 4JJNA 3AN2B 3AYWC 3LZ0D 2AROA 2IO5B 3AZEA 1F1EA 5GT0B 1HTAA 3LJAA 3REID 5B0ZC 5AV8C 3MGQB 3AZGD 1P3PA 5G49A 5AVBA 5AV6D 4QLCB 5B0ZB 4UUZB 5JRGA 5F99A 3FDDA 5B32D 2PYOA 3AZNA 3AZFC 5AY8D 4AWLC 5B40D 5E5AA 4X23A 3RELB 1AOID 1EQZD 3LZ0C 3B0DB 1KX4A 4ZBJC 4UPKA 1P3FC 4ZBJB 2HIOA 3AZGC 3KWQB 1P3FB 5AV6C 3AV2C 5AV5B 3REKA 5B32C 4J8VA 3AV2B 1M19D 4Z66A 2Y2KA 3KXBA 5B40C 2BYMA 3UTBB 3X1UD 1AOIC 5CPJB 3AN2A 5AV9C 3REJA 5AV9B 4KUDB 2ZY5A 3C1BD 4NE5A 3AZHB 4WU8A 5B1MA 1P3KB 4QLCA 3REHD 3UT9D 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 C;  4YS3 C;  4Z5T D;  1P3O A;  4YS3 B;  3W99 D;  3KUY B;  3WAA C;  3X1U C;  3MNN B;  3REL A;  4WU9 B;  1M1A D;  3C1B C;  3W96 B;  5B33 D;  4XZQ B;  3AZJ B;  1F66 C;  2BYK A;  4Z2M G;  5AVC A;  3REH C;  5AV5 A;  1F66 B;  3UT9 C;  3A6N D;  3X1T B;  3KSY A;  4Z5T C;  4ZUX B;  3B0C W;  3W99 C;  4DRB A;  3O62 B;  4J8X D;  1M1A C;  1WWI A;  5CPJ A;  5CPI C;  4KUD A;  5B0Y B;  3UTA C;  5B33 C;  1P3B D;  3AZH A;  1P3M B;  3UTA B;  3B6F B;  4R8P B;  4J8W D;  2CWE A;  3MGP D;  5GSU A;  3A6N C;  4KHA B;  3AZI A;  3LZ1 B;  4J8U A;  4YM6 C;  5B31 A;  1BH8 A;  3KUY A;  4J8X C;  4YM6 B;  3MNN A;  3LJA D;  3AV1 D;  5B1L C;  3W96 A;  5B2J B;  3AZN D;  2PYO D;  5B31 G;  4XZQ A;  3AZJ A;  3MGR D;  4J8W C;  1M18 B;  3MGP C;  2NQB D;  1P3L A;  2HUE B;  3X1S D;  3X1T A;  2ARO C;  4JJN B;  3O62 A;  2ARO B;  1TZY D;  3AZE B;  2F8N D;  3LJA C;  3LEL A;  1KU5 A;  3AV1 C;  5AVB C;  5JRG C;  1P3P B;  5G49 B;  4NE6 A;  5F99 C;  3REK D;  5F99 B;  3AZN C;  5B0Y A;  4Z66 D;  1KX5 D;  2PYO C;  1P3M A;  1P3A D;  3MGR C;  3B6F A;  4KGC B;  5E5A C;  3VH6 W;  5E5A B;  4X23 B;  3AN2 D;  3X1S C;  1KX4 C;  4G92 B;  5B2I B;  1KX4 B;  5GT0 D;  4CAY B;  3W98 B;  3MGQ D;  3X1V B;  2HIO B;  4QLC D;  4LD9 A;  5B0Z D;  3REK C;  1KX3 B;  5B2J A;  5CP6 A;  4Z66 C;  4J8V B;  1P3A C;  3VH5 W;  3KXB B;  2BYM B;  1M18 A;  3REL D;  3AZM B;  3AN2 C;  3REJ C;  2IO5 C;  3REJ B;  5KDM A;  4G91 B;  5BNV A;  5GT0 C;  3KWQ D;  3MGQ C;  1P3F D;  4QLC C;  4WU8 B;  5B1M B;  5AV5 D;  3AV2 D;  3WA9 B;  1P3O B;  4KGC A;  3UTB D;  3REL C;  2LY8 A;  2FJ7 A;  3B0D C;  4XUJ B;  5B2I A;  5AV9 D;  4KUD D;  4CAY A;  3AZH D;  3W98 A;  2RVQ D;  3KWQ C;  3AZK A;  1P3K D;  3X1V A;  5AVC C;  3AFA B;  5AV5 C;  2BYK B;  1KX3 A;  5AVC B;  5GSU D;  1S32 B;  5C3I C;  1P34 A;  4YS3 D;  2CV5 B;  3B6G A;  5C3I B;  3KUY D;  3UTB C;  4WNN A;  3MNN D;  4WU9 D;  3AZM A;  5CPJ C;  3MVD B;  3WAA D;  3TU4 A;  3W97 A;  4WV4 B;  4KUD C;  3W96 D;  3AZH C;  5GXQ B;  4XZQ D;  1B67 A;  2RVQ C;  3AZJ D;  1P3K C;  4M6B A;  5DNN B;  1F66 D;  3V9R A;  5GSU C;  3WA9 A;  3X1T D;  3AZI C;  4ZUX D;  3AZI B;  3O62 D;  3KUY C;  4J8U B;  3MNN C;  5B31 B;  1BH8 B;  4WU9 C;  1U35 A;  1ZLA A;  5BT1 D;  2F8N G;  4XUJ A;  3W96 C;  5CPI D;  5B0Y D;  3B0C T;  4XZQ C;  3AZJ C;  3UTA D;  3B6F D;  5GT3 A;  4R8P D;  3AFA A;  1EQZ B;  1S32 A;  3X1T C;  4ZUX C;  1P3L B;  3LZ1 D;  2CV5 A;  2YFW A;  3O62 C;  3MGS A;  4H9R A;  4YM6 D;  3LEL C;  5BT1 C;  5BS7 A;  3MVD A;  3LEL B;  5DNM B;  5B1L D;  5B2J D;  5B0Y C;  1ID3 B;  1P3M C;  3R45 B;  5GXQ A;  3B6F C;  4R8P C;  5DNN A;  1M18 D;  3LZ1 C;  4JJN D;  1B6W A;  1P3I B;  3REI A;  2ARO D;  4HGA B;  5AV6 A;  3AZE D;  4CSR B;  1P3P D;  5AVB D;  4LD9 B;  5AY8 A;  1BH9 A;  5JRG D;  5B2J C;  5F99 D;  2NZD B;  5CP6 B;  5B32 G;  1M18 C;  4KGC D;  1EQZ A;  1HQ3 B;  5E5A D;  4X23 D;  2HUE C;  4JJN C;  1KX4 D;  3AZE C;  1TAF A;  5KDM B;  3W98 D;  5BNV B;  2HIO D;  5DNM A;  1M19 A;  3VH6 T;  1P3P C;  1KX3 D;  4H9N B;  1ID3 A;  4J8V D;  3R45 A;  4DRA A;  3C1C B;  3X1U A;  3KXB D;  1R4V A;  4KGC C;  3AZM D;  4X23 C;  1P3I A;  4G92 C;  5B2I C;  3VH5 T;  3REJ D;  2FJ7 B;  4CSR A;  3REH A;  3W98 C;  3AZK C;  2YFV B;  3X1V C;  3UT9 A;  2HIO C;  4Z2M H;  4WU8 D;  5B1M D;  3AZK B;  1KX3 C;  2NZD A;  2L5A A;  3WA9 D;  4J8V C;  3KXB C;  1P3O D;  1P34 B;  3B6G B;  3WKJ B;  3AZM C;  4WNN B;  1HQ3 A;  2F8N K;  5B33 A;  4XUJ D;  3TU4 B;  4G91 C;  5CHL B;  5JA4 B;  3W97 B;  1H3O B;  4WU8 C;  5B1M C;  3AFA D;  2NQB B;  5CPK B;  3A6N A;  4H9N A;  5AVC D;  3AZL B;  1S32 D;  3WA9 C;  3V9R B;  1JFI A;  4J8X A;  5FUG A;  3C1C A;  2CV5 D;  1P3O C;  5B24 B;  3WTP B;  1ZLA C;  3MVD D;  1U35 B;  1ZLA B;  4EO5 B;  5CPJ D;  1P3B A;  4XUJ C;  4J8W A;  5GXQ D;  2YFV A;  3MGP A;  5DNN D;  3AFA C;  1P3G B;  5GT3 B;  1S32 C;  3AYW B;  2CV5 C;  1N1J B;  3AZI D;  3MGS C;  3AV1 A;  2YFW B;  4J8U D;  3WKJ A;  5B31 D;  4H9S A;  5AV8 B;  4H9R B;  5BS7 C;  3MGS B;  3MVD C;  3VH6 A;  5JA4 A;  3MGR A;  3AZF B;  1H3O A;  5GXQ C;  4AWL B;  3NQJ A;  5DNN C;  2NQB A;  5CPK A;  3X1S A;  3AZL A;  4H9Q B;  3LZ0 B;  1TZY A;  1P3L D;  2F8N A;  4H9O A;  3REI C;  2JSS A;  5B24 A;  4J8U C;  3WTP A;  3VH5 A;  5B31 C;  3REI B;  3AZG B;  5AV6 B;  3LEL D;  5DNM D;  1Q9C A;  5B32 B;  1KX5 A;  1BFM A;  5AY8 C;  1P3A A;  1ID3 D;  5AY8 B;  4NE3 A;  1BH9 B;  5B40 B;  1ULY A;  1P3M D;  1P3G A;  1EQZ C;  1AOI B;  3AYW A;  1P3L C;  5GT0 A;  1P3I D;  1N1J A;  3MGQ A;  5B0Z A;  5AV8 A;  4UUZ A;  1TAF B;  5DNM C;  4LD9 D;  1M19 B;  2NZD D;  3AZF A;  1ID3 C;  4E45 A;  5CP6 D;  3WAA B;  3X1U B;  3WTP E;  1HQ3 D;  4H9Q A;  5BNX B;  3LZ0 A;  1P3I C;  3C1B B;  3KWQ A;  1P3F A;  4HGA C;  3AZG A;  3REH B;  3AV2 A;  3UT9 B;  4NFT A;  5B32 A;  4LD9 C;  2NZD C;  4Z5T B;  5CP6 C;  5B40 A;  3UTB A;  3C1C D;  3W99 B;  1M1A B;  1AOI A;  1HQ3 C;  1WWS A;  5AV9 A;  5CPI B;  3NQU B;  2FJ7 D;  5B33 B;  1P3K A;  5B2I D;  3AZK D;  3X1V D;  3A6N B;  4YS3 A;  3C1C C;  1JFI B;  4H9P B;  4J8X B;  4WU9 A;  1P34 D;  5FUG B;  3B6G D;  3WAA A;  3WKJ D;  5B1L B;  5BNX A;  2F8N H;  1P3B C;  3TU4 D;  2FJ7 C;  3C1B A;  1P3B B;  3W97 D;  1A7W A;  1F66 A;  4J8W B;  3MGP B;  5CPK D;  5BO0 B;  3AZL D;  4ZUX A;  4Z5T A;  3W99 A;  1P34 C;  5B24 D;  4WZS B;  1M1A A;  3LJA B;  3B6G C;  3WTP D;  3WKJ C;  4H9S C;  3AV1 B;  5AVB B;  1U35 D;  1ZLA D;  5JRG B;  5CPI A;  3TU4 C;  3NQU A;  3AZN B;  3UTA A;  2PYO B;  3W97 C;  4R8P A;  3MGR B;  2NQB C;  3NQJ B;  1P3G D;  5CPK C;  4KHA A;  5GT3 D;  3AZL C;  3LZ1 A;  3X1S B;  3AYW D;  1TZY C;  4YM6 A;  1TZY B;  4H9P A;  5B24 C;  2F8N B;  4H9O B;  3WTP C;  5AV8 D;  3MGS D;  5B1L A;  1U35 C;  4EO5 C;  3REK B;  1KX5 C;  1KX5 B;  4Z66 B;  3AZF D;  3B0B A;  1P3A B;  4E44 A;  1P3G C;  5GT3 C;  5BO0 A;  4JJN A;  3AN2 B;  3AYW C;  3LZ0 D;  2ARO A;  2IO5 B;  3AZE A;  1F1E A;  5GT0 B;  1HTA A;  3LJA A;  3REI D;  5B0Z C;  5AV8 C;  3MGQ B;  3AZG D;  1P3P A;  5G49 A;  5AVB A;  5AV6 D;  4QLC B;  5B0Z B;  4UUZ B;  5JRG A;  5F99 A;  5B32 D;  2PYO A;  3AZN A;  3AZF C;  5AY8 D;  4AWL C;  5B40 D;  5E5A A;  4X23 A;  3REL B;  1AOI D;  1EQZ D;  3LZ0 C;  3B0D B;  1KX4 A;  4ZBJ C;  1P3F C;  4ZBJ B;  2HIO A;  3AZG C;  3KWQ B;  1P3F B;  5AV6 C;  3AV2 C;  5AV5 B;  3REK A;  5B32 C;  4J8V A;  3AV2 B;  1M19 D;  4Z66 A;  3KXB A;  5B40 C;  2BYM A;  3UTB B;  3X1U D;  1AOI C;  5CPJ B;  3AN2 A;  5AV9 C;  3REJ A;  5AV9 B;  4KUD B;  3C1B D;  4NE5 A;  3AZH B;  4WU8 A;  5B1M A;  1P3K B;  4QLC A;  3REH D;  3UT9 D;  5GSU B; 
#chains in the Genus database with same CATH topology
 1M19 C;  3A1K A;  4YS3 C;  4WJ3 C;  4Z5T D;  1P3O A;  3EPJ A;  4YS3 B;  3W99 D;  3KUY B;  3WAA C;  3X1U C;  3MNN B;  3REL A;  4WU9 B;  1M1A D;  3P5J B;  3C1B C;  3W96 B;  5B33 D;  4XZQ B;  3AZJ B;  1F66 C;  2BYK A;  4Z2M G;  5AVC A;  3REH C;  5AV5 A;  1F66 B;  3UT9 C;  3A6N D;  3X1T B;  3KSY A;  4Z5T C;  4ZUX B;  3B0C W;  3W99 C;  4DRB A;  3O62 B;  4J8X D;  1M1A C;  1WWI A;  5CPJ A;  2Y2Q A;  5CPI C;  4KUD A;  5B0Y B;  3UTA C;  5B33 C;  1P3B D;  3AZH A;  1P3M B;  2XD1 A;  3UTA B;  3B6F B;  4R8P B;  4J8W D;  2CWE A;  3MGP D;  5GSU A;  3F6T A;  3A6N C;  4KHA B;  3AZI A;  3LZ1 B;  4J8U A;  4YM6 C;  5B31 A;  1BH8 A;  3KUY A;  4J8X C;  4YM6 B;  3MNN A;  3LJA D;  3AV1 D;  5B1L C;  3W96 A;  5B2J B;  3AZN D;  2PYO D;  5B31 G;  4XZQ A;  3AZJ A;  2ZY4 A;  3MGR D;  4J8W C;  1M18 B;  3MGP C;  2NQB D;  1P3L A;  3AL0 C;  2HUE B;  3X1S D;  3X1T A;  2ARO C;  4JJN B;  3O62 A;  2ARO B;  1TZY D;  3AZE B;  2F8N D;  3LJA C;  3LEL A;  1KU5 A;  3AV1 C;  5AVB C;  5JRG C;  1P3P B;  5G49 B;  4NE6 A;  5F99 C;  3REK D;  5F99 B;  3AZN C;  5B0Y A;  4Z66 D;  1KX5 D;  2PYO C;  1P3M A;  1P3A D;  3MGR C;  3B6F A;  4KGC B;  5E5A C;  3VH6 W;  5E5A B;  4X23 B;  3AN2 D;  3X1S C;  1KX4 C;  4G92 B;  5B2I B;  2Y2N A;  2DQN C;  1KX4 B;  5GT0 D;  4CAY B;  3W98 B;  3MGQ D;  3X1V B;  2HIO B;  4QLC D;  4LD9 A;  5B0Z D;  3REK C;  1KX3 B;  5B2J A;  5CP6 A;  4Z66 C;  4J8V B;  1P3A C;  3VH5 W;  2F2A C;  3KXB B;  2BYM B;  2ZY2 A;  1M18 A;  3REL D;  3AZM B;  3AN2 C;  2XD5 A;  3REJ C;  2G5I C;  2IO5 C;  3REJ B;  5KDM A;  4G91 B;  5BNV A;  5GT0 C;  3KWQ D;  3MGQ C;  1P3F D;  4QLC C;  4WU8 B;  5B1M B;  5AV5 D;  3AV2 D;  3WA9 B;  1P3O B;  4KGC A;  3UTB D;  3REL C;  2LY8 A;  2FJ7 A;  3B0D C;  4XUJ B;  2W8S A;  5B2I A;  5AV9 D;  4KUD D;  4CAY A;  3AZH D;  3W98 A;  2RVQ D;  3KWQ C;  3AZK A;  1P3K D;  3X1V A;  5AVC C;  3AFA B;  5AV5 C;  2BYK B;  1KX3 A;  5AVC B;  5GSU D;  1S32 B;  3EPH A;  5C3I C;  1P34 A;  4YS3 D;  2CV5 B;  3B6G A;  5C3I B;  3KUY D;  3UTB C;  4WNN A;  3MNN D;  2Y2O A;  4WU9 D;  3AZM A;  5CPJ C;  3MVD B;  3WAA D;  3TU4 A;  3W97 A;  4WV4 B;  4KUD C;  3W96 D;  3AZH C;  5GXQ B;  4XZQ D;  1B67 A;  2RVQ C;  3AZJ D;  1P3K C;  4DQY B;  4M6B A;  5DNN B;  1F66 D;  3V9R A;  5GSU C;  3WA9 A;  3X1T D;  3AZI C;  4ZUX D;  3AZI B;  3O62 D;  3KUY C;  4J8U B;  3MNN C;  5B31 B;  1BH8 B;  4WU9 C;  1U35 A;  1ZLA A;  5BT1 D;  2F8N G;  4XUJ A;  3W96 C;  5CPI D;  5B0Y D;  3B0C T;  4XZQ C;  3AZJ C;  3UTA D;  3B6F D;  5GT3 A;  4R8P D;  3AFA A;  1EQZ B;  2BG1 A;  1S32 A;  3X1T C;  2FFF B;  4ZUX C;  1P3L B;  3LZ1 D;  2CV5 A;  2YFW A;  3O62 C;  2Y2L A;  3MGS A;  4H9R A;  4YM6 D;  3LEL C;  5BT1 C;  5BS7 A;  3MVD A;  3LEL B;  5DNM B;  2Y2M A;  5B1L D;  2JE5 A;  5B2J D;  5B0Y C;  1ID3 B;  1P3M C;  3R45 B;  5GXQ A;  3B6F C;  4R8P C;  5DNN A;  1M18 D;  2RIQ A;  3LZ1 C;  2DF4 C;  1B6W A;  4JJN D;  1P3I B;  3REI A;  2ARO D;  4HGA B;  5AV6 A;  3AZE D;  4CSR B;  1P3P D;  5AVB D;  4LD9 B;  5AY8 A;  1BH9 A;  5JRG D;  5B2J C;  5F99 D;  2NZD B;  5CP6 B;  5B32 G;  1M18 C;  4KGC D;  1EQZ A;  1HQ3 B;  5E5A D;  4X23 D;  2HUE C;  4JJN C;  1KX4 D;  3AZE C;  1TAF A;  5KDM B;  3W98 D;  5BNV B;  2HIO D;  5DNM A;  1M19 A;  3VH6 T;  1P3P C;  1KX3 D;  4H9N B;  1ID3 A;  4J8V D;  2Y2G A;  3R45 A;  4DRA A;  3C1C B;  2UWX A;  3X1U A;  3KXB D;  1R4V A;  4KGC C;  3H0R C;  3AZM D;  4X23 C;  1P3I A;  4G92 C;  5B2I C;  3VH5 T;  3REJ D;  2FJ7 B;  4CSR A;  3REH A;  3W98 C;  3AZK C;  2YFV B;  3X1V C;  3UT9 A;  2HIO C;  4Z2M H;  4WU8 D;  5B1M D;  3AZK B;  1KX3 C;  2NZD A;  2L5A A;  3H0L C;  4J8V C;  3WA9 D;  1W2E A;  3KXB C;  1P3O D;  1P34 B;  3B6G B;  3WKJ B;  3AZM C;  4WNN B;  1HQ3 A;  2F8N K;  3IP4 C;  5B33 A;  4XUJ D;  3TU4 B;  2ZM5 A;  4G91 C;  5CHL B;  5JA4 B;  3W97 B;  1H3O B;  4WU8 C;  5B1M C;  3AFA D;  2NQB B;  5CPK B;  3A6N A;  4H9N A;  5AVC D;  3AZL B;  1S32 D;  3WA9 C;  3V9R B;  1JFI A;  4J8X A;  5FUG A;  3C1C A;  2CV5 D;  1P3O C;  5B24 B;  2Y2J A;  3WTP B;  1ZLA C;  3MVD D;  1U35 B;  3H0M C;  4EO5 B;  1ZLA B;  5CPJ D;  1P3B A;  4XUJ C;  4J8W A;  5GXQ D;  2YFV A;  3MGP A;  5DNN D;  3AFA C;  1P3G B;  5GT3 B;  1S32 C;  3AYW B;  2CV5 C;  1N1J B;  3AZI D;  3MGS C;  3AV1 A;  2YFW B;  4J8U D;  3WKJ A;  5B31 D;  4H9S A;  5AV8 B;  4H9R B;  5BS7 C;  3MGS B;  3MVD C;  3VH6 A;  5JA4 A;  3MGR A;  3AZF B;  1H3O A;  5GXQ C;  4AWL B;  3NQJ A;  5DNN C;  2NQB A;  5CPK A;  3EPL A;  3X1S A;  3AZL A;  4H9Q B;  3LZ0 B;  1TZY A;  1P3L D;  3EG5 B;  2F8N A;  4H9O A;  3REI C;  2JSS A;  5B24 A;  4J8U C;  3WTP A;  3VH5 A;  5B31 C;  3REI B;  3AZG B;  5AV6 B;  3LEL D;  5DNM D;  1Q9C A;  5B32 B;  1KX5 A;  1BFM A;  5AY8 C;  1P3A A;  1ID3 D;  5AY8 B;  4NE3 A;  1BH9 B;  1T3U A;  5B40 B;  2VQR A;  1ULY A;  1P3M D;  1P3G A;  1EQZ C;  1AOI B;  3EPK A;  3AYW A;  1P3L C;  5GT0 A;  2ZY3 A;  1P3I D;  1N1J A;  3MGQ A;  5B0Z A;  5AV8 A;  4UUZ A;  1TAF B;  5DNM C;  4LD9 D;  1M19 B;  2NZD D;  3AZF A;  1ID3 C;  3KFU G;  4E45 A;  5CP6 D;  2Y2P A;  3WAA B;  3X1U B;  3WTP E;  1HQ3 D;  4H9Q A;  5BNX B;  3LZ0 A;  1P3I C;  3C1B B;  3KWQ A;  1P3F A;  4HGA C;  3AZG A;  1Z2C B;  3REH B;  3AV2 A;  3UT9 B;  4NFT A;  5B32 A;  4LD9 C;  2NZD C;  4Z5T B;  2J8P A;  5CP6 C;  5B40 A;  3UTB A;  3C1C D;  3W99 B;  1M1A B;  1AOI A;  1HQ3 C;  1WWS A;  5AV9 A;  5CPI B;  3NQU B;  2FJ7 D;  5B33 B;  1P3K A;  5B2I D;  3AZK D;  3X1V D;  3A6N B;  4YS3 A;  3C1C C;  1JFI B;  4H9P B;  4J8X B;  4WU9 A;  1P34 D;  5FUG B;  3B6G D;  3WAA A;  3WKJ D;  5B1L B;  5BNX A;  2JCH A;  2F8N H;  1P3B C;  3TU4 D;  2FJ7 C;  3C1B A;  1P3B B;  3W97 D;  1A7W A;  3A1I A;  1F66 A;  4J8W B;  2Y2H A;  3MGP B;  5CPK D;  5BO0 B;  3AZL D;  4ZUX A;  4Z5T A;  3W99 A;  1P34 C;  5B24 D;  4WZS B;  1M1A A;  3LJA B;  3B6G C;  3WTP D;  3WKJ C;  4H9S C;  3AV1 B;  5AVB B;  1U35 D;  1ZLA D;  5JRG B;  5CPI A;  3TU4 C;  3NQU A;  3AZN B;  3UTA A;  2PYO B;  3W97 C;  4R8P A;  3MGR B;  2G5H C;  2NQB C;  3NQJ B;  1P3G D;  5CPK C;  1PZR A;  4KHA A;  5GT3 D;  3AZL C;  3LZ1 A;  3X1S B;  3AYW D;  1TZY C;  4YM6 A;  1TZY B;  4H9P A;  2Y2I A;  5B24 C;  2F8N B;  4H9O B;  3WTP C;  5AV8 D;  3MGS D;  5B1L A;  1U35 C;  4EO5 C;  3REK B;  1KX5 C;  1KX5 B;  4Z66 B;  3AZF D;  3B0B A;  1P3A B;  4E44 A;  1P3G C;  5GT3 C;  5BO0 A;  4JJN A;  3AN2 B;  3AYW C;  3LZ0 D;  2ARO A;  2IO5 B;  3AZE A;  1F1E A;  5GT0 B;  1HTA A;  3LJA A;  3REI D;  5B0Z C;  5AV8 C;  3MGQ B;  3AZG D;  1P3P A;  5G49 A;  5AVB A;  5AV6 D;  4QLC B;  5B0Z B;  4UUZ B;  5JRG A;  5F99 A;  3FDD A;  5B32 D;  2PYO A;  3AZN A;  3AZF C;  5AY8 D;  4AWL C;  5B40 D;  5E5A A;  4X23 A;  3REL B;  1AOI D;  1EQZ D;  3LZ0 C;  3B0D B;  1KX4 A;  4ZBJ C;  4UPK A;  1P3F C;  4ZBJ B;  2HIO A;  3AZG C;  3KWQ B;  1P3F B;  5AV6 C;  3AV2 C;  5AV5 B;  3REK A;  5B32 C;  4J8V A;  3AV2 B;  1M19 D;  4Z66 A;  2Y2K A;  3KXB A;  5B40 C;  2BYM A;  3UTB B;  3X1U D;  1AOI C;  5CPJ B;  3AN2 A;  5AV9 C;  3REJ A;  5AV9 B;  4KUD B;  2ZY5 A;  3C1B D;  4NE5 A;  3AZH B;  4WU8 A;  5B1M A;  1P3K B;  4QLC A;  3REH D;  3UT9 D;  5GSU B; 
#chains in the Genus database with same CATH homology
 1M19 C;  3A1K A;  4YS3 C;  4WJ3 C;  4Z5T D;  1P3O A;  3EPJ A;  4YS3 B;  3W99 D;  3KUY B;  3WAA C;  3X1U C;  3MNN B;  3REL A;  4WU9 B;  1M1A D;  3P5J B;  3C1B C;  3W96 B;  5B33 D;  4XZQ B;  3AZJ B;  1F66 C;  2BYK A;  4Z2M G;  5AVC A;  3REH C;  5AV5 A;  1F66 B;  3UT9 C;  3A6N D;  3X1T B;  3KSY A;  4Z5T C;  4ZUX B;  3B0C W;  3W99 C;  4DRB A;  3O62 B;  4J8X D;  1M1A C;  1WWI A;  5CPJ A;  2Y2Q A;  5CPI C;  4KUD A;  5B0Y B;  3UTA C;  5B33 C;  1P3B D;  3AZH A;  1P3M B;  2XD1 A;  3UTA B;  3B6F B;  4R8P B;  4J8W D;  2CWE A;  3MGP D;  5GSU A;  3F6T A;  3A6N C;  4KHA B;  3AZI A;  3LZ1 B;  4J8U A;  4YM6 C;  5B31 A;  1BH8 A;  3KUY A;  4J8X C;  4YM6 B;  3MNN A;  3LJA D;  3AV1 D;  5B1L C;  3W96 A;  5B2J B;  3AZN D;  2PYO D;  5B31 G;  4XZQ A;  3AZJ A;  2ZY4 A;  3MGR D;  4J8W C;  1M18 B;  3MGP C;  2NQB D;  1P3L A;  3AL0 C;  2HUE B;  3X1S D;  3X1T A;  2ARO C;  4JJN B;  3O62 A;  2ARO B;  1TZY D;  3AZE B;  2F8N D;  3LJA C;  3LEL A;  1KU5 A;  3AV1 C;  5AVB C;  5JRG C;  1P3P B;  5G49 B;  4NE6 A;  5F99 C;  3REK D;  5F99 B;  3AZN C;  5B0Y A;  4Z66 D;  1KX5 D;  2PYO C;  1P3M A;  1P3A D;  3MGR C;  3B6F A;  4KGC B;  5E5A C;  3VH6 W;  5E5A B;  4X23 B;  3AN2 D;  3X1S C;  1KX4 C;  4G92 B;  5B2I B;  2Y2N A;  2DQN C;  1KX4 B;  5GT0 D;  4CAY B;  3W98 B;  3MGQ D;  3X1V B;  2HIO B;  4QLC D;  4LD9 A;  5B0Z D;  3REK C;  1KX3 B;  5B2J A;  5CP6 A;  4Z66 C;  4J8V B;  1P3A C;  3VH5 W;  2F2A C;  3KXB B;  2BYM B;  2ZY2 A;  1M18 A;  3REL D;  3AZM B;  3AN2 C;  2XD5 A;  3REJ C;  2G5I C;  2IO5 C;  3REJ B;  5KDM A;  4G91 B;  5BNV A;  5GT0 C;  3KWQ D;  3MGQ C;  1P3F D;  4QLC C;  4WU8 B;  5B1M B;  5AV5 D;  3AV2 D;  3WA9 B;  1P3O B;  4KGC A;  3UTB D;  3REL C;  2LY8 A;  2FJ7 A;  3B0D C;  4XUJ B;  2W8S A;  5B2I A;  5AV9 D;  4KUD D;  4CAY A;  3AZH D;  3W98 A;  2RVQ D;  3KWQ C;  3AZK A;  1P3K D;  3X1V A;  5AVC C;  3AFA B;  5AV5 C;  2BYK B;  1KX3 A;  5AVC B;  5GSU D;  1S32 B;  3EPH A;  5C3I C;  1P34 A;  4YS3 D;  2CV5 B;  3B6G A;  5C3I B;  3KUY D;  3UTB C;  4WNN A;  3MNN D;  2Y2O A;  4WU9 D;  3AZM A;  5CPJ C;  3MVD B;  3WAA D;  3TU4 A;  3W97 A;  4WV4 B;  4KUD C;  3W96 D;  3AZH C;  5GXQ B;  4XZQ D;  1B67 A;  2RVQ C;  3AZJ D;  1P3K C;  4DQY B;  4M6B A;  5DNN B;  1F66 D;  3V9R A;  5GSU C;  3WA9 A;  3X1T D;  3AZI C;  4ZUX D;  3AZI B;  3O62 D;  3KUY C;  4J8U B;  3MNN C;  5B31 B;  1BH8 B;  4WU9 C;  1U35 A;  1ZLA A;  5BT1 D;  2F8N G;  4XUJ A;  3W96 C;  5CPI D;  5B0Y D;  3B0C T;  4XZQ C;  3AZJ C;  3UTA D;  3B6F D;  5GT3 A;  4R8P D;  3AFA A;  1EQZ B;  2BG1 A;  1S32 A;  3X1T C;  2FFF B;  4ZUX C;  1P3L B;  3LZ1 D;  2CV5 A;  2YFW A;  3O62 C;  2Y2L A;  3MGS A;  4H9R A;  4YM6 D;  3LEL C;  5BT1 C;  5BS7 A;  3MVD A;  3LEL B;  5DNM B;  2Y2M A;  5B1L D;  2JE5 A;  5B2J D;  5B0Y C;  1ID3 B;  1P3M C;  3R45 B;  5GXQ A;  3B6F C;  4R8P C;  5DNN A;  1M18 D;  2RIQ A;  3LZ1 C;  2DF4 C;  1B6W A;  4JJN D;  1P3I B;  3REI A;  2ARO D;  4HGA B;  5AV6 A;  3AZE D;  4CSR B;  1P3P D;  5AVB D;  4LD9 B;  5AY8 A;  1BH9 A;  5JRG D;  5B2J C;  5F99 D;  2NZD B;  5CP6 B;  5B32 G;  1M18 C;  4KGC D;  1EQZ A;  1HQ3 B;  5E5A D;  4X23 D;  2HUE C;  4JJN C;  1KX4 D;  3AZE C;  1TAF A;  5KDM B;  3W98 D;  5BNV B;  2HIO D;  5DNM A;  1M19 A;  3VH6 T;  1P3P C;  1KX3 D;  4H9N B;  1ID3 A;  4J8V D;  2Y2G A;  3R45 A;  4DRA A;  3C1C B;  2UWX A;  3X1U A;  3KXB D;  1R4V A;  4KGC C;  3H0R C;  3AZM D;  4X23 C;  1P3I A;  4G92 C;  5B2I C;  3VH5 T;  3REJ D;  2FJ7 B;  4CSR A;  3REH A;  3W98 C;  3AZK C;  2YFV B;  3X1V C;  3UT9 A;  2HIO C;  4Z2M H;  4WU8 D;  5B1M D;  3AZK B;  1KX3 C;  2NZD A;  2L5A A;  3H0L C;  4J8V C;  3WA9 D;  1W2E A;  3KXB C;  1P3O D;  1P34 B;  3B6G B;  3WKJ B;  3AZM C;  4WNN B;  1HQ3 A;  2F8N K;  3IP4 C;  5B33 A;  4XUJ D;  3TU4 B;  2ZM5 A;  4G91 C;  5CHL B;  5JA4 B;  3W97 B;  1H3O B;  4WU8 C;  5B1M C;  3AFA D;  2NQB B;  5CPK B;  3A6N A;  4H9N A;  5AVC D;  3AZL B;  1S32 D;  3WA9 C;  3V9R B;  1JFI A;  4J8X A;  5FUG A;  3C1C A;  2CV5 D;  1P3O C;  5B24 B;  2Y2J A;  3WTP B;  1ZLA C;  3MVD D;  1U35 B;  3H0M C;  4EO5 B;  1ZLA B;  5CPJ D;  1P3B A;  4XUJ C;  4J8W A;  5GXQ D;  2YFV A;  3MGP A;  5DNN D;  3AFA C;  1P3G B;  5GT3 B;  1S32 C;  3AYW B;  2CV5 C;  1N1J B;  3AZI D;  3MGS C;  3AV1 A;  2YFW B;  4J8U D;  3WKJ A;  5B31 D;  4H9S A;  5AV8 B;  4H9R B;  5BS7 C;  3MGS B;  3MVD C;  3VH6 A;  5JA4 A;  3MGR A;  3AZF B;  1H3O A;  5GXQ C;  4AWL B;  3NQJ A;  5DNN C;  2NQB A;  5CPK A;  3EPL A;  3X1S A;  3AZL A;  4H9Q B;  3LZ0 B;  1TZY A;  1P3L D;  3EG5 B;  2F8N A;  4H9O A;  3REI C;  2JSS A;  5B24 A;  4J8U C;  3WTP A;  3VH5 A;  5B31 C;  3REI B;  3AZG B;  5AV6 B;  3LEL D;  5DNM D;  1Q9C A;  5B32 B;  1KX5 A;  1BFM A;  5AY8 C;  1P3A A;  1ID3 D;  5AY8 B;  4NE3 A;  1BH9 B;  1T3U A;  5B40 B;  2VQR A;  1ULY A;  1P3M D;  1P3G A;  1EQZ C;  1AOI B;  3EPK A;  3AYW A;  1P3L C;  5GT0 A;  2ZY3 A;  1P3I D;  1N1J A;  3MGQ A;  5B0Z A;  5AV8 A;  4UUZ A;  1TAF B;  5DNM C;  4LD9 D;  1M19 B;  2NZD D;  3AZF A;  1ID3 C;  3KFU G;  4E45 A;  5CP6 D;  2Y2P A;  3WAA B;  3X1U B;  3WTP E;  1HQ3 D;  4H9Q A;  5BNX B;  3LZ0 A;  1P3I C;  3C1B B;  3KWQ A;  1P3F A;  4HGA C;  3AZG A;  1Z2C B;  3REH B;  3AV2 A;  3UT9 B;  4NFT A;  5B32 A;  4LD9 C;  2NZD C;  4Z5T B;  2J8P A;  5CP6 C;  5B40 A;  3UTB A;  3C1C D;  3W99 B;  1M1A B;  1AOI A;  1HQ3 C;  1WWS A;  5AV9 A;  5CPI B;  3NQU B;  2FJ7 D;  5B33 B;  1P3K A;  5B2I D;  3AZK D;  3X1V D;  3A6N B;  4YS3 A;  3C1C C;  1JFI B;  4H9P B;  4J8X B;  4WU9 A;  1P34 D;  5FUG B;  3B6G D;  3WAA A;  3WKJ D;  5B1L B;  5BNX A;  2JCH A;  2F8N H;  1P3B C;  3TU4 D;  2FJ7 C;  3C1B A;  1P3B B;  3W97 D;  1A7W A;  3A1I A;  1F66 A;  4J8W B;  2Y2H A;  3MGP B;  5CPK D;  5BO0 B;  3AZL D;  4ZUX A;  4Z5T A;  3W99 A;  1P34 C;  5B24 D;  4WZS B;  1M1A A;  3LJA B;  3B6G C;  3WTP D;  3WKJ C;  4H9S C;  3AV1 B;  5AVB B;  1U35 D;  1ZLA D;  5JRG B;  5CPI A;  3TU4 C;  3NQU A;  3AZN B;  3UTA A;  2PYO B;  3W97 C;  4R8P A;  3MGR B;  2G5H C;  2NQB C;  3NQJ B;  1P3G D;  5CPK C;  1PZR A;  4KHA A;  5GT3 D;  3AZL C;  3LZ1 A;  3X1S B;  3AYW D;  1TZY C;  4YM6 A;  1TZY B;  4H9P A;  2Y2I A;  5B24 C;  2F8N B;  4H9O B;  3WTP C;  5AV8 D;  3MGS D;  5B1L A;  1U35 C;  4EO5 C;  3REK B;  1KX5 C;  1KX5 B;  4Z66 B;  3AZF D;  3B0B A;  1P3A B;  4E44 A;  1P3G C;  5GT3 C;  5BO0 A;  4JJN A;  3AN2 B;  3AYW C;  3LZ0 D;  2ARO A;  2IO5 B;  3AZE A;  1F1E A;  5GT0 B;  1HTA A;  3LJA A;  3REI D;  5B0Z C;  5AV8 C;  3MGQ B;  3AZG D;  1P3P A;  5G49 A;  5AVB A;  5AV6 D;  4QLC B;  5B0Z B;  4UUZ B;  5JRG A;  5F99 A;  3FDD A;  5B32 D;  2PYO A;  3AZN A;  3AZF C;  5AY8 D;  4AWL C;  5B40 D;  5E5A A;  4X23 A;  3REL B;  1AOI D;  1EQZ D;  3LZ0 C;  3B0D B;  1KX4 A;  4ZBJ C;  4UPK A;  1P3F C;  4ZBJ B;  2HIO A;  3AZG C;  3KWQ B;  1P3F B;  5AV6 C;  3AV2 C;  5AV5 B;  3REK A;  5B32 C;  4J8V A;  3AV2 B;  1M19 D;  4Z66 A;  2Y2K A;  3KXB A;  5B40 C;  2BYM A;  3UTB B;  3X1U D;  1AOI C;  5CPJ B;  3AN2 A;  5AV9 C;  3REJ A;  5AV9 B;  4KUD B;  2ZY5 A;  3C1B D;  4NE5 A;  3AZH B;  4WU8 A;  5B1M A;  1P3K B;  4QLC A;  3REH D;  3UT9 D;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...