2NZDA

Nucleosome core particle containing 145 bp of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdA00
3MGRA 3AZFC 1P34C 2NQBD 5JRGB 3AZEB 3LZ0A 3WA9B 1M19D 5DNNA 4KHAB 3X1SC 1P3BA 5B32B 1JFIB 1ID3C 1KX5A 5B40A 3KXBD 1ULYA 1P3KD 5F99A 1HTAA 3AYWB 2HIOA 4YS3B 3AZKA 5CPKD 1P3LD 4YS3C 3WAAA 3AZMC 5B31C 2LY8A 3W97B 5B2JC 5AV9B 5DNMA 1P3FC 3W97C 3X1TA 3C1CD 1TZYA 3X1VD 3O62C 2FJ7B 3AZHD 5B24B 4X23A 2FJ7C 1F66B 5B24C 4WU9D 5AV6D 1F66C 5CP6D 5CPIB 3MGSA 3KUYB 5C3IC 3B6FA 4UUZB 3KWQB 3C1BB 4H9PB 4ZUXB 5B0ZB 4J8XA 3UTAA 3KWQC 1U35B 3C1BC 5B0ZC 4ZUXC 4XZQA 1P3PB 5AV8D 3VH6A 4J8VC 3WTPA 1HQ3A 1P3PC 3UT9B 1AOID 2IO5B 5AVBB 1ZLAD 3WKJB 1A7WA 5AVBC 3AZGB 1P3ID 5AV5B 2AROD 3LZ1C 3AV1D 4J8UA 1P3MA 3LJAD 4WNNA 5GT3A 3MGRB 4EO5B 4EO5C 1KX3D 4LD9A 4CAYA 3LZ0B 3MGQC 5AY8C 3V9RA 5DNNB 3REKB 5B0YC 4JJNB 3REKC 4E45A 3AZNA 4JJNC 1P3BB 5JA4A 4KGCD 1KX5B 5B40B 2NQBC 3REID 5F99B 3AZFD 2BYMA 4J8WD 3AZKB 1S32A 5FUGA 2F8NK 2PYOA 3WAAB 1M19C 1N1JA 5JRGD 3AZED 5B33B 5B33C 5DNMB 3WA9D 3X1TB 3MNNA 3KXBC 4DRBA 1TZYB 1P3KC 5GSUB 4NE6A 2NZDB 4HGAB 5GSUC 2NZDC 5B32D 5GT0A 5CPKC 1P3LC 3AZLA 3MGSB 3AYWD 4YS3D 3B6FB 3C1CC 2YFWB 1M18A 4J8XB 3UTAB 3X1VC 4XZQB 3VH6T 3AZHC 5AV9D 2F8NG 1R4VA 4WU9C 5AV6C 5CP6C 2FJ7D 1BH8A 5BS7A 4J8UB 1P3MB 3A6NA 1F66D 5GT3B 4WNNB 5E5AA 5CPID 4LD9B 5B2IA 5AV8C 3KUYD 2F8NH 1AOIC 4NE5A 3KWQD 1ZLAC 5B0ZD 4ZUXD 1U35D 5KDMA 1P3IC 4H9NA 3V9RB 4G91B 1P3PD 2AROC 3AZNB 3AV1C 4AWLC 1WWIA 3UT9D 3W99A 3LJAC 5AVBD 1BFMA 3WKJD 3AZGD 3REHA 5AV5D 1KX3C 1Q9CA 4WU8B 2BYMB 5BNXB 4WU8C 1S32B 3MGRD 1P3GA 2BYKA 2PYOB 3LELA 5B31G 3LZ0D 4G92C 3TU4B 3AV2A 5DNND 3REKD 4JJND 3REIC 3X1UB 3AZJA 1P3BD 4J8WC 5CPJA 1KX5D 5B40D 4Z5TA 4XUJA 5JRGC 5AVCA 3AZEC 3AZLB 5F99D 4YM6B 3B0DB 3NQJA 4YM6C 3AZKD 3NQUA 4H9SC 3WA9C 1M18B 3WAAD 5B33D 2HUEB 3REJA 3W96A 5B32C 5DNMD 4CSRB 5GXQA 3X1TD 1TZYD 1P3AA 5GSUD 2NZDD 3AYWC 4X23D 5B1LA 4KUDA 1F1EA 3RELA 5E5AB 3MGSD 5B2IB 5AV9C 3B6FD 4J8XD 3UTAD 3AFAA 5KDMB 4H9NB 3AN2B 1P3OA 4XZQD 3AN2C 1EQZB 3REHB 5CPIC 1EQZC 3KUYC 4J8UD 1P3MD 5GT3D 1P3GB 1U35C 2BYKB 3LELB 4LD9D 5G49A 3UT9C 2YFVA 2IO5C 3WKJC 1KX4A 3AZGC 1M1AA 5AV5C 3B6GB 3AZND 3AZJB 3AZIA 5CPJB 3B6GC 5B1MA 3MGRC 2CV5A 4Z5TB 5AVCB 4XUJB 4WU8D 3MGPA 3LZ0C 3NQJB 1S32D 3NQUB 2PYOD 5DNNC 1BH9A 4H9OA 3W96B 1P3BC 3TU4D 5GXQB 1KX5C 5B40C 1P3AB 2HIOB 1B6WA 5F99C 3X1UD 2RVQC 3AZKC 5B1LB 4KUDB 3WAAC 4R8PA 3AZLD 3RELB 3UTBA 4YM6D 5DNMC 3X1TC 1M18D 1TZYC 4QLCA 3AFAB 1P3OB 2AROA 3W98A 4X23B 4HGAC 4X23C 2CWEA 3MGSC 4Z66A 2F8NA 3A6ND 3B6FC 4J8XC 3UTAC 5E5AD 1H3OA 3WTPB 1HQ3B 4XZQC 5G49B 5B2ID 3MVDA 3WTPC 1HQ3C 4KGCA 2YFVB 1KX4B 2L5AA 3AN2D 1M1AB 3AZFA 1P34A 4J8UC 3AZIB 1P3MC 5B1MB 5GT3C 1EQZD 2CV5B 3REHD 4CAYB 4LD9C 3MGPB 1P3GD 3X1SA 4ZBJB 4G91C 3LELD 1ID3A 1BH9B 3B0CW 5JA4B 3AZNC 5B32G 3AV2D 3B6GD 4YS3A 3AZJD 5FUGB 5B31A 5CPJD 3AZMA 1S32C 1N1JB 4Z5TD 2PYOC 3R45A 4WV4B 4XUJD 5B2JA 3W97A 5AVCD 4R8PB 3UTBB 1P3FA 3MNNB 3TU4C 3MNNC 3O62A 4QLCB 2FJ7A 3W98B 5BT1D 5GT0B 5B24A 3X1UC 3W96D 1F66A 5GXQD 5GT0C 3AZLC 2RVQD 2HIOD 1P3AD 4Z66B 3KWQA 3B0DC 3C1BA 5B1LD 4ZUXA 5B0ZA 2F8NB 4KUDD 1M18C 4J8VA 1P3PA 2HUEC 5BO0A 3RELD 1H3OB 5AVBA 3MVDB 3LZ1A 3AFAD 1BH8B 1P3OD 3VH5W 1P34B 3A6NB 5BS7C 3A6NC 5E5AC 3KSYA 3MGQA 5AY8A 5B2IC 5B0YA 3X1SB 3REKA 4JJNA 3WTPD 1HQ3D 1ID3B 3W99B 2NQBA 4NFTA 3W99C 4H9QA 1KX4D 3REHC 1M1AD 1B67A 1M19A 3AZID 5B31B 3AZMB 5B1MD 1P3GC 2CV5D 5B33A 3R45B 5B2JB 1P3FB 3LELC 3KXBA 3MGPD 1P3KA 4H9RA 5BNVA 3AV2B 3O62B 5GSUA 3AV2C 2NZDA 5CPKA 1P3LA 3AZJC 5CPJC 1TAFA 4Z5TC 5C3IB 4XUJC 5AVCC 3C1CA 2YFWA 3X1VA 3AZHA 4J8VB 4R8PD 3REJB 5BO0B 3UTBD 4NE3A 5BT1C 3W96C 3REJC 3MNND 4WU9A 5AV6A 5CP6A 5GXQC 4Z2MG 3LZ1B 4QLCD 3VH5A 1P3AC 2HIOC 3W98D 5GT0D 5B1LC 4KUDC 5AV8A 4M6BA 1AOIA 3RELC 3MGQB 1ZLAA 4Z66D 5AY8B 1P3IA 2F8ND 4Z2MH 5B0YB 3AV1A 3B0CT 3AFAC 1P3OC 3LJAA 3MVDD 2NQBB 5CHLB 4E44A 1KX3A 4H9QB 4WU8A 5BNXA 1P34D 1M19B 3WTPE 3B0BA 3KXBB 3TU4A 1P3KB 4H9RB 5BNVB 3REIA 1KX4C 3X1SD 4J8WA 1M1AC 1ID3D 3X1UA 5CPKB 1P3LB 3W99D 5JRGA 3AZEA 3AZIC 1TAFB 4DRAA 5B1MC 2CV5C 4YM6A 3WA9A 4H9SA 3C1CB 3MGPC 3AZMD 5B31D 4KHAA 3X1VB 3AZHB 5B2JD 1P3FD 5B32A 1JFIA 4H9OB 4ZBJC 3W97D 4WU9B 4CSRA 5AV6B 4WZSB 5CP6B 3O62D 3AYWA 3VH5T 5B24D 5AV8B 5AV9A 4R8PC 1AOIB 3UTBC 1ZLAB 1WWSA 1P3IB 3C1BD 2AROB 3AN2A 4J8VD 4QLCC 3AV1B 4AWLB 3REJD 3W98C 3LJAB 2JSSA 5CPIA 1EQZA 1KX3B 3LZ1D 3KUYA 3B6GA 4UUZA 4H9PA 4Z66C 1U35A 1KU5A 4G92B 3UT9A 3VH6W 3MGQD 3WKJA 4KGCB 5AY8D 3MVDC 3AZGA 4KGCC 5AV5A 5B0YD 3REIB 3AZFB 4J8WB
chains in the Genus database with same CATH superfamily
3MGRA 3AZFC 1P34C 2NQBD 5JRGB 3AZEB 3LZ0A 3WA9B 1M19D 5DNNA 4KHAB 3X1SC 1P3BA 5B32B 1JFIB 1ID3C 1KX5A 5B40A 3KXBD 1ULYA 1P3KD 5F99A 1HTAA 3AYWB 2HIOA 2Y2JA 4YS3B 3AZKA 5CPKD 1P3LD 4YS3C 3WAAA 3AZMC 5B31C 2LY8A 3W97B 3IP4C 2BG1A 5B2JC 5AV9B 5DNMA 1P3FC 3W97C 3X1TA 3C1CD 2G5HC 3EPLA 1TZYA 3X1VD 2Y2IA 3O62C 2FJ7B 3AZHD 5B24B 4X23A 2FJ7C 1F66B 5B24C 4WU9D 5AV6D 1F66C 5CP6D 5CPIB 3MGSA 3KUYB 5C3IC 3B6FA 4UUZB 3KWQB 3C1BB 4H9PB 4ZUXB 5B0ZB 4J8XA 3UTAA 3KWQC 1U35B 3C1BC 5B0ZC 4ZUXC 4XZQA 1P3PB 5AV8D 3VH6A 4J8VC 3WTPA 1HQ3A 2ZY4A 3UT9B 1P3PC 1AOID 2IO5B 5AVBB 1ZLAD 3WKJB 1A7WA 5AVBC 3AZGB 1P3ID 5AV5B 2AROD 3LZ1C 3AV1D 4J8UA 1P3MA 3LJAD 4WNNA 5GT3A 3MGRB 4EO5B 4UPKA 4EO5C 1KX3D 4LD9A 4CAYA 3LZ0B 3MGQC 5AY8C 3V9RA 5DNNB 3REKB 5B0YC 4JJNB 3REKC 4E45A 3AZNA 4JJNC 1P3BB 5JA4A 4KGCD 1KX5B 5B40B 2NQBC 3REID 5F99B 3A1IA 3AZFD 2BYMA 4J8WD 3AZKB 1S32A 5FUGA 2F8NK 2PYOA 3WAAB 1M19C 1N1JA 5JRGD 3AZED 5B33B 5B33C 2XD1A 5DNMB 3WA9D 3X1TB 3MNNA 3KXBC 4DRBA 1TZYB 1P3KC 5GSUB 4NE6A 2NZDB 4HGAB 5GSUC 2NZDC 1Z2CB 5B32D 5GT0A 5CPKC 1P3LC 3AZLA 2DF4C 3MGSB 3AYWD 4YS3D 3B6FB 3C1CC 2YFWB 1M18A 4J8XB 3UTAB 3X1VC 4XZQB 3VH6T 3AZHC 5AV9D 2F8NG 1R4VA 2ZY3A 4WU9C 5AV6C 5CP6C 2FJ7D 1BH8A 5BS7A 4J8UB 1P3MB 3A6NA 1F66D 5GT3B 4WNNB 5E5AA 5CPID 2W8SA 3EPKA 4LD9B 5B2IA 5AV8C 3KUYD 2F8NH 1AOIC 4NE5A 3KWQD 1ZLAC 5B0ZD 4ZUXD 1U35D 5KDMA 1P3IC 4H9NA 3V9RB 2VQRA 4G91B 1P3PD 2AROC 2ZM5A 3AZNB 3AV1C 4AWLC 1WWIA 3UT9D 3W99A 3LJAC 5AVBD 1BFMA 3WKJD 3AZGD 3REHA 2G5IC 5AV5D 1Q9CA 1KX3C 4WU8B 2BYMB 5BNXB 4WU8C 1S32B 3MGRD 1P3GA 2BYKA 2PYOB 3LELA 5B31G 3LZ0D 4G92C 3TU4B 2JCHA 3AV2A 5DNND 3REKD 4JJND 3REIC 3X1UB 3AZJA 1P3BD 4J8WC 5CPJA 1KX5D 5B40D 4Z5TA 2Y2HA 4XUJA 2Y2GA 5JRGC 5AVCA 3AZEC 3AZLB 5F99D 4YM6B 3B0DB 3NQJA 4YM6C 3AZKD 3NQUA 4H9SC 3WA9C 1M18B 3WAAD 5B33D 2HUEB 3REJA 3W96A 5B32C 5DNMD 4CSRB 5GXQA 3X1TD 1TZYD 1P3AA 5GSUD 2NZDD 3AYWC 4X23D 5B1LA 4KUDA 1F1EA 3RELA 5E5AB 3MGSD 2RIQA 5B2IB 5AV9C 3B6FD 4J8XD 3UTAD 3AFAA 5KDMB 4H9NB 3AN2B 1P3OA 4XZQD 2Y2LA 3AN2C 1EQZB 3REHB 5CPIC 1EQZC 3KUYC 4J8UD 1P3MD 5GT3D 1P3GB 1U35C 2BYKB 3EG5B 4WJ3C 3LELB 4LD9D 5G49A 3UT9C 2YFVA 2IO5C 3WKJC 1KX4A 3AZGC 1M1AA 5AV5C 3B6GB 3AZND 3AZJB 3FDDA 3AZIA 5CPJB 3B6GC 5B1MA 3MGRC 2CV5A 4Z5TB 5AVCB 4XUJB 4WU8D 3MGPA 3LZ0C 3NQJB 3EPJA 1S32D 3NQUB 2PYOD 4DQYB 3F6TA 5DNNC 1BH9A 4H9OA 3W96B 1P3BC 3TU4D 5GXQB 1KX5C 5B40C 1P3AB 2HIOB 1B6WA 5F99C 3X1UD 2RVQC 3AZKC 5B1LB 4KUDB 3WAAC 4R8PA 3AZLD 3RELB 3UTBA 4YM6D 5DNMC 2Y2NA 3X1TC 1M18D 1TZYC 4QLCA 3AFAB 1P3OB 2AROA 3W98A 4X23B 4HGAC 4X23C 2CWEA 3MGSC 1W2EA 4Z66A 2F2AC 2F8NA 3A6ND 3B6FC 4J8XC 3UTAC 5E5AD 1H3OA 3WTPB 1HQ3B 4XZQC 5G49B 5B2ID 3MVDA 3WTPC 1HQ3C 4KGCA 2YFVB 1KX4B 2L5AA 3AN2D 1M1AB 3AZFA 1P34A 4J8UC 3AZIB 1P3MC 5B1MB 5GT3C 1EQZD 2CV5B 3REHD 4CAYB 2Y2PA 4LD9C 3MGPB 2J8PA 1P3GD 3X1SA 4ZBJB 4G91C 3LELD 1ID3A 1BH9B 3B0CW 5JA4B 1PZRA 3AZNC 5B32G 3AV2D 3B6GD 4YS3A 3AZJD 5FUGB 5B31A 5CPJD 3AZMA 1S32C 1N1JB 2ZY2A 4Z5TD 2PYOC 3R45A 4WV4B 4XUJD 5B2JA 3W97A 5AVCD 4R8PB 3UTBB 1P3FA 2JE5A 3MNNB 3TU4C 3MNNC 3O62A 4QLCB 2FJ7A 3W98B 5BT1D 5GT0B 5B24A 3X1UC 3W96D 1F66A 5GXQD 5GT0C 3AZLC 2RVQD 2HIOD 1P3AD 4Z66B 3KWQA 3B0DC 3C1BA 5B1LD 4ZUXA 5B0ZA 2F8NB 4KUDD 1M18C 4J8VA 1P3PA 2HUEC 5BO0A 3RELD 1H3OB 3AL0C 5AVBA 3MVDB 3LZ1A 3AFAD 1BH8B 1P3OD 3VH5W 1P34B 3A6NB 5BS7C 3A6NC 5E5AC 3KSYA 3MGQA 5AY8A 5B2IC 5B0YA 3X1SB 3REKA 4JJNA 3WTPD 1HQ3D 1ID3B 3W99B 2NQBA 4NFTA 3W99C 3H0LC 4H9QA 1KX4D 3REHC 1M1AD 1B67A 1M19A 3AZID 5B31B 3AZMB 5B1MD 1P3GC 2CV5D 5B33A 3R45B 5B2JB 1P3FB 3EPHA 3LELC 3KXBA 2UWXA 2Y2QA 3MGPD 1P3KA 4H9RA 5BNVA 3AV2B 3O62B 5GSUA 3AV2C 2NZDA 5CPKA 1T3UA 1P3LA 3AZJC 5CPJC 1TAFA 4Z5TC 5C3IB 4XUJC 5AVCC 3KFUG 3C1CA 2YFWA 3X1VA 3AZHA 4J8VB 4R8PD 3REJB 5BO0B 3UTBD 4NE3A 5BT1C 3W96C 3REJC 3MNND 4WU9A 5AV6A 5CP6A 5GXQC 4Z2MG 3LZ1B 4QLCD 3VH5A 1P3AC 2HIOC 3W98D 5GT0D 5B1LC 2Y2OA 4KUDC 5AV8A 2DQNC 4M6BA 1AOIA 3RELC 3MGQB 1ZLAA 4Z66D 5AY8B 1P3IA 3P5JB 2F8ND 2Y2KA 4Z2MH 5B0YB 3AV1A 3B0CT 3AFAC 1P3OC 3LJAA 3MVDD 2NQBB 5CHLB 4E44A 1KX3A 4H9QB 4WU8A 5BNXA 1P34D 1M19B 3WTPE 3B0BA 3KXBB 3TU4A 1P3KB 4H9RB 5BNVB 3REIA 1KX4C 3X1SD 4J8WA 1M1AC 1ID3D 3X1UA 5CPKB 1P3LB 3W99D 5JRGA 3AZEA 3AZIC 1TAFB 4DRAA 5B1MC 2CV5C 4YM6A 3WA9A 4H9SA 3C1CB 3MGPC 3AZMD 5B31D 4KHAA 3X1VB 3AZHB 5B2JD 1P3FD 5B32A 1JFIA 4H9OB 4ZBJC 3W97D 4WU9B 4CSRA 5AV6B 4WZSB 5CP6B 3O62D 3AYWA 3VH5T 3H0MC 5B24D 5AV8B 5AV9A 4R8PC 1AOIB 3UTBC 1ZLAB 1WWSA 1P3IB 3C1BD 2AROB 3AN2A 4J8VD 4QLCC 2XD5A 4AWLB 3REJD 3AV1B 3W98C 3LJAB 2JSSA 3AZFB 5CPIA 1EQZA 1KX3B 3LZ1D 3KUYA 3B6GA 4UUZA 3H0RC 4H9PA 4Z66C 1U35A 1KU5A 4G92B 3UT9A 3VH6W 3A1KA 3MGQD 3WKJA 4KGCB 5AY8D 2Y2MA 3MVDC 3AZGA 4KGCC 5AV5A 2ZY5A 5B0YD 3REIB 2FFFB 4J8WB
chains in the Genus database with same CATH topology
3MGRA 3AZFC 1P34C 2NQBD 5JRGB 3AZEB 3LZ0A 3WA9B 1M19D 5DNNA 4KHAB 3X1SC 1P3BA 5B32B 1JFIB 1ID3C 1KX5A 5B40A 3KXBD 1ULYA 1P3KD 5F99A 1HTAA 3AYWB 2HIOA 2Y2JA 4YS3B 3AZKA 5CPKD 1P3LD 4YS3C 3WAAA 3AZMC 5B31C 2LY8A 3W97B 3IP4C 2BG1A 5B2JC 5AV9B 5DNMA 1P3FC 3W97C 3X1TA 3C1CD 2G5HC 3EPLA 1TZYA 3X1VD 2Y2IA 3O62C 2FJ7B 3AZHD 5B24B 4X23A 2FJ7C 1F66B 5B24C 4WU9D 5AV6D 1F66C 5CP6D 5CPIB 3MGSA 3KUYB 5C3IC 3B6FA 4UUZB 3KWQB 3C1BB 4H9PB 4ZUXB 5B0ZB 4J8XA 3UTAA 3KWQC 1U35B 3C1BC 5B0ZC 4ZUXC 4XZQA 1P3PB 5AV8D 3VH6A 4J8VC 3WTPA 1HQ3A 2ZY4A 3UT9B 1P3PC 1AOID 2IO5B 5AVBB 1ZLAD 3WKJB 1A7WA 5AVBC 3AZGB 1P3ID 5AV5B 2AROD 3LZ1C 3AV1D 4J8UA 1P3MA 3LJAD 4WNNA 5GT3A 3MGRB 4EO5B 4UPKA 4EO5C 1KX3D 4LD9A 4CAYA 3LZ0B 3MGQC 5AY8C 3V9RA 5DNNB 3REKB 5B0YC 4JJNB 3REKC 4E45A 3AZNA 4JJNC 1P3BB 5JA4A 4KGCD 1KX5B 5B40B 2NQBC 3REID 5F99B 3A1IA 3AZFD 2BYMA 4J8WD 3AZKB 1S32A 5FUGA 2F8NK 2PYOA 3WAAB 1M19C 1N1JA 5JRGD 3AZED 5B33B 5B33C 2XD1A 5DNMB 3WA9D 3X1TB 3MNNA 3KXBC 4DRBA 1TZYB 1P3KC 5GSUB 4NE6A 2NZDB 4HGAB 5GSUC 2NZDC 1Z2CB 5B32D 5GT0A 5CPKC 1P3LC 3AZLA 2DF4C 3MGSB 3AYWD 4YS3D 3B6FB 3C1CC 2YFWB 1M18A 4J8XB 3UTAB 3X1VC 4XZQB 3VH6T 3AZHC 5AV9D 2F8NG 1R4VA 2ZY3A 4WU9C 5AV6C 5CP6C 2FJ7D 1BH8A 5BS7A 4J8UB 1P3MB 3A6NA 1F66D 5GT3B 4WNNB 5E5AA 5CPID 2W8SA 3EPKA 4LD9B 5B2IA 5AV8C 3KUYD 2F8NH 1AOIC 4NE5A 3KWQD 1ZLAC 5B0ZD 4ZUXD 1U35D 5KDMA 1P3IC 4H9NA 3V9RB 2VQRA 4G91B 1P3PD 2AROC 2ZM5A 3AZNB 3AV1C 4AWLC 1WWIA 3UT9D 3W99A 3LJAC 5AVBD 1BFMA 3WKJD 3AZGD 3REHA 2G5IC 5AV5D 1Q9CA 1KX3C 4WU8B 2BYMB 5BNXB 4WU8C 1S32B 3MGRD 1P3GA 2BYKA 2PYOB 3LELA 5B31G 3LZ0D 4G92C 3TU4B 2JCHA 3AV2A 5DNND 3REKD 4JJND 3REIC 3X1UB 3AZJA 1P3BD 4J8WC 5CPJA 1KX5D 5B40D 4Z5TA 2Y2HA 4XUJA 2Y2GA 5JRGC 5AVCA 3AZEC 3AZLB 5F99D 4YM6B 3B0DB 3NQJA 4YM6C 3AZKD 3NQUA 4H9SC 3WA9C 1M18B 3WAAD 5B33D 2HUEB 3REJA 3W96A 5B32C 5DNMD 4CSRB 5GXQA 3X1TD 1TZYD 1P3AA 5GSUD 2NZDD 3AYWC 4X23D 5B1LA 4KUDA 1F1EA 3RELA 5E5AB 3MGSD 2RIQA 5B2IB 5AV9C 3B6FD 4J8XD 3UTAD 3AFAA 5KDMB 4H9NB 3AN2B 1P3OA 4XZQD 2Y2LA 3AN2C 1EQZB 3REHB 5CPIC 1EQZC 3KUYC 4J8UD 1P3MD 5GT3D 1P3GB 1U35C 2BYKB 3EG5B 4WJ3C 3LELB 4LD9D 5G49A 3UT9C 2YFVA 2IO5C 3WKJC 1KX4A 3AZGC 1M1AA 5AV5C 3B6GB 3AZND 3AZJB 3FDDA 3AZIA 5CPJB 3B6GC 5B1MA 3MGRC 2CV5A 4Z5TB 5AVCB 4XUJB 4WU8D 3MGPA 3LZ0C 3NQJB 3EPJA 1S32D 3NQUB 2PYOD 4DQYB 3F6TA 5DNNC 1BH9A 4H9OA 3W96B 1P3BC 3TU4D 5GXQB 1KX5C 5B40C 1P3AB 2HIOB 1B6WA 5F99C 3X1UD 2RVQC 3AZKC 5B1LB 4KUDB 3WAAC 4R8PA 3AZLD 3RELB 3UTBA 4YM6D 5DNMC 2Y2NA 3X1TC 1M18D 1TZYC 4QLCA 3AFAB 1P3OB 2AROA 3W98A 4X23B 4HGAC 4X23C 2CWEA 3MGSC 1W2EA 4Z66A 2F2AC 2F8NA 3A6ND 3B6FC 4J8XC 3UTAC 5E5AD 1H3OA 3WTPB 1HQ3B 4XZQC 5G49B 5B2ID 3MVDA 3WTPC 1HQ3C 4KGCA 2YFVB 1KX4B 2L5AA 3AN2D 1M1AB 3AZFA 1P34A 4J8UC 3AZIB 1P3MC 5B1MB 5GT3C 1EQZD 2CV5B 3REHD 4CAYB 2Y2PA 4LD9C 3MGPB 2J8PA 1P3GD 3X1SA 4ZBJB 4G91C 3LELD 1ID3A 1BH9B 3B0CW 5JA4B 1PZRA 3AZNC 5B32G 3AV2D 3B6GD 4YS3A 3AZJD 5FUGB 5B31A 5CPJD 3AZMA 1S32C 1N1JB 2ZY2A 4Z5TD 2PYOC 3R45A 4WV4B 4XUJD 5B2JA 3W97A 5AVCD 4R8PB 3UTBB 1P3FA 2JE5A 3MNNB 3TU4C 3MNNC 3O62A 4QLCB 2FJ7A 3W98B 5BT1D 5GT0B 5B24A 3X1UC 3W96D 1F66A 5GXQD 5GT0C 3AZLC 2RVQD 2HIOD 1P3AD 4Z66B 3KWQA 3B0DC 3C1BA 5B1LD 4ZUXA 5B0ZA 2F8NB 4KUDD 1M18C 4J8VA 1P3PA 2HUEC 5BO0A 3RELD 1H3OB 3AL0C 5AVBA 3MVDB 3LZ1A 3AFAD 1BH8B 1P3OD 3VH5W 1P34B 3A6NB 5BS7C 3A6NC 5E5AC 3KSYA 3MGQA 5AY8A 5B2IC 5B0YA 3X1SB 3REKA 4JJNA 3WTPD 1HQ3D 1ID3B 3W99B 2NQBA 4NFTA 3W99C 3H0LC 4H9QA 1KX4D 3REHC 1M1AD 1B67A 1M19A 3AZID 5B31B 3AZMB 5B1MD 1P3GC 2CV5D 5B33A 3R45B 5B2JB 1P3FB 3EPHA 3LELC 3KXBA 2UWXA 2Y2QA 3MGPD 1P3KA 4H9RA 5BNVA 3AV2B 3O62B 5GSUA 3AV2C 2NZDA 5CPKA 1T3UA 1P3LA 3AZJC 5CPJC 1TAFA 4Z5TC 5C3IB 4XUJC 5AVCC 3KFUG 3C1CA 2YFWA 3X1VA 3AZHA 4J8VB 4R8PD 3REJB 5BO0B 3UTBD 4NE3A 5BT1C 3W96C 3REJC 3MNND 4WU9A 5AV6A 5CP6A 5GXQC 4Z2MG 3LZ1B 4QLCD 3VH5A 1P3AC 2HIOC 3W98D 5GT0D 5B1LC 2Y2OA 4KUDC 5AV8A 2DQNC 4M6BA 1AOIA 3RELC 3MGQB 1ZLAA 4Z66D 5AY8B 1P3IA 3P5JB 2F8ND 2Y2KA 4Z2MH 5B0YB 3AV1A 3B0CT 3AFAC 1P3OC 3LJAA 3MVDD 2NQBB 5CHLB 4E44A 1KX3A 4H9QB 4WU8A 5BNXA 1P34D 1M19B 3WTPE 3B0BA 3KXBB 3TU4A 1P3KB 4H9RB 5BNVB 3REIA 1KX4C 3X1SD 4J8WA 1M1AC 1ID3D 3X1UA 5CPKB 1P3LB 3W99D 5JRGA 3AZEA 3AZIC 1TAFB 4DRAA 5B1MC 2CV5C 4YM6A 3WA9A 4H9SA 3C1CB 3MGPC 3AZMD 5B31D 4KHAA 3X1VB 3AZHB 5B2JD 1P3FD 5B32A 1JFIA 4H9OB 4ZBJC 3W97D 4WU9B 4CSRA 5AV6B 4WZSB 5CP6B 3O62D 3AYWA 3VH5T 3H0MC 5B24D 5AV8B 5AV9A 4R8PC 1AOIB 3UTBC 1ZLAB 1WWSA 1P3IB 3C1BD 2AROB 3AN2A 4J8VD 4QLCC 2XD5A 4AWLB 3REJD 3AV1B 3W98C 3LJAB 2JSSA 3AZFB 5CPIA 1EQZA 1KX3B 3LZ1D 3KUYA 3B6GA 4UUZA 3H0RC 4H9PA 4Z66C 1U35A 1KU5A 4G92B 3UT9A 3VH6W 3A1KA 3MGQD 3WKJA 4KGCB 5AY8D 2Y2MA 3MVDC 3AZGA 4KGCC 5AV5A 2ZY5A 5B0YD 3REIB 2FFFB 4J8WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR A;  3AZF C;  1P34 C;  2NQB D;  5JRG B;  3AZE B;  3LZ0 A;  3WA9 B;  1M19 D;  5DNN A;  4KHA B;  3X1S C;  1P3B A;  5B32 B;  1JFI B;  1ID3 C;  1KX5 A;  5B40 A;  3KXB D;  1ULY A;  1P3K D;  5F99 A;  1HTA A;  3AYW B;  2HIO A;  4YS3 B;  3AZK A;  5CPK D;  1P3L D;  4YS3 C;  3WAA A;  3AZM C;  5B31 C;  2LY8 A;  3W97 B;  5B2J C;  5AV9 B;  5DNM A;  1P3F C;  3W97 C;  3X1T A;  3C1C D;  1TZY A;  3X1V D;  3O62 C;  2FJ7 B;  3AZH D;  5B24 B;  4X23 A;  2FJ7 C;  1F66 B;  5B24 C;  4WU9 D;  5AV6 D;  1F66 C;  5CP6 D;  5CPI B;  3MGS A;  3KUY B;  5C3I C;  3B6F A;  4UUZ B;  3KWQ B;  3C1B B;  4H9P B;  4ZUX B;  5B0Z B;  4J8X A;  3UTA A;  3KWQ C;  1U35 B;  3C1B C;  5B0Z C;  4ZUX C;  4XZQ A;  1P3P B;  5AV8 D;  3VH6 A;  4J8V C;  3WTP A;  1HQ3 A;  1P3P C;  3UT9 B;  1AOI D;  2IO5 B;  5AVB B;  1ZLA D;  3WKJ B;  1A7W A;  5AVB C;  3AZG B;  1P3I D;  5AV5 B;  2ARO D;  3LZ1 C;  3AV1 D;  4J8U A;  1P3M A;  3LJA D;  4WNN A;  5GT3 A;  3MGR B;  4EO5 B;  4EO5 C;  1KX3 D;  4LD9 A;  4CAY A;  3LZ0 B;  3MGQ C;  5AY8 C;  3V9R A;  5DNN B;  3REK B;  5B0Y C;  4JJN B;  3REK C;  4E45 A;  3AZN A;  4JJN C;  1P3B B;  5JA4 A;  4KGC D;  1KX5 B;  5B40 B;  2NQB C;  3REI D;  5F99 B;  3AZF D;  2BYM A;  4J8W D;  3AZK B;  1S32 A;  5FUG A;  2F8N K;  2PYO A;  3WAA B;  1M19 C;  1N1J A;  5JRG D;  3AZE D;  5B33 B;  5B33 C;  5DNM B;  3WA9 D;  3X1T B;  3MNN A;  3KXB C;  4DRB A;  1TZY B;  1P3K C;  5GSU B;  4NE6 A;  2NZD B;  4HGA B;  5GSU C;  2NZD C;  5B32 D;  5GT0 A;  5CPK C;  1P3L C;  3AZL A;  3MGS B;  3AYW D;  4YS3 D;  3B6F B;  3C1C C;  2YFW B;  1M18 A;  4J8X B;  3UTA B;  3X1V C;  4XZQ B;  3VH6 T;  3AZH C;  5AV9 D;  2F8N G;  1R4V A;  4WU9 C;  5AV6 C;  5CP6 C;  2FJ7 D;  1BH8 A;  5BS7 A;  4J8U B;  1P3M B;  3A6N A;  1F66 D;  5GT3 B;  4WNN B;  5E5A A;  5CPI D;  4LD9 B;  5B2I A;  5AV8 C;  3KUY D;  2F8N H;  1AOI C;  4NE5 A;  3KWQ D;  1ZLA C;  5B0Z D;  4ZUX D;  1U35 D;  5KDM A;  1P3I C;  4H9N A;  3V9R B;  4G91 B;  1P3P D;  2ARO C;  3AZN B;  3AV1 C;  4AWL C;  1WWI A;  3UT9 D;  3W99 A;  3LJA C;  5AVB D;  1BFM A;  3WKJ D;  3AZG D;  3REH A;  5AV5 D;  1KX3 C;  1Q9C A;  4WU8 B;  2BYM B;  5BNX B;  4WU8 C;  1S32 B;  3MGR D;  1P3G A;  2BYK A;  2PYO B;  3LEL A;  5B31 G;  3LZ0 D;  4G92 C;  3TU4 B;  3AV2 A;  5DNN D;  3REK D;  4JJN D;  3REI C;  3X1U B;  3AZJ A;  1P3B D;  4J8W C;  5CPJ A;  1KX5 D;  5B40 D;  4Z5T A;  4XUJ A;  5JRG C;  5AVC A;  3AZE C;  3AZL B;  5F99 D;  4YM6 B;  3B0D B;  3NQJ A;  4YM6 C;  3AZK D;  3NQU A;  4H9S C;  3WA9 C;  1M18 B;  3WAA D;  5B33 D;  2HUE B;  3REJ A;  3W96 A;  5B32 C;  5DNM D;  4CSR B;  5GXQ A;  3X1T D;  1TZY D;  1P3A A;  5GSU D;  2NZD D;  3AYW C;  4X23 D;  5B1L A;  4KUD A;  1F1E A;  3REL A;  5E5A B;  3MGS D;  5B2I B;  5AV9 C;  3B6F D;  4J8X D;  3UTA D;  3AFA A;  5KDM B;  4H9N B;  3AN2 B;  1P3O A;  4XZQ D;  3AN2 C;  1EQZ B;  3REH B;  5CPI C;  1EQZ C;  3KUY C;  4J8U D;  1P3M D;  5GT3 D;  1P3G B;  1U35 C;  2BYK B;  3LEL B;  4LD9 D;  5G49 A;  3UT9 C;  2YFV A;  2IO5 C;  3WKJ C;  1KX4 A;  3AZG C;  1M1A A;  5AV5 C;  3B6G B;  3AZN D;  3AZJ B;  3AZI A;  5CPJ B;  3B6G C;  5B1M A;  3MGR C;  2CV5 A;  4Z5T B;  5AVC B;  4XUJ B;  4WU8 D;  3MGP A;  3LZ0 C;  3NQJ B;  1S32 D;  3NQU B;  2PYO D;  5DNN C;  1BH9 A;  4H9O A;  3W96 B;  1P3B C;  3TU4 D;  5GXQ B;  1KX5 C;  5B40 C;  1P3A B;  2HIO B;  1B6W A;  5F99 C;  3X1U D;  2RVQ C;  3AZK C;  5B1L B;  4KUD B;  3WAA C;  4R8P A;  3AZL D;  3REL B;  3UTB A;  4YM6 D;  5DNM C;  3X1T C;  1M18 D;  1TZY C;  4QLC A;  3AFA B;  1P3O B;  2ARO A;  3W98 A;  4X23 B;  4HGA C;  4X23 C;  2CWE A;  3MGS C;  4Z66 A;  2F8N A;  3A6N D;  3B6F C;  4J8X C;  3UTA C;  5E5A D;  1H3O A;  3WTP B;  1HQ3 B;  4XZQ C;  5G49 B;  5B2I D;  3MVD A;  3WTP C;  1HQ3 C;  4KGC A;  2YFV B;  1KX4 B;  2L5A A;  3AN2 D;  1M1A B;  3AZF A;  1P34 A;  4J8U C;  3AZI B;  1P3M C;  5B1M B;  5GT3 C;  1EQZ D;  2CV5 B;  3REH D;  4CAY B;  4LD9 C;  3MGP B;  1P3G D;  3X1S A;  4ZBJ B;  4G91 C;  3LEL D;  1ID3 A;  1BH9 B;  3B0C W;  5JA4 B;  3AZN C;  5B32 G;  3AV2 D;  3B6G D;  4YS3 A;  3AZJ D;  5FUG B;  5B31 A;  5CPJ D;  3AZM A;  1S32 C;  1N1J B;  4Z5T D;  2PYO C;  3R45 A;  4WV4 B;  4XUJ D;  5B2J A;  3W97 A;  5AVC D;  4R8P B;  3UTB B;  1P3F A;  3MNN B;  3TU4 C;  3MNN C;  3O62 A;  4QLC B;  2FJ7 A;  3W98 B;  5BT1 D;  5GT0 B;  5B24 A;  3X1U C;  3W96 D;  1F66 A;  5GXQ D;  5GT0 C;  3AZL C;  2RVQ D;  2HIO D;  1P3A D;  4Z66 B;  3KWQ A;  3B0D C;  3C1B A;  5B1L D;  4ZUX A;  5B0Z A;  2F8N B;  4KUD D;  1M18 C;  4J8V A;  1P3P A;  2HUE C;  5BO0 A;  3REL D;  1H3O B;  5AVB A;  3MVD B;  3LZ1 A;  3AFA D;  1BH8 B;  1P3O D;  3VH5 W;  1P34 B;  3A6N B;  5BS7 C;  3A6N C;  5E5A C;  3KSY A;  3MGQ A;  5AY8 A;  5B2I C;  5B0Y A;  3X1S B;  3REK A;  4JJN A;  3WTP D;  1HQ3 D;  1ID3 B;  3W99 B;  2NQB A;  4NFT A;  3W99 C;  4H9Q A;  1KX4 D;  3REH C;  1M1A D;  1B67 A;  1M19 A;  3AZI D;  5B31 B;  3AZM B;  5B1M D;  1P3G C;  2CV5 D;  5B33 A;  3R45 B;  5B2J B;  1P3F B;  3LEL C;  3KXB A;  3MGP D;  1P3K A;  4H9R A;  5BNV A;  3AV2 B;  3O62 B;  5GSU A;  3AV2 C;  2NZD A;  5CPK A;  1P3L A;  3AZJ C;  5CPJ C;  1TAF A;  4Z5T C;  5C3I B;  4XUJ C;  5AVC C;  3C1C A;  2YFW A;  3X1V A;  3AZH A;  4J8V B;  4R8P D;  3REJ B;  5BO0 B;  3UTB D;  4NE3 A;  5BT1 C;  3W96 C;  3REJ C;  3MNN D;  4WU9 A;  5AV6 A;  5CP6 A;  5GXQ C;  4Z2M G;  3LZ1 B;  4QLC D;  3VH5 A;  1P3A C;  2HIO C;  3W98 D;  5GT0 D;  5B1L C;  4KUD C;  5AV8 A;  4M6B A;  1AOI A;  3REL C;  3MGQ B;  1ZLA A;  4Z66 D;  5AY8 B;  1P3I A;  2F8N D;  4Z2M H;  5B0Y B;  3AV1 A;  3B0C T;  3AFA C;  1P3O C;  3LJA A;  3MVD D;  2NQB B;  5CHL B;  4E44 A;  1KX3 A;  4H9Q B;  4WU8 A;  5BNX A;  1P34 D;  1M19 B;  3WTP E;  3B0B A;  3KXB B;  3TU4 A;  1P3K B;  4H9R B;  5BNV B;  3REI A;  1KX4 C;  3X1S D;  4J8W A;  1M1A C;  1ID3 D;  3X1U A;  5CPK B;  1P3L B;  3W99 D;  5JRG A;  3AZE A;  3AZI C;  1TAF B;  4DRA A;  5B1M C;  2CV5 C;  4YM6 A;  3WA9 A;  4H9S A;  3C1C B;  3MGP C;  3AZM D;  5B31 D;  4KHA A;  3X1V B;  3AZH B;  5B2J D;  1P3F D;  5B32 A;  1JFI A;  4H9O B;  4ZBJ C;  3W97 D;  4WU9 B;  4CSR A;  5AV6 B;  4WZS B;  5CP6 B;  3O62 D;  3AYW A;  3VH5 T;  5B24 D;  5AV8 B;  5AV9 A;  4R8P C;  1AOI B;  3UTB C;  1ZLA B;  1WWS A;  1P3I B;  3C1B D;  2ARO B;  3AN2 A;  4J8V D;  4QLC C;  3AV1 B;  4AWL B;  3REJ D;  3W98 C;  3LJA B;  2JSS A;  5CPI A;  1EQZ A;  1KX3 B;  3LZ1 D;  3KUY A;  3B6G A;  4UUZ A;  4H9P A;  4Z66 C;  1U35 A;  1KU5 A;  4G92 B;  3UT9 A;  3VH6 W;  3MGQ D;  3WKJ A;  4KGC B;  5AY8 D;  3MVD C;  3AZG A;  4KGC C;  5AV5 A;  5B0Y D;  3REI B;  3AZF B;  4J8W B; 
#chains in the Genus database with same CATH topology
 3MGR A;  3AZF C;  1P34 C;  2NQB D;  5JRG B;  3AZE B;  3LZ0 A;  3WA9 B;  1M19 D;  5DNN A;  4KHA B;  3X1S C;  1P3B A;  5B32 B;  1JFI B;  1ID3 C;  1KX5 A;  5B40 A;  3KXB D;  1ULY A;  1P3K D;  5F99 A;  1HTA A;  3AYW B;  2HIO A;  2Y2J A;  4YS3 B;  3AZK A;  5CPK D;  1P3L D;  4YS3 C;  3WAA A;  3AZM C;  5B31 C;  2LY8 A;  3W97 B;  3IP4 C;  2BG1 A;  5B2J C;  5AV9 B;  5DNM A;  1P3F C;  3W97 C;  3X1T A;  3C1C D;  2G5H C;  3EPL A;  1TZY A;  3X1V D;  2Y2I A;  3O62 C;  2FJ7 B;  3AZH D;  5B24 B;  4X23 A;  2FJ7 C;  1F66 B;  5B24 C;  4WU9 D;  5AV6 D;  1F66 C;  5CP6 D;  5CPI B;  3MGS A;  3KUY B;  5C3I C;  3B6F A;  4UUZ B;  3KWQ B;  3C1B B;  4H9P B;  4ZUX B;  5B0Z B;  4J8X A;  3UTA A;  3KWQ C;  1U35 B;  3C1B C;  5B0Z C;  4ZUX C;  4XZQ A;  1P3P B;  5AV8 D;  3VH6 A;  4J8V C;  3WTP A;  1HQ3 A;  2ZY4 A;  3UT9 B;  1P3P C;  1AOI D;  2IO5 B;  5AVB B;  1ZLA D;  3WKJ B;  1A7W A;  5AVB C;  3AZG B;  1P3I D;  5AV5 B;  2ARO D;  3LZ1 C;  3AV1 D;  4J8U A;  1P3M A;  3LJA D;  4WNN A;  5GT3 A;  3MGR B;  4EO5 B;  4UPK A;  4EO5 C;  1KX3 D;  4LD9 A;  4CAY A;  3LZ0 B;  3MGQ C;  5AY8 C;  3V9R A;  5DNN B;  3REK B;  5B0Y C;  4JJN B;  3REK C;  4E45 A;  3AZN A;  4JJN C;  1P3B B;  5JA4 A;  4KGC D;  1KX5 B;  5B40 B;  2NQB C;  3REI D;  5F99 B;  3A1I A;  3AZF D;  2BYM A;  4J8W D;  3AZK B;  1S32 A;  5FUG A;  2F8N K;  2PYO A;  3WAA B;  1M19 C;  1N1J A;  5JRG D;  3AZE D;  5B33 B;  5B33 C;  2XD1 A;  5DNM B;  3WA9 D;  3X1T B;  3MNN A;  3KXB C;  4DRB A;  1TZY B;  1P3K C;  5GSU B;  4NE6 A;  2NZD B;  4HGA B;  5GSU C;  2NZD C;  1Z2C B;  5B32 D;  5GT0 A;  5CPK C;  1P3L C;  3AZL A;  2DF4 C;  3MGS B;  3AYW D;  4YS3 D;  3B6F B;  3C1C C;  2YFW B;  1M18 A;  4J8X B;  3UTA B;  3X1V C;  4XZQ B;  3VH6 T;  3AZH C;  5AV9 D;  2F8N G;  1R4V A;  2ZY3 A;  4WU9 C;  5AV6 C;  5CP6 C;  2FJ7 D;  1BH8 A;  5BS7 A;  4J8U B;  1P3M B;  3A6N A;  1F66 D;  5GT3 B;  4WNN B;  5E5A A;  5CPI D;  2W8S A;  3EPK A;  4LD9 B;  5B2I A;  5AV8 C;  3KUY D;  2F8N H;  1AOI C;  4NE5 A;  3KWQ D;  1ZLA C;  5B0Z D;  4ZUX D;  1U35 D;  5KDM A;  1P3I C;  4H9N A;  3V9R B;  2VQR A;  4G91 B;  1P3P D;  2ARO C;  2ZM5 A;  3AZN B;  3AV1 C;  4AWL C;  1WWI A;  3UT9 D;  3W99 A;  3LJA C;  5AVB D;  1BFM A;  3WKJ D;  3AZG D;  3REH A;  2G5I C;  5AV5 D;  1Q9C A;  1KX3 C;  4WU8 B;  2BYM B;  5BNX B;  4WU8 C;  1S32 B;  3MGR D;  1P3G A;  2BYK A;  2PYO B;  3LEL A;  5B31 G;  3LZ0 D;  4G92 C;  3TU4 B;  2JCH A;  3AV2 A;  5DNN D;  3REK D;  4JJN D;  3REI C;  3X1U B;  3AZJ A;  1P3B D;  4J8W C;  5CPJ A;  1KX5 D;  5B40 D;  4Z5T A;  2Y2H A;  4XUJ A;  2Y2G A;  5JRG C;  5AVC A;  3AZE C;  3AZL B;  5F99 D;  4YM6 B;  3B0D B;  3NQJ A;  4YM6 C;  3AZK D;  3NQU A;  4H9S C;  3WA9 C;  1M18 B;  3WAA D;  5B33 D;  2HUE B;  3REJ A;  3W96 A;  5B32 C;  5DNM D;  4CSR B;  5GXQ A;  3X1T D;  1TZY D;  1P3A A;  5GSU D;  2NZD D;  3AYW C;  4X23 D;  5B1L A;  4KUD A;  1F1E A;  3REL A;  5E5A B;  3MGS D;  2RIQ A;  5B2I B;  5AV9 C;  3B6F D;  4J8X D;  3UTA D;  3AFA A;  5KDM B;  4H9N B;  3AN2 B;  1P3O A;  4XZQ D;  2Y2L A;  3AN2 C;  1EQZ B;  3REH B;  5CPI C;  1EQZ C;  3KUY C;  4J8U D;  1P3M D;  5GT3 D;  1P3G B;  1U35 C;  2BYK B;  3EG5 B;  4WJ3 C;  3LEL B;  4LD9 D;  5G49 A;  3UT9 C;  2YFV A;  2IO5 C;  3WKJ C;  1KX4 A;  3AZG C;  1M1A A;  5AV5 C;  3B6G B;  3AZN D;  3AZJ B;  3FDD A;  3AZI A;  5CPJ B;  3B6G C;  5B1M A;  3MGR C;  2CV5 A;  4Z5T B;  5AVC B;  4XUJ B;  4WU8 D;  3MGP A;  3LZ0 C;  3NQJ B;  3EPJ A;  1S32 D;  3NQU B;  2PYO D;  4DQY B;  3F6T A;  5DNN C;  1BH9 A;  4H9O A;  3W96 B;  1P3B C;  3TU4 D;  5GXQ B;  1KX5 C;  5B40 C;  1P3A B;  2HIO B;  1B6W A;  5F99 C;  3X1U D;  2RVQ C;  3AZK C;  5B1L B;  4KUD B;  3WAA C;  4R8P A;  3AZL D;  3REL B;  3UTB A;  4YM6 D;  5DNM C;  2Y2N A;  3X1T C;  1M18 D;  1TZY C;  4QLC A;  3AFA B;  1P3O B;  2ARO A;  3W98 A;  4X23 B;  4HGA C;  4X23 C;  2CWE A;  3MGS C;  1W2E A;  4Z66 A;  2F2A C;  2F8N A;  3A6N D;  3B6F C;  4J8X C;  3UTA C;  5E5A D;  1H3O A;  3WTP B;  1HQ3 B;  4XZQ C;  5G49 B;  5B2I D;  3MVD A;  3WTP C;  1HQ3 C;  4KGC A;  2YFV B;  1KX4 B;  2L5A A;  3AN2 D;  1M1A B;  3AZF A;  1P34 A;  4J8U C;  3AZI B;  1P3M C;  5B1M B;  5GT3 C;  1EQZ D;  2CV5 B;  3REH D;  4CAY B;  2Y2P A;  4LD9 C;  3MGP B;  2J8P A;  1P3G D;  3X1S A;  4ZBJ B;  4G91 C;  3LEL D;  1ID3 A;  1BH9 B;  3B0C W;  5JA4 B;  1PZR A;  3AZN C;  5B32 G;  3AV2 D;  3B6G D;  4YS3 A;  3AZJ D;  5FUG B;  5B31 A;  5CPJ D;  3AZM A;  1S32 C;  1N1J B;  2ZY2 A;  4Z5T D;  2PYO C;  3R45 A;  4WV4 B;  4XUJ D;  5B2J A;  3W97 A;  5AVC D;  4R8P B;  3UTB B;  1P3F A;  2JE5 A;  3MNN B;  3TU4 C;  3MNN C;  3O62 A;  4QLC B;  2FJ7 A;  3W98 B;  5BT1 D;  5GT0 B;  5B24 A;  3X1U C;  3W96 D;  1F66 A;  5GXQ D;  5GT0 C;  3AZL C;  2RVQ D;  2HIO D;  1P3A D;  4Z66 B;  3KWQ A;  3B0D C;  3C1B A;  5B1L D;  4ZUX A;  5B0Z A;  2F8N B;  4KUD D;  1M18 C;  4J8V A;  1P3P A;  2HUE C;  5BO0 A;  3REL D;  1H3O B;  3AL0 C;  5AVB A;  3MVD B;  3LZ1 A;  3AFA D;  1BH8 B;  1P3O D;  3VH5 W;  1P34 B;  3A6N B;  5BS7 C;  3A6N C;  5E5A C;  3KSY A;  3MGQ A;  5AY8 A;  5B2I C;  5B0Y A;  3X1S B;  3REK A;  4JJN A;  3WTP D;  1HQ3 D;  1ID3 B;  3W99 B;  2NQB A;  4NFT A;  3W99 C;  3H0L C;  4H9Q A;  1KX4 D;  3REH C;  1M1A D;  1B67 A;  1M19 A;  3AZI D;  5B31 B;  3AZM B;  5B1M D;  1P3G C;  2CV5 D;  5B33 A;  3R45 B;  5B2J B;  1P3F B;  3EPH A;  3LEL C;  3KXB A;  2UWX A;  2Y2Q A;  3MGP D;  1P3K A;  4H9R A;  5BNV A;  3AV2 B;  3O62 B;  5GSU A;  3AV2 C;  2NZD A;  5CPK A;  1T3U A;  1P3L A;  3AZJ C;  5CPJ C;  1TAF A;  4Z5T C;  5C3I B;  4XUJ C;  5AVC C;  3KFU G;  3C1C A;  2YFW A;  3X1V A;  3AZH A;  4J8V B;  4R8P D;  3REJ B;  5BO0 B;  3UTB D;  4NE3 A;  5BT1 C;  3W96 C;  3REJ C;  3MNN D;  4WU9 A;  5AV6 A;  5CP6 A;  5GXQ C;  4Z2M G;  3LZ1 B;  4QLC D;  3VH5 A;  1P3A C;  2HIO C;  3W98 D;  5GT0 D;  5B1L C;  2Y2O A;  4KUD C;  5AV8 A;  2DQN C;  4M6B A;  1AOI A;  3REL C;  3MGQ B;  1ZLA A;  4Z66 D;  5AY8 B;  1P3I A;  3P5J B;  2F8N D;  2Y2K A;  4Z2M H;  5B0Y B;  3AV1 A;  3B0C T;  3AFA C;  1P3O C;  3LJA A;  3MVD D;  2NQB B;  5CHL B;  4E44 A;  1KX3 A;  4H9Q B;  4WU8 A;  5BNX A;  1P34 D;  1M19 B;  3WTP E;  3B0B A;  3KXB B;  3TU4 A;  1P3K B;  4H9R B;  5BNV B;  3REI A;  1KX4 C;  3X1S D;  4J8W A;  1M1A C;  1ID3 D;  3X1U A;  5CPK B;  1P3L B;  3W99 D;  5JRG A;  3AZE A;  3AZI C;  1TAF B;  4DRA A;  5B1M C;  2CV5 C;  4YM6 A;  3WA9 A;  4H9S A;  3C1C B;  3MGP C;  3AZM D;  5B31 D;  4KHA A;  3X1V B;  3AZH B;  5B2J D;  1P3F D;  5B32 A;  1JFI A;  4H9O B;  4ZBJ C;  3W97 D;  4WU9 B;  4CSR A;  5AV6 B;  4WZS B;  5CP6 B;  3O62 D;  3AYW A;  3VH5 T;  3H0M C;  5B24 D;  5AV8 B;  5AV9 A;  4R8P C;  1AOI B;  3UTB C;  1ZLA B;  1WWS A;  1P3I B;  3C1B D;  2ARO B;  3AN2 A;  4J8V D;  4QLC C;  2XD5 A;  4AWL B;  3REJ D;  3AV1 B;  3W98 C;  3LJA B;  2JSS A;  3AZF B;  5CPI A;  1EQZ A;  1KX3 B;  3LZ1 D;  3KUY A;  3B6G A;  4UUZ A;  3H0R C;  4H9P A;  4Z66 C;  1U35 A;  1KU5 A;  4G92 B;  3UT9 A;  3VH6 W;  3A1K A;  3MGQ D;  3WKJ A;  4KGC B;  5AY8 D;  2Y2M A;  3MVD C;  3AZG A;  4KGC C;  5AV5 A;  2ZY5 A;  5B0Y D;  3REI B;  2FFF B;  4J8W B; 
#chains in the Genus database with same CATH homology
 3MGR A;  3AZF C;  1P34 C;  2NQB D;  5JRG B;  3AZE B;  3LZ0 A;  3WA9 B;  1M19 D;  5DNN A;  4KHA B;  3X1S C;  1P3B A;  5B32 B;  1JFI B;  1ID3 C;  1KX5 A;  5B40 A;  3KXB D;  1ULY A;  1P3K D;  5F99 A;  1HTA A;  3AYW B;  2HIO A;  2Y2J A;  4YS3 B;  3AZK A;  5CPK D;  1P3L D;  4YS3 C;  3WAA A;  3AZM C;  5B31 C;  2LY8 A;  3W97 B;  3IP4 C;  2BG1 A;  5B2J C;  5AV9 B;  5DNM A;  1P3F C;  3W97 C;  3X1T A;  3C1C D;  2G5H C;  3EPL A;  1TZY A;  3X1V D;  2Y2I A;  3O62 C;  2FJ7 B;  3AZH D;  5B24 B;  4X23 A;  2FJ7 C;  1F66 B;  5B24 C;  4WU9 D;  5AV6 D;  1F66 C;  5CP6 D;  5CPI B;  3MGS A;  3KUY B;  5C3I C;  3B6F A;  4UUZ B;  3KWQ B;  3C1B B;  4H9P B;  4ZUX B;  5B0Z B;  4J8X A;  3UTA A;  3KWQ C;  1U35 B;  3C1B C;  5B0Z C;  4ZUX C;  4XZQ A;  1P3P B;  5AV8 D;  3VH6 A;  4J8V C;  3WTP A;  1HQ3 A;  2ZY4 A;  3UT9 B;  1P3P C;  1AOI D;  2IO5 B;  5AVB B;  1ZLA D;  3WKJ B;  1A7W A;  5AVB C;  3AZG B;  1P3I D;  5AV5 B;  2ARO D;  3LZ1 C;  3AV1 D;  4J8U A;  1P3M A;  3LJA D;  4WNN A;  5GT3 A;  3MGR B;  4EO5 B;  4UPK A;  4EO5 C;  1KX3 D;  4LD9 A;  4CAY A;  3LZ0 B;  3MGQ C;  5AY8 C;  3V9R A;  5DNN B;  3REK B;  5B0Y C;  4JJN B;  3REK C;  4E45 A;  3AZN A;  4JJN C;  1P3B B;  5JA4 A;  4KGC D;  1KX5 B;  5B40 B;  2NQB C;  3REI D;  5F99 B;  3A1I A;  3AZF D;  2BYM A;  4J8W D;  3AZK B;  1S32 A;  5FUG A;  2F8N K;  2PYO A;  3WAA B;  1M19 C;  1N1J A;  5JRG D;  3AZE D;  5B33 B;  5B33 C;  2XD1 A;  5DNM B;  3WA9 D;  3X1T B;  3MNN A;  3KXB C;  4DRB A;  1TZY B;  1P3K C;  5GSU B;  4NE6 A;  2NZD B;  4HGA B;  5GSU C;  2NZD C;  1Z2C B;  5B32 D;  5GT0 A;  5CPK C;  1P3L C;  3AZL A;  2DF4 C;  3MGS B;  3AYW D;  4YS3 D;  3B6F B;  3C1C C;  2YFW B;  1M18 A;  4J8X B;  3UTA B;  3X1V C;  4XZQ B;  3VH6 T;  3AZH C;  5AV9 D;  2F8N G;  1R4V A;  2ZY3 A;  4WU9 C;  5AV6 C;  5CP6 C;  2FJ7 D;  1BH8 A;  5BS7 A;  4J8U B;  1P3M B;  3A6N A;  1F66 D;  5GT3 B;  4WNN B;  5E5A A;  5CPI D;  2W8S A;  3EPK A;  4LD9 B;  5B2I A;  5AV8 C;  3KUY D;  2F8N H;  1AOI C;  4NE5 A;  3KWQ D;  1ZLA C;  5B0Z D;  4ZUX D;  1U35 D;  5KDM A;  1P3I C;  4H9N A;  3V9R B;  2VQR A;  4G91 B;  1P3P D;  2ARO C;  2ZM5 A;  3AZN B;  3AV1 C;  4AWL C;  1WWI A;  3UT9 D;  3W99 A;  3LJA C;  5AVB D;  1BFM A;  3WKJ D;  3AZG D;  3REH A;  2G5I C;  5AV5 D;  1Q9C A;  1KX3 C;  4WU8 B;  2BYM B;  5BNX B;  4WU8 C;  1S32 B;  3MGR D;  1P3G A;  2BYK A;  2PYO B;  3LEL A;  5B31 G;  3LZ0 D;  4G92 C;  3TU4 B;  2JCH A;  3AV2 A;  5DNN D;  3REK D;  4JJN D;  3REI C;  3X1U B;  3AZJ A;  1P3B D;  4J8W C;  5CPJ A;  1KX5 D;  5B40 D;  4Z5T A;  2Y2H A;  4XUJ A;  2Y2G A;  5JRG C;  5AVC A;  3AZE C;  3AZL B;  5F99 D;  4YM6 B;  3B0D B;  3NQJ A;  4YM6 C;  3AZK D;  3NQU A;  4H9S C;  3WA9 C;  1M18 B;  3WAA D;  5B33 D;  2HUE B;  3REJ A;  3W96 A;  5B32 C;  5DNM D;  4CSR B;  5GXQ A;  3X1T D;  1TZY D;  1P3A A;  5GSU D;  2NZD D;  3AYW C;  4X23 D;  5B1L A;  4KUD A;  1F1E A;  3REL A;  5E5A B;  3MGS D;  2RIQ A;  5B2I B;  5AV9 C;  3B6F D;  4J8X D;  3UTA D;  3AFA A;  5KDM B;  4H9N B;  3AN2 B;  1P3O A;  4XZQ D;  2Y2L A;  3AN2 C;  1EQZ B;  3REH B;  5CPI C;  1EQZ C;  3KUY C;  4J8U D;  1P3M D;  5GT3 D;  1P3G B;  1U35 C;  2BYK B;  3EG5 B;  4WJ3 C;  3LEL B;  4LD9 D;  5G49 A;  3UT9 C;  2YFV A;  2IO5 C;  3WKJ C;  1KX4 A;  3AZG C;  1M1A A;  5AV5 C;  3B6G B;  3AZN D;  3AZJ B;  3FDD A;  3AZI A;  5CPJ B;  3B6G C;  5B1M A;  3MGR C;  2CV5 A;  4Z5T B;  5AVC B;  4XUJ B;  4WU8 D;  3MGP A;  3LZ0 C;  3NQJ B;  3EPJ A;  1S32 D;  3NQU B;  2PYO D;  4DQY B;  3F6T A;  5DNN C;  1BH9 A;  4H9O A;  3W96 B;  1P3B C;  3TU4 D;  5GXQ B;  1KX5 C;  5B40 C;  1P3A B;  2HIO B;  1B6W A;  5F99 C;  3X1U D;  2RVQ C;  3AZK C;  5B1L B;  4KUD B;  3WAA C;  4R8P A;  3AZL D;  3REL B;  3UTB A;  4YM6 D;  5DNM C;  2Y2N A;  3X1T C;  1M18 D;  1TZY C;  4QLC A;  3AFA B;  1P3O B;  2ARO A;  3W98 A;  4X23 B;  4HGA C;  4X23 C;  2CWE A;  3MGS C;  1W2E A;  4Z66 A;  2F2A C;  2F8N A;  3A6N D;  3B6F C;  4J8X C;  3UTA C;  5E5A D;  1H3O A;  3WTP B;  1HQ3 B;  4XZQ C;  5G49 B;  5B2I D;  3MVD A;  3WTP C;  1HQ3 C;  4KGC A;  2YFV B;  1KX4 B;  2L5A A;  3AN2 D;  1M1A B;  3AZF A;  1P34 A;  4J8U C;  3AZI B;  1P3M C;  5B1M B;  5GT3 C;  1EQZ D;  2CV5 B;  3REH D;  4CAY B;  2Y2P A;  4LD9 C;  3MGP B;  2J8P A;  1P3G D;  3X1S A;  4ZBJ B;  4G91 C;  3LEL D;  1ID3 A;  1BH9 B;  3B0C W;  5JA4 B;  1PZR A;  3AZN C;  5B32 G;  3AV2 D;  3B6G D;  4YS3 A;  3AZJ D;  5FUG B;  5B31 A;  5CPJ D;  3AZM A;  1S32 C;  1N1J B;  2ZY2 A;  4Z5T D;  2PYO C;  3R45 A;  4WV4 B;  4XUJ D;  5B2J A;  3W97 A;  5AVC D;  4R8P B;  3UTB B;  1P3F A;  2JE5 A;  3MNN B;  3TU4 C;  3MNN C;  3O62 A;  4QLC B;  2FJ7 A;  3W98 B;  5BT1 D;  5GT0 B;  5B24 A;  3X1U C;  3W96 D;  1F66 A;  5GXQ D;  5GT0 C;  3AZL C;  2RVQ D;  2HIO D;  1P3A D;  4Z66 B;  3KWQ A;  3B0D C;  3C1B A;  5B1L D;  4ZUX A;  5B0Z A;  2F8N B;  4KUD D;  1M18 C;  4J8V A;  1P3P A;  2HUE C;  5BO0 A;  3REL D;  1H3O B;  3AL0 C;  5AVB A;  3MVD B;  3LZ1 A;  3AFA D;  1BH8 B;  1P3O D;  3VH5 W;  1P34 B;  3A6N B;  5BS7 C;  3A6N C;  5E5A C;  3KSY A;  3MGQ A;  5AY8 A;  5B2I C;  5B0Y A;  3X1S B;  3REK A;  4JJN A;  3WTP D;  1HQ3 D;  1ID3 B;  3W99 B;  2NQB A;  4NFT A;  3W99 C;  3H0L C;  4H9Q A;  1KX4 D;  3REH C;  1M1A D;  1B67 A;  1M19 A;  3AZI D;  5B31 B;  3AZM B;  5B1M D;  1P3G C;  2CV5 D;  5B33 A;  3R45 B;  5B2J B;  1P3F B;  3EPH A;  3LEL C;  3KXB A;  2UWX A;  2Y2Q A;  3MGP D;  1P3K A;  4H9R A;  5BNV A;  3AV2 B;  3O62 B;  5GSU A;  3AV2 C;  2NZD A;  5CPK A;  1T3U A;  1P3L A;  3AZJ C;  5CPJ C;  1TAF A;  4Z5T C;  5C3I B;  4XUJ C;  5AVC C;  3KFU G;  3C1C A;  2YFW A;  3X1V A;  3AZH A;  4J8V B;  4R8P D;  3REJ B;  5BO0 B;  3UTB D;  4NE3 A;  5BT1 C;  3W96 C;  3REJ C;  3MNN D;  4WU9 A;  5AV6 A;  5CP6 A;  5GXQ C;  4Z2M G;  3LZ1 B;  4QLC D;  3VH5 A;  1P3A C;  2HIO C;  3W98 D;  5GT0 D;  5B1L C;  2Y2O A;  4KUD C;  5AV8 A;  2DQN C;  4M6B A;  1AOI A;  3REL C;  3MGQ B;  1ZLA A;  4Z66 D;  5AY8 B;  1P3I A;  3P5J B;  2F8N D;  2Y2K A;  4Z2M H;  5B0Y B;  3AV1 A;  3B0C T;  3AFA C;  1P3O C;  3LJA A;  3MVD D;  2NQB B;  5CHL B;  4E44 A;  1KX3 A;  4H9Q B;  4WU8 A;  5BNX A;  1P34 D;  1M19 B;  3WTP E;  3B0B A;  3KXB B;  3TU4 A;  1P3K B;  4H9R B;  5BNV B;  3REI A;  1KX4 C;  3X1S D;  4J8W A;  1M1A C;  1ID3 D;  3X1U A;  5CPK B;  1P3L B;  3W99 D;  5JRG A;  3AZE A;  3AZI C;  1TAF B;  4DRA A;  5B1M C;  2CV5 C;  4YM6 A;  3WA9 A;  4H9S A;  3C1C B;  3MGP C;  3AZM D;  5B31 D;  4KHA A;  3X1V B;  3AZH B;  5B2J D;  1P3F D;  5B32 A;  1JFI A;  4H9O B;  4ZBJ C;  3W97 D;  4WU9 B;  4CSR A;  5AV6 B;  4WZS B;  5CP6 B;  3O62 D;  3AYW A;  3VH5 T;  3H0M C;  5B24 D;  5AV8 B;  5AV9 A;  4R8P C;  1AOI B;  3UTB C;  1ZLA B;  1WWS A;  1P3I B;  3C1B D;  2ARO B;  3AN2 A;  4J8V D;  4QLC C;  2XD5 A;  4AWL B;  3REJ D;  3AV1 B;  3W98 C;  3LJA B;  2JSS A;  3AZF B;  5CPI A;  1EQZ A;  1KX3 B;  3LZ1 D;  3KUY A;  3B6G A;  4UUZ A;  3H0R C;  4H9P A;  4Z66 C;  1U35 A;  1KU5 A;  4G92 B;  3UT9 A;  3VH6 W;  3A1K A;  3MGQ D;  3WKJ A;  4KGC B;  5AY8 D;  2Y2M A;  3MVD C;  3AZG A;  4KGC C;  5AV5 A;  2ZY5 A;  5B0Y D;  3REI B;  2FFF B;  4J8W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...