2NQBD

Drosophila nucleosome structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
RKRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbD00
3VH5W 3KXBC 1JFIA 3LZ1D 4WU9D 5B40D 1P3MD 4ZUXD 5B2JB 3WTPD 5AY8D 1TAFA 1P3GA 5B0YC 5B33A 4WU8A 3REJC 2HIOD 5CPIA 4ZBJC 1KX3D 3X1UD 1P3PA 5B0YB 3REIC 4YM6C 3AZNA 3RELA 4ZBJB 4XZQA 5B31D 3AZFC 1P3AA 2BYMA 3MGRC 4X23C 3REIB 4YM6B 4LD9B 3AZFB 3MGRB 4J8VA 5GT0B 5JA4A 3REKD 5AVBD 2NZDD 1F66A 5GXQA 2L5AA 1HQ3D 1HTAA 1P3ID 3WKJA 4XUJA 4G92C 5DNNB 2IO5C 1P3LC 3VH6T 3WAAC 4YS3A 3AZMD 1N1JB 3KSYA 4H9QB 5E5AA 4QLCA 5FUGB 3W99A 3AZEA 4J8XD 4DRBA 1AOIA 2IO5B 1P3LB 3WAAB 5DNMD 2HUEC 2FJ7D 3UT9A 5JRGC 2AROA 4KGCD 3AZGC 2NQBC 1U35C 3A6NA 5B2IC 3KUYA 3AZGB 5GT3A 3AZKD 3B6FD 4J8WD 4KUDA 2NQBB 5AV5A 2YFWA 1U35B 5B2IB 1P3KD 3W97D 5BS7C 1JFIB 3C1CD 3AYWA 1P3GC 3KWQA 5F99C 5B33C 1BH9B 5B24A 5B1MC 3TU4D 3AZHC 3AN2D 3X1TA 1TAFB 1S32D 1P3GB 5B33B 4WU8B 3AZID 3RELC 4XZQC 1P3AC 4H9NA 4J8UA 3AFAC 3AZHB 4JJNA 5AV9C 1KX5A 3X1SD 3X1VD 2PYOA 3RELB 4XZQB 1P3AB 2BYMB 1EQZD 3LJAD 3AFAB 5B0ZC 5AV6A 4H9PB 4Z5TC 5AV9B 3MNNA 3REHC 5GXQC 3AV2A 3KXBA 1KU5A 4J8VB 5AV8C 3W96D 5B0ZB 5JA4B 4R8PD 5B32D 1P34D 5GXQB 1ID3D 4WNNB 3W99C 5CPJC 3WKJB 1P3BC 3REJA 3UTAC 3LZ0D 4KHAA 3WA9C 2RVQD 2F8NK 4NE6A 5CPJB 3W99B 4QLCB 3REIA 4YM6A 3W98C 3UTAB 3AZLC 1AOIB 3AZFA 3WA9B 3MGRA 5AVCD 3KUYC 1KX4C 1ZLAD 4X23A 3UTBA 4NFTA 3W98B 1P3OD 3VH6W 3AZLB 2YFVB 3KUYB 4NE3A 1ULYA 5GT3B 3C1BA 4KUDB 2YFWB 4H9QA 3MGSD 4WU9C 5B40C 1P3MC 4ZUXC 3X1TC 3WTPC 3KWQB 1P3LA 3WAAA 5BO0A 5B24B 4WU9B 2HIOC 5B40B 3X1TB 1KX5C 1KX3C 3X1UC 3AZJD 3MVDA 2CV5A 5JRGA 4H9NB 4H9OA 3MGPD 3AZGA 2NQBA 5AV6C 1M1AA 5B31C 4Z66D 3X1UB 1U35A 1KX5B 1TZYD 2PYOB 5B2IA 5GSUD 3AV2C 5AV6B 4H9SC 3MNNB 1BH9A 3AV2B 3KXBB 3REKC 5BS7A 1M18D 5F99A 1HQ3C 2F8NA 5B1MA 3B6GD 3REKB 3AZHA 4HGAC 5CP6D 3REJB 1HQ3B 3AZMC 4KHAB 3AFAA 3UTBC 5AV9A 4H9PA 1P3FD 5DNMC 3AZMB 4AWLC 4KGCC 1M19D 5B0ZA 4X23B 3UTBB 3REHA 4Z5TA 5DNMB 3LELD 3C1BC 4AWLB 3NQJB 5B1LD 4WNNA 5AV8A 3AZKC 3B6FC 3C1BB 3W97C 3C1CC 5CPJA 4G92B 1P3BA 3MGQD 3B6FB 3UTAA 5B2JD 3TU4C 3W97B 3MVDC 3WA9A 2CV5C 5BO0B 3AN2C 3WTPE 1S32C 3AZIC 3W98A 1M1AC 3AZLA 2YFVA 3MVDB 2CV5B 2HUEB 4WV4B 1KX4A 5JRGB 5B0YD 3X1SC 4H9OB 3X1VC 1M1AB 3LJAC 3B0BA 3X1SB 4LD9D 4CSRB 5GT0D 3LZ1A 4R8PC 5B32C 3O62D 4WU9A 5B40A 1P34C 4ZUXA 1P3MA 2CWEA 2F8NG 3WTPA 5F99B 1ID3C 5B32G 5AY8A 2F8NB 5B1MB 5DNND 5B32B 1P34B 2HIOA 3LZ0C 3VH5A 1KX3A 3X1UA 2BYKB 5BNXA 5B31A 5AVCC 1ZLAC 4Z2MG 4E45A 1P3OC 3REHB 4H9SA 4Z5TB 3V9RB 4EO5C 2F8NH 3REKA 5AVBA 5CPKD 3AV1D 2NZDA 5AV8B 1HQ3A 1P3IA 3MGSC 1P3BB 3AZMA 5KDMA 4J8XA 1P3GD 5B33D 4WU8D 4Z2MH 3AZJC 5CPID 5DNMA 2FJ7A 3NQJA 4KGCA 1P3PD 1KX4B 4M6BA 4Z66C 3AZJB 3AZND 1TZYC 3RELD 4XZQD 1P3AD 4H9RA 3LZ1C 1R4VA 3AZKA 1H3OB 3B6FA 4J8WA 2LY8A 1P3KA 3W97A 5AY8C 3C1CA 4J8VD 1M18C 3R45B 3LZ1B 4G91C 1P3MB 4ZUXB 1F66D 5GXQD 3WTPB 3TU4A 3B6GC 5AY8B 4XUJD 3AN2A 1M18B 1S32A 5CP6C 3WKJD 3AZIA 4G91B 2HIOB 1KX3B 5BT1D 4YS3D 3B6GB 3W99D 5E5AD 4QLCD 3AZED 5CP6B 3X1SA 5B31G 3X1VA 1P3FC 5BNXB 1AOID 5B31B 1EQZA 4CSRA 3LJAA 3UT9D 2AROD 4CAYB 5AVBC 2NZDC 1P3FB 3LELC 3A6ND 5B1LC 3B0DC 1P3IC 3W96A 4R8PA 5B32A 1P34A 5G49B 5AVBB 4NE5A 2NZDB 5GT3D 3LELB 4KUDD 5AV5D 2BYKA 1ID3A 1F1EA 3B0DB 1P3IB 3MGQC 4J8XC 3AYWD 5B2JC 3LZ0A 3KWQD 4HGAB 2FJ7C 5B24D 3MGQB 3NQUB 5KDMB 3X1TD 4J8XB 3V9RA 5AVCA 2FJ7B 1ZLAA 4J8UD 4KGCB 4JJND 1A7WA 4J8WC 1P3OA 1KX5D 4WZSB 2PYOD 1P3KC 4H9RB 3B0CT 4LD9C 3AZKB 5AV6D 4J8WB 3MNND 5GT0C 3AV2D 1P3KB 3O62C 3KXBD 3MGSA 3C1CB 3VH6A 4UUZA 3TU4B 5DNNC 3O62B 3AN2B 1S32B 3AZIB 3REJD 3AZJA 1EQZC 3MGPA 1Q9CA 1H3OA 4Z66A 4YM6D 3REID 3X1VB 1TZYA 5GSUA 3AZFD 3MGRD 1EQZB 3R45A 1WWSA 3W96C 3LJAB 4X23D 3UTBD 5BNVB 5CPKC 3AV1C 1M18A 3W96B 4R8PB 3C1BD 2RVQC 1ID3B 3B6GA 1B6WA 5CPKB 3AV1B 5CP6A 3LZ0B 1P3LD 3WAAD 4WU8C 4CAYA 5CPIC 2JSSA 1P3FA 1BH8A 3VH5T 3MVDD 2CV5D 5AVCB 1M19A 1P3PC 1ZLAB 5JRGD 5G49A 3AZGD 3AZNC 5CPIB 2NQBD 3LELA 1P3OB 1M1AD 1U35D 5B1LA 5B2ID 1P3PB 4EO5B 3AZNB 4J8VC 3MGSB 3MGQA 3NQUA 1BFMA 1F66C 5B2JA 5F99D 3WKJC 4XUJC 2F8ND 4UUZB 3B0CW 5B1MD 3MGPC 3AZHD 1F66B 5CHLB 5BT1C 4YS3C 1B67A 5GSUC 5E5AC 4QLCC 4XUJB 3AZEC 5B0YA 3AFAD 3MGPB 1AOIC 5AV9D 4Z66B 4YS3B 1TZYB 5C3IC 3UT9C 5GSUB 5E5AB 2AROC 3AZEB 5B0ZD 4LD9A 3A6NC 3REHD 4Z5TD 5GT0A 5C3IB 3UT9B 4E44A 2AROB 3O62A 5GT3C 5AV8D 4KUDC 5AV5C 3A6NB 5DNNA 3AYWC 5CPJD 3KWQC 1P3BD 1WWIA 5AV5B 3UTAD 1N1JA 5B24C 5FUGA 3WA9D 1M19C 3AYWB 3W98D 3AZLD 1BH8B 5BNVA 4J8UC 1M19B 3KUYD 4JJNC 1KX4D 4DRAA 2PYOC 4J8UB 5B1LB 5CPKA 3AV1A 4JJNB 3MNNC
chains in the Genus database with same CATH superfamily
3VH5W 3KXBC 3FDDA 1JFIA 3LZ1D 4WU9D 5B40D 1P3MD 4ZUXD 3H0LC 5B2JB 3WTPD 2ZM5A 5AY8D 1TAFA 3A1KA 1P3GA 5B0YC 5B33A 4WU8A 3REJC 2HIOD 5CPIA 4ZBJC 1KX3D 2Y2OA 3X1UD 1P3PA 5B0YB 3REIC 4YM6C 3AZNA 3RELA 4ZBJB 4XZQA 5B31D 3AZFC 1P3AA 2BYMA 3MGRC 2Y2JA 4X23C 2ZY2A 3REIB 4YM6B 4LD9B 3AZFB 3MGRB 4J8VA 5GT0B 5JA4A 3REKD 5AVBD 2NZDD 1F66A 5GXQA 2L5AA 1HQ3D 1HTAA 1P3ID 3WKJA 4XUJA 4G92C 5DNNB 2IO5C 1P3LC 3VH6T 3WAAC 4YS3A 3AZMD 1N1JB 3KSYA 4H9QB 5E5AA 4QLCA 2Y2LA 5FUGB 3AZEA 3W99A 4J8XD 4DRBA 1AOIA 2IO5B 1P3LB 3WAAB 5DNMD 2HUEC 2FJ7D 3UT9A 5JRGC 2AROA 4KGCD 3AZGC 2NQBC 1U35C 3A6NA 5B2IC 3KUYA 2ZY5A 3AZGB 5GT3A 3AZKD 3B6FD 4J8WD 4KUDA 2NQBB 5AV5A 2YFWA 1U35B 5B2IB 1P3KD 3W97D 5BS7C 2VQRA 3C1CD 3AYWA 1JFIB 1P3GC 3KWQA 5F99C 5B33C 1BH9B 5B24A 5B1MC 3TU4D 3AZHC 3AN2D 3X1TA 1TAFB 1S32D 1P3GB 5B33B 4WU8B 3AZID 3RELC 4XZQC 1P3AC 4H9NA 4J8UA 3AFAC 3AZHB 4JJNA 5AV9C 1KX5A 3X1SD 3X1VD 2PYOA 3RELB 2JE5A 4XZQB 1P3AB 2BYMB 1EQZD 3LJAD 3AFAB 5B0ZC 5AV6A 4H9PB 4Z5TC 5AV9B 3MNNA 3REHC 5GXQC 3AV2A 3KXBA 1KU5A 4J8VB 5AV8C 3W96D 5B0ZB 5JA4B 4R8PD 5B32D 1P34D 5GXQB 1ID3D 4UPKA 4WNNB 3W99C 5CPJC 3WKJB 1P3BC 3REJA 3UTAC 3LZ0D 4KHAA 3WA9C 2RVQD 2F8NK 4NE6A 5CPJB 3W99B 4QLCB 3REIA 4YM6A 3W98C 3UTAB 3AZLC 1AOIB 3AZFA 3WA9B 3MGRA 5AVCD 3KUYC 1KX4C 1ZLAD 4X23A 3UTBA 4NFTA 3W98B 1P3OD 3VH6W 3AZLB 2YFVB 3A1IA 3KUYB 4NE3A 1ULYA 3IP4C 5GT3B 3C1BA 4KUDB 2YFWB 4H9QA 3MGSD 4WU9C 5B40C 1P3MC 4ZUXC 3X1TC 3WTPC 3KWQB 1P3LA 3WAAA 5BO0A 5B24B 4WU9B 2HIOC 5B40B 3X1TB 1KX5C 1KX3C 3X1UC 3AZJD 3MVDA 2CV5A 5JRGA 4H9NB 4H9OA 3MGPD 3AZGA 2NQBA 5AV6C 1M1AA 5B31C 4Z66D 3X1UB 1U35A 1KX5B 1TZYD 2PYOB 5B2IA 5GSUD 3AV2C 5AV6B 4H9SC 3MNNB 1BH9A 3AV2B 3KXBB 3REKC 5BS7A 1M18D 5F99A 1HQ3C 2Y2PA 2F8NA 5B1MA 3B6GD 3REKB 3AZHA 4HGAC 5CP6D 3REJB 1HQ3B 3AZMC 4KHAB 3AFAA 3UTBC 5AV9A 4H9PA 1P3FD 5DNMC 3AZMB 4AWLC 4KGCC 1M19D 5B0ZA 4X23B 2BG1A 3UTBB 3REHA 4Z5TA 5DNMB 3LELD 3C1BC 4AWLB 3NQJB 5B1LD 4WNNA 5AV8A 3AZKC 3B6FC 3C1BB 3W97C 3C1CC 5CPJA 3EG5B 4G92B 1P3BA 3MGQD 3B6FB 3UTAA 5B2JD 3TU4C 3W97B 3MVDC 3WA9A 2CV5C 5BO0B 3AN2C 3WTPE 1S32C 3AZIC 3W98A 1M1AC 3AZLA 2YFVA 3MVDB 2CV5B 2HUEB 4WV4B 1KX4A 5JRGB 5B0YD 3X1SC 4H9OB 3X1VC 1M1AB 3LJAC 2ZY4A 3B0BA 3X1SB 4LD9D 2Y2HA 2Y2GA 2FFFB 4CSRB 5GT0D 3LZ1A 4R8PC 5B32C 3O62D 4WU9A 5B40A 1T3UA 4ZUXA 1P34C 1P3MA 2CWEA 2F8NG 3WTPA 5F99B 1ID3C 5B32G 5AY8A 2F8NB 5B1MB 5DNND 5B32B 1P34B 2HIOA 3LZ0C 3VH5A 3H0RC 1KX3A 3X1UA 1PZRA 2BYKB 5BNXA 5B31A 5AVCC 1ZLAC 4Z2MG 4E45A 3EPLA 1P3OC 3H0MC 3REHB 4H9SA 4Z5TB 3V9RB 4EO5C 2F8NH 3REKA 5AVBA 5CPKD 3AV1D 2NZDA 5AV8B 1HQ3A 1P3IA 3MGSC 2XD5A 1P3BB 3AZMA 5KDMA 4J8XA 1P3GD 5B33D 4WU8D 4Z2MH 3AZJC 5CPID 5DNMA 2FJ7A 3NQJA 4KGCA 1P3PD 1KX4B 4M6BA 4Z66C 3AZJB 3AZND 4WJ3C 1TZYC 3RELD 4XZQD 1P3AD 4H9RA 3LZ1C 1R4VA 3AZKA 1H3OB 3B6FA 4J8WA 2LY8A 1P3KA 3W97A 5AY8C 3C1CA 4J8VD 1M18C 3R45B 3LZ1B 4G91C 1P3MB 4ZUXB 1F66D 5GXQD 3WTPB 3TU4A 3B6GC 5AY8B 4XUJD 3AN2A 1M18B 1S32A 5CP6C 3WKJD 3AZIA 4G91B 2HIOB 1KX3B 5BT1D 4YS3D 3B6GB 3W99D 5E5AD 4QLCD 3AZED 5CP6B 3X1SA 5B31G 3X1VA 1P3FC 5BNXB 1AOID 5B31B 1EQZA 4CSRA 3LJAA 3UT9D 2AROD 4CAYB 5AVBC 2NZDC 1P3FB 3LELC 3A6ND 5B1LC 3B0DC 1P3IC 3W96A 4R8PA 5B32A 1P34A 5G49B 5AVBB 2Y2KA 4NE5A 2NZDB 5GT3D 3LELB 4KUDD 2UWXA 5AV5D 2BYKA 1ID3A 1F1EA 3B0DB 1P3IB 3MGQC 4J8XC 3AYWD 5B2JC 3LZ0A 3KWQD 4HGAB 2DQNC 2FJ7C 2G5IC 5B24D 3EPJA 3MGQB 3NQUB 5KDMB 3X1TD 4J8XB 3V9RA 5AVCA 2FJ7B 1ZLAA 2Y2IA 2XD1A 4J8UD 4KGCB 4JJND 1A7WA 4J8WC 1P3OA 1KX5D 4WZSB 2DF4C 3EPKA 2PYOD 1P3KC 4H9RB 3B0CT 4LD9C 3AZKB 5AV6D 4J8WB 3MNND 5GT0C 3AV2D 1P3KB 3O62C 3KXBD 3MGSA 4DQYB 3C1CB 3VH6A 4UUZA 3TU4B 5DNNC 3O62B 3AN2B 1S32B 3AZIB 3REJD 3AZJA 2Y2MA 2JCHA 1EQZC 3MGPA 1Q9CA 3KFUG 1H3OA 4Z66A 4YM6D 3REID 3X1VB 1TZYA 5GSUA 2J8PA 3AZFD 3MGRD 1EQZB 3R45A 1WWSA 3W96C 3LJAB 4X23D 3UTBD 2ZY3A 5BNVB 5CPKC 3AV1C 1M18A 3W96B 4R8PB 2G5HC 3C1BD 2RVQC 1ID3B 3B6GA 1B6WA 5CPKB 3AL0C 3AV1B 5CP6A 3LZ0B 1P3LD 3WAAD 4WU8C 4CAYA 5CPIC 2JSSA 1P3FA 1BH8A 3VH5T 3MVDD 2CV5D 5AVCB 1M19A 1P3PC 1ZLAB 5JRGD 5G49A 3AZGD 3AZNC 5CPIB 2NQBD 3LELA 1P3OB 1M1AD 1U35D 5B1LA 5B2ID 1P3PB 4EO5B 3AZNB 2W8SA 4J8VC 1W2EA 2Y2QA 3MGSB 3MGQA 3NQUA 1BFMA 1F66C 5B2JA 5F99D 3WKJC 4XUJC 2F8ND 4UUZB 3B0CW 5B1MD 3MGPC 3AZHD 1F66B 5CHLB 5BT1C 4YS3C 3F6TA 1B67A 5GSUC 5E5AC 4QLCC 4XUJB 3AZEC 5B0YA 3AFAD 3MGPB 1AOIC 5AV9D 4Z66B 3P5JB 4YS3B 3EPHA 2RIQA 1TZYB 5C3IC 3UT9C 5GSUB 2Y2NA 2AROC 5E5AB 3AZEB 5B0ZD 4LD9A 3A6NC 3REHD 4Z5TD 2F2AC 5GT0A 5C3IB 3UT9B 4E44A 2AROB 3O62A 5GT3C 5AV8D 4KUDC 5AV5C 3A6NB 5DNNA 3AYWC 5CPJD 3KWQC 1P3BD 1WWIA 5AV5B 3UTAD 1N1JA 5B24C 5FUGA 3WA9D 1M19C 3AYWB 1Z2CB 3W98D 3AZLD 1BH8B 5BNVA 4J8UC 1M19B 3KUYD 4JJNC 1KX4D 4DRAA 2PYOC 4J8UB 5B1LB 5CPKA 3AV1A 4JJNB 3MNNC
chains in the Genus database with same CATH topology
3VH5W 3KXBC 3FDDA 1JFIA 3LZ1D 4WU9D 5B40D 1P3MD 4ZUXD 3H0LC 5B2JB 3WTPD 2ZM5A 5AY8D 1TAFA 3A1KA 1P3GA 5B0YC 5B33A 4WU8A 3REJC 2HIOD 5CPIA 4ZBJC 1KX3D 2Y2OA 3X1UD 1P3PA 5B0YB 3REIC 4YM6C 3AZNA 3RELA 4ZBJB 4XZQA 5B31D 3AZFC 1P3AA 2BYMA 3MGRC 2Y2JA 4X23C 2ZY2A 3REIB 4YM6B 4LD9B 3AZFB 3MGRB 4J8VA 5GT0B 5JA4A 3REKD 5AVBD 2NZDD 1F66A 5GXQA 2L5AA 1HQ3D 1HTAA 1P3ID 3WKJA 4XUJA 4G92C 5DNNB 2IO5C 1P3LC 3VH6T 3WAAC 4YS3A 3AZMD 1N1JB 3KSYA 4H9QB 5E5AA 4QLCA 2Y2LA 5FUGB 3AZEA 3W99A 4J8XD 4DRBA 1AOIA 2IO5B 1P3LB 3WAAB 5DNMD 2HUEC 2FJ7D 3UT9A 5JRGC 2AROA 4KGCD 3AZGC 2NQBC 1U35C 3A6NA 5B2IC 3KUYA 2ZY5A 3AZGB 5GT3A 3AZKD 3B6FD 4J8WD 4KUDA 2NQBB 5AV5A 2YFWA 1U35B 5B2IB 1P3KD 3W97D 5BS7C 2VQRA 3C1CD 3AYWA 1JFIB 1P3GC 3KWQA 5F99C 5B33C 1BH9B 5B24A 5B1MC 3TU4D 3AZHC 3AN2D 3X1TA 1TAFB 1S32D 1P3GB 5B33B 4WU8B 3AZID 3RELC 4XZQC 1P3AC 4H9NA 4J8UA 3AFAC 3AZHB 4JJNA 5AV9C 1KX5A 3X1SD 3X1VD 2PYOA 3RELB 2JE5A 4XZQB 1P3AB 2BYMB 1EQZD 3LJAD 3AFAB 5B0ZC 5AV6A 4H9PB 4Z5TC 5AV9B 3MNNA 3REHC 5GXQC 3AV2A 3KXBA 1KU5A 4J8VB 5AV8C 3W96D 5B0ZB 5JA4B 4R8PD 5B32D 1P34D 5GXQB 1ID3D 4UPKA 4WNNB 3W99C 5CPJC 3WKJB 1P3BC 3REJA 3UTAC 3LZ0D 4KHAA 3WA9C 2RVQD 2F8NK 4NE6A 5CPJB 3W99B 4QLCB 3REIA 4YM6A 3W98C 3UTAB 3AZLC 1AOIB 3AZFA 3WA9B 3MGRA 5AVCD 3KUYC 1KX4C 1ZLAD 4X23A 3UTBA 4NFTA 3W98B 1P3OD 3VH6W 3AZLB 2YFVB 3A1IA 3KUYB 4NE3A 1ULYA 3IP4C 5GT3B 3C1BA 4KUDB 2YFWB 4H9QA 3MGSD 4WU9C 5B40C 1P3MC 4ZUXC 3X1TC 3WTPC 3KWQB 1P3LA 3WAAA 5BO0A 5B24B 4WU9B 2HIOC 5B40B 3X1TB 1KX5C 1KX3C 3X1UC 3AZJD 3MVDA 2CV5A 5JRGA 4H9NB 4H9OA 3MGPD 3AZGA 2NQBA 5AV6C 1M1AA 5B31C 4Z66D 3X1UB 1U35A 1KX5B 1TZYD 2PYOB 5B2IA 5GSUD 3AV2C 5AV6B 4H9SC 3MNNB 1BH9A 3AV2B 3KXBB 3REKC 5BS7A 1M18D 5F99A 1HQ3C 2Y2PA 2F8NA 5B1MA 3B6GD 3REKB 3AZHA 4HGAC 5CP6D 3REJB 1HQ3B 3AZMC 4KHAB 3AFAA 3UTBC 5AV9A 4H9PA 1P3FD 5DNMC 3AZMB 4AWLC 4KGCC 1M19D 5B0ZA 4X23B 2BG1A 3UTBB 3REHA 4Z5TA 5DNMB 3LELD 3C1BC 4AWLB 3NQJB 5B1LD 4WNNA 5AV8A 3AZKC 3B6FC 3C1BB 3W97C 3C1CC 5CPJA 3EG5B 4G92B 1P3BA 3MGQD 3B6FB 3UTAA 5B2JD 3TU4C 3W97B 3MVDC 3WA9A 2CV5C 5BO0B 3AN2C 3WTPE 1S32C 3AZIC 3W98A 1M1AC 3AZLA 2YFVA 3MVDB 2CV5B 2HUEB 4WV4B 1KX4A 5JRGB 5B0YD 3X1SC 4H9OB 3X1VC 1M1AB 3LJAC 2ZY4A 3B0BA 3X1SB 4LD9D 2Y2HA 2Y2GA 2FFFB 4CSRB 5GT0D 3LZ1A 4R8PC 5B32C 3O62D 4WU9A 5B40A 1T3UA 4ZUXA 1P34C 1P3MA 2CWEA 2F8NG 3WTPA 5F99B 1ID3C 5B32G 5AY8A 2F8NB 5B1MB 5DNND 5B32B 1P34B 2HIOA 3LZ0C 3VH5A 3H0RC 1KX3A 3X1UA 1PZRA 2BYKB 5BNXA 5B31A 5AVCC 1ZLAC 4Z2MG 4E45A 3EPLA 1P3OC 3H0MC 3REHB 4H9SA 4Z5TB 3V9RB 4EO5C 2F8NH 3REKA 5AVBA 5CPKD 3AV1D 2NZDA 5AV8B 1HQ3A 1P3IA 3MGSC 2XD5A 1P3BB 3AZMA 5KDMA 4J8XA 1P3GD 5B33D 4WU8D 4Z2MH 3AZJC 5CPID 5DNMA 2FJ7A 3NQJA 4KGCA 1P3PD 1KX4B 4M6BA 4Z66C 3AZJB 3AZND 4WJ3C 1TZYC 3RELD 4XZQD 1P3AD 4H9RA 3LZ1C 1R4VA 3AZKA 1H3OB 3B6FA 4J8WA 2LY8A 1P3KA 3W97A 5AY8C 3C1CA 4J8VD 1M18C 3R45B 3LZ1B 4G91C 1P3MB 4ZUXB 1F66D 5GXQD 3WTPB 3TU4A 3B6GC 5AY8B 4XUJD 3AN2A 1M18B 1S32A 5CP6C 3WKJD 3AZIA 4G91B 2HIOB 1KX3B 5BT1D 4YS3D 3B6GB 3W99D 5E5AD 4QLCD 3AZED 5CP6B 3X1SA 5B31G 3X1VA 1P3FC 5BNXB 1AOID 5B31B 1EQZA 4CSRA 3LJAA 3UT9D 2AROD 4CAYB 5AVBC 2NZDC 1P3FB 3LELC 3A6ND 5B1LC 3B0DC 1P3IC 3W96A 4R8PA 5B32A 1P34A 5G49B 5AVBB 2Y2KA 4NE5A 2NZDB 5GT3D 3LELB 4KUDD 2UWXA 5AV5D 2BYKA 1ID3A 1F1EA 3B0DB 1P3IB 3MGQC 4J8XC 3AYWD 5B2JC 3LZ0A 3KWQD 4HGAB 2DQNC 2FJ7C 2G5IC 5B24D 3EPJA 3MGQB 3NQUB 5KDMB 3X1TD 4J8XB 3V9RA 5AVCA 2FJ7B 1ZLAA 2Y2IA 2XD1A 4J8UD 4KGCB 4JJND 1A7WA 4J8WC 1P3OA 1KX5D 4WZSB 2DF4C 3EPKA 2PYOD 1P3KC 4H9RB 3B0CT 4LD9C 3AZKB 5AV6D 4J8WB 3MNND 5GT0C 3AV2D 1P3KB 3O62C 3KXBD 3MGSA 4DQYB 3C1CB 3VH6A 4UUZA 3TU4B 5DNNC 3O62B 3AN2B 1S32B 3AZIB 3REJD 3AZJA 2Y2MA 2JCHA 1EQZC 3MGPA 1Q9CA 3KFUG 1H3OA 4Z66A 4YM6D 3REID 3X1VB 1TZYA 5GSUA 2J8PA 3AZFD 3MGRD 1EQZB 3R45A 1WWSA 3W96C 3LJAB 4X23D 3UTBD 2ZY3A 5BNVB 5CPKC 3AV1C 1M18A 3W96B 4R8PB 2G5HC 3C1BD 2RVQC 1ID3B 3B6GA 1B6WA 5CPKB 3AL0C 3AV1B 5CP6A 3LZ0B 1P3LD 3WAAD 4WU8C 4CAYA 5CPIC 2JSSA 1P3FA 1BH8A 3VH5T 3MVDD 2CV5D 5AVCB 1M19A 1P3PC 1ZLAB 5JRGD 5G49A 3AZGD 3AZNC 5CPIB 2NQBD 3LELA 1P3OB 1M1AD 1U35D 5B1LA 5B2ID 1P3PB 4EO5B 3AZNB 2W8SA 4J8VC 1W2EA 2Y2QA 3MGSB 3MGQA 3NQUA 1BFMA 1F66C 5B2JA 5F99D 3WKJC 4XUJC 2F8ND 4UUZB 3B0CW 5B1MD 3MGPC 3AZHD 1F66B 5CHLB 5BT1C 4YS3C 3F6TA 1B67A 5GSUC 5E5AC 4QLCC 4XUJB 3AZEC 5B0YA 3AFAD 3MGPB 1AOIC 5AV9D 4Z66B 3P5JB 4YS3B 3EPHA 2RIQA 1TZYB 5C3IC 3UT9C 5GSUB 2Y2NA 2AROC 5E5AB 3AZEB 5B0ZD 4LD9A 3A6NC 3REHD 4Z5TD 2F2AC 5GT0A 5C3IB 3UT9B 4E44A 2AROB 3O62A 5GT3C 5AV8D 4KUDC 5AV5C 3A6NB 5DNNA 3AYWC 5CPJD 3KWQC 1P3BD 1WWIA 5AV5B 3UTAD 1N1JA 5B24C 5FUGA 3WA9D 1M19C 3AYWB 1Z2CB 3W98D 3AZLD 1BH8B 5BNVA 4J8UC 1M19B 3KUYD 4JJNC 1KX4D 4DRAA 2PYOC 4J8UB 5B1LB 5CPKA 3AV1A 4JJNB 3MNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 W;  3KXB C;  1JFI A;  3LZ1 D;  4WU9 D;  5B40 D;  1P3M D;  4ZUX D;  5B2J B;  3WTP D;  5AY8 D;  1TAF A;  1P3G A;  5B0Y C;  5B33 A;  4WU8 A;  3REJ C;  2HIO D;  5CPI A;  4ZBJ C;  1KX3 D;  3X1U D;  1P3P A;  5B0Y B;  3REI C;  4YM6 C;  3AZN A;  3REL A;  4ZBJ B;  4XZQ A;  5B31 D;  3AZF C;  1P3A A;  2BYM A;  3MGR C;  4X23 C;  3REI B;  4YM6 B;  4LD9 B;  3AZF B;  3MGR B;  4J8V A;  5GT0 B;  5JA4 A;  3REK D;  5AVB D;  2NZD D;  1F66 A;  5GXQ A;  2L5A A;  1HQ3 D;  1HTA A;  1P3I D;  3WKJ A;  4XUJ A;  4G92 C;  5DNN B;  2IO5 C;  1P3L C;  3VH6 T;  3WAA C;  4YS3 A;  3AZM D;  1N1J B;  3KSY A;  4H9Q B;  5E5A A;  4QLC A;  5FUG B;  3W99 A;  3AZE A;  4J8X D;  4DRB A;  1AOI A;  2IO5 B;  1P3L B;  3WAA B;  5DNM D;  2HUE C;  2FJ7 D;  3UT9 A;  5JRG C;  2ARO A;  4KGC D;  3AZG C;  2NQB C;  1U35 C;  3A6N A;  5B2I C;  3KUY A;  3AZG B;  5GT3 A;  3AZK D;  3B6F D;  4J8W D;  4KUD A;  2NQB B;  5AV5 A;  2YFW A;  1U35 B;  5B2I B;  1P3K D;  3W97 D;  5BS7 C;  1JFI B;  3C1C D;  3AYW A;  1P3G C;  3KWQ A;  5F99 C;  5B33 C;  1BH9 B;  5B24 A;  5B1M C;  3TU4 D;  3AZH C;  3AN2 D;  3X1T A;  1TAF B;  1S32 D;  1P3G B;  5B33 B;  4WU8 B;  3AZI D;  3REL C;  4XZQ C;  1P3A C;  4H9N A;  4J8U A;  3AFA C;  3AZH B;  4JJN A;  5AV9 C;  1KX5 A;  3X1S D;  3X1V D;  2PYO A;  3REL B;  4XZQ B;  1P3A B;  2BYM B;  1EQZ D;  3LJA D;  3AFA B;  5B0Z C;  5AV6 A;  4H9P B;  4Z5T C;  5AV9 B;  3MNN A;  3REH C;  5GXQ C;  3AV2 A;  3KXB A;  1KU5 A;  4J8V B;  5AV8 C;  3W96 D;  5B0Z B;  5JA4 B;  4R8P D;  5B32 D;  1P34 D;  5GXQ B;  1ID3 D;  4WNN B;  3W99 C;  5CPJ C;  3WKJ B;  1P3B C;  3REJ A;  3UTA C;  3LZ0 D;  4KHA A;  3WA9 C;  2RVQ D;  2F8N K;  4NE6 A;  5CPJ B;  3W99 B;  4QLC B;  3REI A;  4YM6 A;  3W98 C;  3UTA B;  3AZL C;  1AOI B;  3AZF A;  3WA9 B;  3MGR A;  5AVC D;  3KUY C;  1KX4 C;  1ZLA D;  4X23 A;  3UTB A;  4NFT A;  3W98 B;  1P3O D;  3VH6 W;  3AZL B;  2YFV B;  3KUY B;  4NE3 A;  1ULY A;  5GT3 B;  3C1B A;  4KUD B;  2YFW B;  4H9Q A;  3MGS D;  4WU9 C;  5B40 C;  1P3M C;  4ZUX C;  3X1T C;  3WTP C;  3KWQ B;  1P3L A;  3WAA A;  5BO0 A;  5B24 B;  4WU9 B;  2HIO C;  5B40 B;  3X1T B;  1KX5 C;  1KX3 C;  3X1U C;  3AZJ D;  3MVD A;  2CV5 A;  5JRG A;  4H9N B;  4H9O A;  3MGP D;  3AZG A;  2NQB A;  5AV6 C;  1M1A A;  5B31 C;  4Z66 D;  3X1U B;  1U35 A;  1KX5 B;  1TZY D;  2PYO B;  5B2I A;  5GSU D;  3AV2 C;  5AV6 B;  4H9S C;  3MNN B;  1BH9 A;  3AV2 B;  3KXB B;  3REK C;  5BS7 A;  1M18 D;  5F99 A;  1HQ3 C;  2F8N A;  5B1M A;  3B6G D;  3REK B;  3AZH A;  4HGA C;  5CP6 D;  3REJ B;  1HQ3 B;  3AZM C;  4KHA B;  3AFA A;  3UTB C;  5AV9 A;  4H9P A;  1P3F D;  5DNM C;  3AZM B;  4AWL C;  4KGC C;  1M19 D;  5B0Z A;  4X23 B;  3UTB B;  3REH A;  4Z5T A;  5DNM B;  3LEL D;  3C1B C;  4AWL B;  3NQJ B;  5B1L D;  4WNN A;  5AV8 A;  3AZK C;  3B6F C;  3C1B B;  3W97 C;  3C1C C;  5CPJ A;  4G92 B;  1P3B A;  3MGQ D;  3B6F B;  3UTA A;  5B2J D;  3TU4 C;  3W97 B;  3MVD C;  3WA9 A;  2CV5 C;  5BO0 B;  3AN2 C;  3WTP E;  1S32 C;  3AZI C;  3W98 A;  1M1A C;  3AZL A;  2YFV A;  3MVD B;  2CV5 B;  2HUE B;  4WV4 B;  1KX4 A;  5JRG B;  5B0Y D;  3X1S C;  4H9O B;  3X1V C;  1M1A B;  3LJA C;  3B0B A;  3X1S B;  4LD9 D;  4CSR B;  5GT0 D;  3LZ1 A;  4R8P C;  5B32 C;  3O62 D;  4WU9 A;  5B40 A;  1P34 C;  4ZUX A;  1P3M A;  2CWE A;  2F8N G;  3WTP A;  5F99 B;  1ID3 C;  5B32 G;  5AY8 A;  2F8N B;  5B1M B;  5DNN D;  5B32 B;  1P34 B;  2HIO A;  3LZ0 C;  3VH5 A;  1KX3 A;  3X1U A;  2BYK B;  5BNX A;  5B31 A;  5AVC C;  1ZLA C;  4Z2M G;  4E45 A;  1P3O C;  3REH B;  4H9S A;  4Z5T B;  3V9R B;  4EO5 C;  2F8N H;  3REK A;  5AVB A;  5CPK D;  3AV1 D;  2NZD A;  5AV8 B;  1HQ3 A;  1P3I A;  3MGS C;  1P3B B;  3AZM A;  5KDM A;  4J8X A;  1P3G D;  5B33 D;  4WU8 D;  4Z2M H;  3AZJ C;  5CPI D;  5DNM A;  2FJ7 A;  3NQJ A;  4KGC A;  1P3P D;  1KX4 B;  4M6B A;  4Z66 C;  3AZJ B;  3AZN D;  1TZY C;  3REL D;  4XZQ D;  1P3A D;  4H9R A;  3LZ1 C;  1R4V A;  3AZK A;  1H3O B;  3B6F A;  4J8W A;  2LY8 A;  1P3K A;  3W97 A;  5AY8 C;  3C1C A;  4J8V D;  1M18 C;  3R45 B;  3LZ1 B;  4G91 C;  1P3M B;  4ZUX B;  1F66 D;  5GXQ D;  3WTP B;  3TU4 A;  3B6G C;  5AY8 B;  4XUJ D;  3AN2 A;  1M18 B;  1S32 A;  5CP6 C;  3WKJ D;  3AZI A;  4G91 B;  2HIO B;  1KX3 B;  5BT1 D;  4YS3 D;  3B6G B;  3W99 D;  5E5A D;  4QLC D;  3AZE D;  5CP6 B;  3X1S A;  5B31 G;  3X1V A;  1P3F C;  5BNX B;  1AOI D;  5B31 B;  1EQZ A;  4CSR A;  3LJA A;  3UT9 D;  2ARO D;  4CAY B;  5AVB C;  2NZD C;  1P3F B;  3LEL C;  3A6N D;  5B1L C;  3B0D C;  1P3I C;  3W96 A;  4R8P A;  5B32 A;  1P34 A;  5G49 B;  5AVB B;  4NE5 A;  2NZD B;  5GT3 D;  3LEL B;  4KUD D;  5AV5 D;  2BYK A;  1ID3 A;  1F1E A;  3B0D B;  1P3I B;  3MGQ C;  4J8X C;  3AYW D;  5B2J C;  3LZ0 A;  3KWQ D;  4HGA B;  2FJ7 C;  5B24 D;  3MGQ B;  3NQU B;  5KDM B;  3X1T D;  4J8X B;  3V9R A;  5AVC A;  2FJ7 B;  1ZLA A;  4J8U D;  4KGC B;  4JJN D;  1A7W A;  4J8W C;  1P3O A;  1KX5 D;  4WZS B;  2PYO D;  1P3K C;  4H9R B;  3B0C T;  4LD9 C;  3AZK B;  5AV6 D;  4J8W B;  3MNN D;  5GT0 C;  3AV2 D;  1P3K B;  3O62 C;  3KXB D;  3MGS A;  3C1C B;  3VH6 A;  4UUZ A;  3TU4 B;  5DNN C;  3O62 B;  3AN2 B;  1S32 B;  3AZI B;  3REJ D;  3AZJ A;  1EQZ C;  3MGP A;  1Q9C A;  1H3O A;  4Z66 A;  4YM6 D;  3REI D;  3X1V B;  1TZY A;  5GSU A;  3AZF D;  3MGR D;  1EQZ B;  3R45 A;  1WWS A;  3W96 C;  3LJA B;  4X23 D;  3UTB D;  5BNV B;  5CPK C;  3AV1 C;  1M18 A;  3W96 B;  4R8P B;  3C1B D;  2RVQ C;  1ID3 B;  3B6G A;  1B6W A;  5CPK B;  3AV1 B;  5CP6 A;  3LZ0 B;  1P3L D;  3WAA D;  4WU8 C;  4CAY A;  5CPI C;  2JSS A;  1P3F A;  1BH8 A;  3VH5 T;  3MVD D;  2CV5 D;  5AVC B;  1M19 A;  1P3P C;  1ZLA B;  5JRG D;  5G49 A;  3AZG D;  3AZN C;  5CPI B;  2NQB D;  3LEL A;  1P3O B;  1M1A D;  1U35 D;  5B1L A;  5B2I D;  1P3P B;  4EO5 B;  3AZN B;  4J8V C;  3MGS B;  3MGQ A;  3NQU A;  1BFM A;  1F66 C;  5B2J A;  5F99 D;  3WKJ C;  4XUJ C;  2F8N D;  4UUZ B;  3B0C W;  5B1M D;  3MGP C;  3AZH D;  1F66 B;  5CHL B;  5BT1 C;  4YS3 C;  1B67 A;  5GSU C;  5E5A C;  4QLC C;  4XUJ B;  3AZE C;  5B0Y A;  3AFA D;  3MGP B;  1AOI C;  5AV9 D;  4Z66 B;  4YS3 B;  1TZY B;  5C3I C;  3UT9 C;  5GSU B;  5E5A B;  2ARO C;  3AZE B;  5B0Z D;  4LD9 A;  3A6N C;  3REH D;  4Z5T D;  5GT0 A;  5C3I B;  3UT9 B;  4E44 A;  2ARO B;  3O62 A;  5GT3 C;  5AV8 D;  4KUD C;  5AV5 C;  3A6N B;  5DNN A;  3AYW C;  5CPJ D;  3KWQ C;  1P3B D;  1WWI A;  5AV5 B;  3UTA D;  1N1J A;  5B24 C;  5FUG A;  3WA9 D;  1M19 C;  3AYW B;  3W98 D;  3AZL D;  1BH8 B;  5BNV A;  4J8U C;  1M19 B;  3KUY D;  4JJN C;  1KX4 D;  4DRA A;  2PYO C;  4J8U B;  5B1L B;  5CPK A;  3AV1 A;  4JJN B;  3MNN C; 
#chains in the Genus database with same CATH topology
 3VH5 W;  3KXB C;  3FDD A;  1JFI A;  3LZ1 D;  4WU9 D;  5B40 D;  1P3M D;  4ZUX D;  3H0L C;  5B2J B;  3WTP D;  2ZM5 A;  5AY8 D;  1TAF A;  3A1K A;  1P3G A;  5B0Y C;  5B33 A;  4WU8 A;  3REJ C;  2HIO D;  5CPI A;  4ZBJ C;  1KX3 D;  2Y2O A;  3X1U D;  1P3P A;  5B0Y B;  3REI C;  4YM6 C;  3AZN A;  3REL A;  4ZBJ B;  4XZQ A;  5B31 D;  3AZF C;  1P3A A;  2BYM A;  3MGR C;  2Y2J A;  4X23 C;  2ZY2 A;  3REI B;  4YM6 B;  4LD9 B;  3AZF B;  3MGR B;  4J8V A;  5GT0 B;  5JA4 A;  3REK D;  5AVB D;  2NZD D;  1F66 A;  5GXQ A;  2L5A A;  1HQ3 D;  1HTA A;  1P3I D;  3WKJ A;  4XUJ A;  4G92 C;  5DNN B;  2IO5 C;  1P3L C;  3VH6 T;  3WAA C;  4YS3 A;  3AZM D;  1N1J B;  3KSY A;  4H9Q B;  5E5A A;  4QLC A;  2Y2L A;  5FUG B;  3AZE A;  3W99 A;  4J8X D;  4DRB A;  1AOI A;  2IO5 B;  1P3L B;  3WAA B;  5DNM D;  2HUE C;  2FJ7 D;  3UT9 A;  5JRG C;  2ARO A;  4KGC D;  3AZG C;  2NQB C;  1U35 C;  3A6N A;  5B2I C;  3KUY A;  2ZY5 A;  3AZG B;  5GT3 A;  3AZK D;  3B6F D;  4J8W D;  4KUD A;  2NQB B;  5AV5 A;  2YFW A;  1U35 B;  5B2I B;  1P3K D;  3W97 D;  5BS7 C;  2VQR A;  3C1C D;  3AYW A;  1JFI B;  1P3G C;  3KWQ A;  5F99 C;  5B33 C;  1BH9 B;  5B24 A;  5B1M C;  3TU4 D;  3AZH C;  3AN2 D;  3X1T A;  1TAF B;  1S32 D;  1P3G B;  5B33 B;  4WU8 B;  3AZI D;  3REL C;  4XZQ C;  1P3A C;  4H9N A;  4J8U A;  3AFA C;  3AZH B;  4JJN A;  5AV9 C;  1KX5 A;  3X1S D;  3X1V D;  2PYO A;  3REL B;  2JE5 A;  4XZQ B;  1P3A B;  2BYM B;  1EQZ D;  3LJA D;  3AFA B;  5B0Z C;  5AV6 A;  4H9P B;  4Z5T C;  5AV9 B;  3MNN A;  3REH C;  5GXQ C;  3AV2 A;  3KXB A;  1KU5 A;  4J8V B;  5AV8 C;  3W96 D;  5B0Z B;  5JA4 B;  4R8P D;  5B32 D;  1P34 D;  5GXQ B;  1ID3 D;  4UPK A;  4WNN B;  3W99 C;  5CPJ C;  3WKJ B;  1P3B C;  3REJ A;  3UTA C;  3LZ0 D;  4KHA A;  3WA9 C;  2RVQ D;  2F8N K;  4NE6 A;  5CPJ B;  3W99 B;  4QLC B;  3REI A;  4YM6 A;  3W98 C;  3UTA B;  3AZL C;  1AOI B;  3AZF A;  3WA9 B;  3MGR A;  5AVC D;  3KUY C;  1KX4 C;  1ZLA D;  4X23 A;  3UTB A;  4NFT A;  3W98 B;  1P3O D;  3VH6 W;  3AZL B;  2YFV B;  3A1I A;  3KUY B;  4NE3 A;  1ULY A;  3IP4 C;  5GT3 B;  3C1B A;  4KUD B;  2YFW B;  4H9Q A;  3MGS D;  4WU9 C;  5B40 C;  1P3M C;  4ZUX C;  3X1T C;  3WTP C;  3KWQ B;  1P3L A;  3WAA A;  5BO0 A;  5B24 B;  4WU9 B;  2HIO C;  5B40 B;  3X1T B;  1KX5 C;  1KX3 C;  3X1U C;  3AZJ D;  3MVD A;  2CV5 A;  5JRG A;  4H9N B;  4H9O A;  3MGP D;  3AZG A;  2NQB A;  5AV6 C;  1M1A A;  5B31 C;  4Z66 D;  3X1U B;  1U35 A;  1KX5 B;  1TZY D;  2PYO B;  5B2I A;  5GSU D;  3AV2 C;  5AV6 B;  4H9S C;  3MNN B;  1BH9 A;  3AV2 B;  3KXB B;  3REK C;  5BS7 A;  1M18 D;  5F99 A;  1HQ3 C;  2Y2P A;  2F8N A;  5B1M A;  3B6G D;  3REK B;  3AZH A;  4HGA C;  5CP6 D;  3REJ B;  1HQ3 B;  3AZM C;  4KHA B;  3AFA A;  3UTB C;  5AV9 A;  4H9P A;  1P3F D;  5DNM C;  3AZM B;  4AWL C;  4KGC C;  1M19 D;  5B0Z A;  4X23 B;  2BG1 A;  3UTB B;  3REH A;  4Z5T A;  5DNM B;  3LEL D;  3C1B C;  4AWL B;  3NQJ B;  5B1L D;  4WNN A;  5AV8 A;  3AZK C;  3B6F C;  3C1B B;  3W97 C;  3C1C C;  5CPJ A;  3EG5 B;  4G92 B;  1P3B A;  3MGQ D;  3B6F B;  3UTA A;  5B2J D;  3TU4 C;  3W97 B;  3MVD C;  3WA9 A;  2CV5 C;  5BO0 B;  3AN2 C;  3WTP E;  1S32 C;  3AZI C;  3W98 A;  1M1A C;  3AZL A;  2YFV A;  3MVD B;  2CV5 B;  2HUE B;  4WV4 B;  1KX4 A;  5JRG B;  5B0Y D;  3X1S C;  4H9O B;  3X1V C;  1M1A B;  3LJA C;  2ZY4 A;  3B0B A;  3X1S B;  4LD9 D;  2Y2H A;  2Y2G A;  2FFF B;  4CSR B;  5GT0 D;  3LZ1 A;  4R8P C;  5B32 C;  3O62 D;  4WU9 A;  5B40 A;  1T3U A;  4ZUX A;  1P34 C;  1P3M A;  2CWE A;  2F8N G;  3WTP A;  5F99 B;  1ID3 C;  5B32 G;  5AY8 A;  2F8N B;  5B1M B;  5DNN D;  5B32 B;  1P34 B;  2HIO A;  3LZ0 C;  3VH5 A;  3H0R C;  1KX3 A;  3X1U A;  1PZR A;  2BYK B;  5BNX A;  5B31 A;  5AVC C;  1ZLA C;  4Z2M G;  4E45 A;  3EPL A;  1P3O C;  3H0M C;  3REH B;  4H9S A;  4Z5T B;  3V9R B;  4EO5 C;  2F8N H;  3REK A;  5AVB A;  5CPK D;  3AV1 D;  2NZD A;  5AV8 B;  1HQ3 A;  1P3I A;  3MGS C;  2XD5 A;  1P3B B;  3AZM A;  5KDM A;  4J8X A;  1P3G D;  5B33 D;  4WU8 D;  4Z2M H;  3AZJ C;  5CPI D;  5DNM A;  2FJ7 A;  3NQJ A;  4KGC A;  1P3P D;  1KX4 B;  4M6B A;  4Z66 C;  3AZJ B;  3AZN D;  4WJ3 C;  1TZY C;  3REL D;  4XZQ D;  1P3A D;  4H9R A;  3LZ1 C;  1R4V A;  3AZK A;  1H3O B;  3B6F A;  4J8W A;  2LY8 A;  1P3K A;  3W97 A;  5AY8 C;  3C1C A;  4J8V D;  1M18 C;  3R45 B;  3LZ1 B;  4G91 C;  1P3M B;  4ZUX B;  1F66 D;  5GXQ D;  3WTP B;  3TU4 A;  3B6G C;  5AY8 B;  4XUJ D;  3AN2 A;  1M18 B;  1S32 A;  5CP6 C;  3WKJ D;  3AZI A;  4G91 B;  2HIO B;  1KX3 B;  5BT1 D;  4YS3 D;  3B6G B;  3W99 D;  5E5A D;  4QLC D;  3AZE D;  5CP6 B;  3X1S A;  5B31 G;  3X1V A;  1P3F C;  5BNX B;  1AOI D;  5B31 B;  1EQZ A;  4CSR A;  3LJA A;  3UT9 D;  2ARO D;  4CAY B;  5AVB C;  2NZD C;  1P3F B;  3LEL C;  3A6N D;  5B1L C;  3B0D C;  1P3I C;  3W96 A;  4R8P A;  5B32 A;  1P34 A;  5G49 B;  5AVB B;  2Y2K A;  4NE5 A;  2NZD B;  5GT3 D;  3LEL B;  4KUD D;  2UWX A;  5AV5 D;  2BYK A;  1ID3 A;  1F1E A;  3B0D B;  1P3I B;  3MGQ C;  4J8X C;  3AYW D;  5B2J C;  3LZ0 A;  3KWQ D;  4HGA B;  2DQN C;  2FJ7 C;  2G5I C;  5B24 D;  3EPJ A;  3MGQ B;  3NQU B;  5KDM B;  3X1T D;  4J8X B;  3V9R A;  5AVC A;  2FJ7 B;  1ZLA A;  2Y2I A;  2XD1 A;  4J8U D;  4KGC B;  4JJN D;  1A7W A;  4J8W C;  1P3O A;  1KX5 D;  4WZS B;  2DF4 C;  3EPK A;  2PYO D;  1P3K C;  4H9R B;  3B0C T;  4LD9 C;  3AZK B;  5AV6 D;  4J8W B;  3MNN D;  5GT0 C;  3AV2 D;  1P3K B;  3O62 C;  3KXB D;  3MGS A;  4DQY B;  3C1C B;  3VH6 A;  4UUZ A;  3TU4 B;  5DNN C;  3O62 B;  3AN2 B;  1S32 B;  3AZI B;  3REJ D;  3AZJ A;  2Y2M A;  2JCH A;  1EQZ C;  3MGP A;  1Q9C A;  3KFU G;  1H3O A;  4Z66 A;  4YM6 D;  3REI D;  3X1V B;  1TZY A;  5GSU A;  2J8P A;  3AZF D;  3MGR D;  1EQZ B;  3R45 A;  1WWS A;  3W96 C;  3LJA B;  4X23 D;  3UTB D;  2ZY3 A;  5BNV B;  5CPK C;  3AV1 C;  1M18 A;  3W96 B;  4R8P B;  2G5H C;  3C1B D;  2RVQ C;  1ID3 B;  3B6G A;  1B6W A;  5CPK B;  3AL0 C;  3AV1 B;  5CP6 A;  3LZ0 B;  1P3L D;  3WAA D;  4WU8 C;  4CAY A;  5CPI C;  2JSS A;  1P3F A;  1BH8 A;  3VH5 T;  3MVD D;  2CV5 D;  5AVC B;  1M19 A;  1P3P C;  1ZLA B;  5JRG D;  5G49 A;  3AZG D;  3AZN C;  5CPI B;  2NQB D;  3LEL A;  1P3O B;  1M1A D;  1U35 D;  5B1L A;  5B2I D;  1P3P B;  4EO5 B;  3AZN B;  2W8S A;  4J8V C;  1W2E A;  2Y2Q A;  3MGS B;  3MGQ A;  3NQU A;  1BFM A;  1F66 C;  5B2J A;  5F99 D;  3WKJ C;  4XUJ C;  2F8N D;  4UUZ B;  3B0C W;  5B1M D;  3MGP C;  3AZH D;  1F66 B;  5CHL B;  5BT1 C;  4YS3 C;  3F6T A;  1B67 A;  5GSU C;  5E5A C;  4QLC C;  4XUJ B;  3AZE C;  5B0Y A;  3AFA D;  3MGP B;  1AOI C;  5AV9 D;  4Z66 B;  3P5J B;  4YS3 B;  3EPH A;  2RIQ A;  1TZY B;  5C3I C;  3UT9 C;  5GSU B;  2Y2N A;  2ARO C;  5E5A B;  3AZE B;  5B0Z D;  4LD9 A;  3A6N C;  3REH D;  4Z5T D;  2F2A C;  5GT0 A;  5C3I B;  3UT9 B;  4E44 A;  2ARO B;  3O62 A;  5GT3 C;  5AV8 D;  4KUD C;  5AV5 C;  3A6N B;  5DNN A;  3AYW C;  5CPJ D;  3KWQ C;  1P3B D;  1WWI A;  5AV5 B;  3UTA D;  1N1J A;  5B24 C;  5FUG A;  3WA9 D;  1M19 C;  3AYW B;  1Z2C B;  3W98 D;  3AZL D;  1BH8 B;  5BNV A;  4J8U C;  1M19 B;  3KUY D;  4JJN C;  1KX4 D;  4DRA A;  2PYO C;  4J8U B;  5B1L B;  5CPK A;  3AV1 A;  4JJN B;  3MNN C; 
#chains in the Genus database with same CATH homology
 3VH5 W;  3KXB C;  3FDD A;  1JFI A;  3LZ1 D;  4WU9 D;  5B40 D;  1P3M D;  4ZUX D;  3H0L C;  5B2J B;  3WTP D;  2ZM5 A;  5AY8 D;  1TAF A;  3A1K A;  1P3G A;  5B0Y C;  5B33 A;  4WU8 A;  3REJ C;  2HIO D;  5CPI A;  4ZBJ C;  1KX3 D;  2Y2O A;  3X1U D;  1P3P A;  5B0Y B;  3REI C;  4YM6 C;  3AZN A;  3REL A;  4ZBJ B;  4XZQ A;  5B31 D;  3AZF C;  1P3A A;  2BYM A;  3MGR C;  2Y2J A;  4X23 C;  2ZY2 A;  3REI B;  4YM6 B;  4LD9 B;  3AZF B;  3MGR B;  4J8V A;  5GT0 B;  5JA4 A;  3REK D;  5AVB D;  2NZD D;  1F66 A;  5GXQ A;  2L5A A;  1HQ3 D;  1HTA A;  1P3I D;  3WKJ A;  4XUJ A;  4G92 C;  5DNN B;  2IO5 C;  1P3L C;  3VH6 T;  3WAA C;  4YS3 A;  3AZM D;  1N1J B;  3KSY A;  4H9Q B;  5E5A A;  4QLC A;  2Y2L A;  5FUG B;  3AZE A;  3W99 A;  4J8X D;  4DRB A;  1AOI A;  2IO5 B;  1P3L B;  3WAA B;  5DNM D;  2HUE C;  2FJ7 D;  3UT9 A;  5JRG C;  2ARO A;  4KGC D;  3AZG C;  2NQB C;  1U35 C;  3A6N A;  5B2I C;  3KUY A;  2ZY5 A;  3AZG B;  5GT3 A;  3AZK D;  3B6F D;  4J8W D;  4KUD A;  2NQB B;  5AV5 A;  2YFW A;  1U35 B;  5B2I B;  1P3K D;  3W97 D;  5BS7 C;  2VQR A;  3C1C D;  3AYW A;  1JFI B;  1P3G C;  3KWQ A;  5F99 C;  5B33 C;  1BH9 B;  5B24 A;  5B1M C;  3TU4 D;  3AZH C;  3AN2 D;  3X1T A;  1TAF B;  1S32 D;  1P3G B;  5B33 B;  4WU8 B;  3AZI D;  3REL C;  4XZQ C;  1P3A C;  4H9N A;  4J8U A;  3AFA C;  3AZH B;  4JJN A;  5AV9 C;  1KX5 A;  3X1S D;  3X1V D;  2PYO A;  3REL B;  2JE5 A;  4XZQ B;  1P3A B;  2BYM B;  1EQZ D;  3LJA D;  3AFA B;  5B0Z C;  5AV6 A;  4H9P B;  4Z5T C;  5AV9 B;  3MNN A;  3REH C;  5GXQ C;  3AV2 A;  3KXB A;  1KU5 A;  4J8V B;  5AV8 C;  3W96 D;  5B0Z B;  5JA4 B;  4R8P D;  5B32 D;  1P34 D;  5GXQ B;  1ID3 D;  4UPK A;  4WNN B;  3W99 C;  5CPJ C;  3WKJ B;  1P3B C;  3REJ A;  3UTA C;  3LZ0 D;  4KHA A;  3WA9 C;  2RVQ D;  2F8N K;  4NE6 A;  5CPJ B;  3W99 B;  4QLC B;  3REI A;  4YM6 A;  3W98 C;  3UTA B;  3AZL C;  1AOI B;  3AZF A;  3WA9 B;  3MGR A;  5AVC D;  3KUY C;  1KX4 C;  1ZLA D;  4X23 A;  3UTB A;  4NFT A;  3W98 B;  1P3O D;  3VH6 W;  3AZL B;  2YFV B;  3A1I A;  3KUY B;  4NE3 A;  1ULY A;  3IP4 C;  5GT3 B;  3C1B A;  4KUD B;  2YFW B;  4H9Q A;  3MGS D;  4WU9 C;  5B40 C;  1P3M C;  4ZUX C;  3X1T C;  3WTP C;  3KWQ B;  1P3L A;  3WAA A;  5BO0 A;  5B24 B;  4WU9 B;  2HIO C;  5B40 B;  3X1T B;  1KX5 C;  1KX3 C;  3X1U C;  3AZJ D;  3MVD A;  2CV5 A;  5JRG A;  4H9N B;  4H9O A;  3MGP D;  3AZG A;  2NQB A;  5AV6 C;  1M1A A;  5B31 C;  4Z66 D;  3X1U B;  1U35 A;  1KX5 B;  1TZY D;  2PYO B;  5B2I A;  5GSU D;  3AV2 C;  5AV6 B;  4H9S C;  3MNN B;  1BH9 A;  3AV2 B;  3KXB B;  3REK C;  5BS7 A;  1M18 D;  5F99 A;  1HQ3 C;  2Y2P A;  2F8N A;  5B1M A;  3B6G D;  3REK B;  3AZH A;  4HGA C;  5CP6 D;  3REJ B;  1HQ3 B;  3AZM C;  4KHA B;  3AFA A;  3UTB C;  5AV9 A;  4H9P A;  1P3F D;  5DNM C;  3AZM B;  4AWL C;  4KGC C;  1M19 D;  5B0Z A;  4X23 B;  2BG1 A;  3UTB B;  3REH A;  4Z5T A;  5DNM B;  3LEL D;  3C1B C;  4AWL B;  3NQJ B;  5B1L D;  4WNN A;  5AV8 A;  3AZK C;  3B6F C;  3C1B B;  3W97 C;  3C1C C;  5CPJ A;  3EG5 B;  4G92 B;  1P3B A;  3MGQ D;  3B6F B;  3UTA A;  5B2J D;  3TU4 C;  3W97 B;  3MVD C;  3WA9 A;  2CV5 C;  5BO0 B;  3AN2 C;  3WTP E;  1S32 C;  3AZI C;  3W98 A;  1M1A C;  3AZL A;  2YFV A;  3MVD B;  2CV5 B;  2HUE B;  4WV4 B;  1KX4 A;  5JRG B;  5B0Y D;  3X1S C;  4H9O B;  3X1V C;  1M1A B;  3LJA C;  2ZY4 A;  3B0B A;  3X1S B;  4LD9 D;  2Y2H A;  2Y2G A;  2FFF B;  4CSR B;  5GT0 D;  3LZ1 A;  4R8P C;  5B32 C;  3O62 D;  4WU9 A;  5B40 A;  1T3U A;  4ZUX A;  1P34 C;  1P3M A;  2CWE A;  2F8N G;  3WTP A;  5F99 B;  1ID3 C;  5B32 G;  5AY8 A;  2F8N B;  5B1M B;  5DNN D;  5B32 B;  1P34 B;  2HIO A;  3LZ0 C;  3VH5 A;  3H0R C;  1KX3 A;  3X1U A;  1PZR A;  2BYK B;  5BNX A;  5B31 A;  5AVC C;  1ZLA C;  4Z2M G;  4E45 A;  3EPL A;  1P3O C;  3H0M C;  3REH B;  4H9S A;  4Z5T B;  3V9R B;  4EO5 C;  2F8N H;  3REK A;  5AVB A;  5CPK D;  3AV1 D;  2NZD A;  5AV8 B;  1HQ3 A;  1P3I A;  3MGS C;  2XD5 A;  1P3B B;  3AZM A;  5KDM A;  4J8X A;  1P3G D;  5B33 D;  4WU8 D;  4Z2M H;  3AZJ C;  5CPI D;  5DNM A;  2FJ7 A;  3NQJ A;  4KGC A;  1P3P D;  1KX4 B;  4M6B A;  4Z66 C;  3AZJ B;  3AZN D;  4WJ3 C;  1TZY C;  3REL D;  4XZQ D;  1P3A D;  4H9R A;  3LZ1 C;  1R4V A;  3AZK A;  1H3O B;  3B6F A;  4J8W A;  2LY8 A;  1P3K A;  3W97 A;  5AY8 C;  3C1C A;  4J8V D;  1M18 C;  3R45 B;  3LZ1 B;  4G91 C;  1P3M B;  4ZUX B;  1F66 D;  5GXQ D;  3WTP B;  3TU4 A;  3B6G C;  5AY8 B;  4XUJ D;  3AN2 A;  1M18 B;  1S32 A;  5CP6 C;  3WKJ D;  3AZI A;  4G91 B;  2HIO B;  1KX3 B;  5BT1 D;  4YS3 D;  3B6G B;  3W99 D;  5E5A D;  4QLC D;  3AZE D;  5CP6 B;  3X1S A;  5B31 G;  3X1V A;  1P3F C;  5BNX B;  1AOI D;  5B31 B;  1EQZ A;  4CSR A;  3LJA A;  3UT9 D;  2ARO D;  4CAY B;  5AVB C;  2NZD C;  1P3F B;  3LEL C;  3A6N D;  5B1L C;  3B0D C;  1P3I C;  3W96 A;  4R8P A;  5B32 A;  1P34 A;  5G49 B;  5AVB B;  2Y2K A;  4NE5 A;  2NZD B;  5GT3 D;  3LEL B;  4KUD D;  2UWX A;  5AV5 D;  2BYK A;  1ID3 A;  1F1E A;  3B0D B;  1P3I B;  3MGQ C;  4J8X C;  3AYW D;  5B2J C;  3LZ0 A;  3KWQ D;  4HGA B;  2DQN C;  2FJ7 C;  2G5I C;  5B24 D;  3EPJ A;  3MGQ B;  3NQU B;  5KDM B;  3X1T D;  4J8X B;  3V9R A;  5AVC A;  2FJ7 B;  1ZLA A;  2Y2I A;  2XD1 A;  4J8U D;  4KGC B;  4JJN D;  1A7W A;  4J8W C;  1P3O A;  1KX5 D;  4WZS B;  2DF4 C;  3EPK A;  2PYO D;  1P3K C;  4H9R B;  3B0C T;  4LD9 C;  3AZK B;  5AV6 D;  4J8W B;  3MNN D;  5GT0 C;  3AV2 D;  1P3K B;  3O62 C;  3KXB D;  3MGS A;  4DQY B;  3C1C B;  3VH6 A;  4UUZ A;  3TU4 B;  5DNN C;  3O62 B;  3AN2 B;  1S32 B;  3AZI B;  3REJ D;  3AZJ A;  2Y2M A;  2JCH A;  1EQZ C;  3MGP A;  1Q9C A;  3KFU G;  1H3O A;  4Z66 A;  4YM6 D;  3REI D;  3X1V B;  1TZY A;  5GSU A;  2J8P A;  3AZF D;  3MGR D;  1EQZ B;  3R45 A;  1WWS A;  3W96 C;  3LJA B;  4X23 D;  3UTB D;  2ZY3 A;  5BNV B;  5CPK C;  3AV1 C;  1M18 A;  3W96 B;  4R8P B;  2G5H C;  3C1B D;  2RVQ C;  1ID3 B;  3B6G A;  1B6W A;  5CPK B;  3AL0 C;  3AV1 B;  5CP6 A;  3LZ0 B;  1P3L D;  3WAA D;  4WU8 C;  4CAY A;  5CPI C;  2JSS A;  1P3F A;  1BH8 A;  3VH5 T;  3MVD D;  2CV5 D;  5AVC B;  1M19 A;  1P3P C;  1ZLA B;  5JRG D;  5G49 A;  3AZG D;  3AZN C;  5CPI B;  2NQB D;  3LEL A;  1P3O B;  1M1A D;  1U35 D;  5B1L A;  5B2I D;  1P3P B;  4EO5 B;  3AZN B;  2W8S A;  4J8V C;  1W2E A;  2Y2Q A;  3MGS B;  3MGQ A;  3NQU A;  1BFM A;  1F66 C;  5B2J A;  5F99 D;  3WKJ C;  4XUJ C;  2F8N D;  4UUZ B;  3B0C W;  5B1M D;  3MGP C;  3AZH D;  1F66 B;  5CHL B;  5BT1 C;  4YS3 C;  3F6T A;  1B67 A;  5GSU C;  5E5A C;  4QLC C;  4XUJ B;  3AZE C;  5B0Y A;  3AFA D;  3MGP B;  1AOI C;  5AV9 D;  4Z66 B;  3P5J B;  4YS3 B;  3EPH A;  2RIQ A;  1TZY B;  5C3I C;  3UT9 C;  5GSU B;  2Y2N A;  2ARO C;  5E5A B;  3AZE B;  5B0Z D;  4LD9 A;  3A6N C;  3REH D;  4Z5T D;  2F2A C;  5GT0 A;  5C3I B;  3UT9 B;  4E44 A;  2ARO B;  3O62 A;  5GT3 C;  5AV8 D;  4KUD C;  5AV5 C;  3A6N B;  5DNN A;  3AYW C;  5CPJ D;  3KWQ C;  1P3B D;  1WWI A;  5AV5 B;  3UTA D;  1N1J A;  5B24 C;  5FUG A;  3WA9 D;  1M19 C;  3AYW B;  1Z2C B;  3W98 D;  3AZL D;  1BH8 B;  5BNV A;  4J8U C;  1M19 B;  3KUY D;  4JJN C;  1KX4 D;  4DRA A;  2PYO C;  4J8U B;  5B1L B;  5CPK A;  3AV1 A;  4JJN B;  3MNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...