2NZDC

Nucleosome core particle containing 145 bp of dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdC00
5B1LD 3AZKB 1AOIA 4Z5TB 1KX5A 1TZYD 3WTPA 3UTAB 3WKJB 3AZEB 1AOIC 3MGRD 1KX5C 3MNNB 4XZQA 3WTPC 3LJAA 5CPIC 1WWSA 4XZQC 3LJAB 3LJAC 3REJA 5GXQB 5GT0D 3UTBA 1M1AD 1P3LD 3B6FA 3NQJA 5B1MB 3REJC 1P3OA 4KUDD 5B1LA 3UTBB 3UTBC 1JFIB 3B6FB 5B0YA 3W97D 2BYMA 2BYKA 3MVDB 5BS7A 3AZID 1P3OC 5B1LC 4QLCD 5B0YC 3X1UD 2BYMB 5BS7C 5AV9D 4XUJD 5AV6A 3AZMD 5E5AB 4LD9A 5B32G 5AV6C 5G49B 4X23B 2HIOB 3REHA 4LD9C 4KUDA 1F66B 3AN2D 3NQUA 3REHC 4KUDC 3B6GB 5DNNA 3R45A 4QLCA 3VH6A 3X1UA 1P3PA 3NQUB 5DNMD 1ZLAA 3AZNA 5DNNC 3X1VD 1BH8B 4XUJA 4QLCC 1P34A 3X1UC 1P3PC 5JRGA 5B31B 1S32B 3AZLD 1P3BB 1ZLAC 3AZNB 1P34C 4XUJC 1KX4B 3UT9D 3A6ND 5JRGC 4Z66B 4WU9D 4CAYA 1U35A 3LZ1A 4G92B 3LELA 4G92C 4HGAB 4J8XB 1U35C 1U35B 3LZ1C 3LELB 3LELC 3MGPA 4G91C 3X1SD 4H9OB 4NE5A 4J8UB 3WA9B 3MGPC 5B33B 1ID3D 2NQBD 1M18A 3X1VC 3AFAD 4YM6D 4WU9A 3W98B 5B2ID 4H9QA 1M18C 5AY8A 2PYOD 3W99D 5AVBD 4WU9C 5AY8C 4WNNA 1M19D 1EQZB 2HUEB 5B24D 5B0ZB 3WAAD 1P3MA 2NZDD 4AWLC 3RELD 3KXBD 1P3GB 3X1SC 4ZBJC 1HQ3D 1P3MB 1P3MC 5AV8A 5GT3D 1P3AB 3LZ0A 4YM6A 1P3KB 3AV1B 5CPKA 5CP6A 5B2JB 5AV8C 3C1CD 3LZ0C 4YM6C 5JA4B 3MGSA 3TU4D 5CPKC 5CP6C 3W96B 4JJNA 5BNVB 2CWEA 3AZFD 3MGSC 3KUYB 4WU8A 4J8VA 4R8PD 4JJNC 1B67A 1P3FA 2CV5B 4J8VC 4WU8C 4H9NB 4EO5C 4EO5B 3AZHA 1P3FB 4WV4B 1P3FC 3AV2D 2FJ7D 5GSUB 3REKB 3REID 2AROD 5AVCA 3AZGD 5AV5A 1HQ3C 4ZUXA 3AZHB 3AZHC 3C1BB 5AVCC 4CSRA 3AZKD 5AV5C 2JSSA 5AV5B 4Z5TD 4ZUXC 4UUZA 1H3OA 5FUGB 3MGQA 3UTAD 3AZED 1KX3A 2F8ND 3B0DC 4R8PA 3VH5T 4UUZB 3V9RB 3MNND 1H3OB 3MGQB 3MGQC 1KX3C 1AOIB 4R8PC 5CPIA 1KX5B 3WTPB 2FJ7A 4YS3A 4H9SA 3KWQA 5BT1D 5CPIB 2YFWA 4XZQB 5B32A 2FJ7C 4YS3C 4H9SC 5B1MD 4KGCD 4NE6A 4H9PA 3KWQC 3KWQB 2YFVA 3AYWA 5CPJA 5B32C 3REJB 3MVDD 2F8NA 5B40D 5BO0A 3NQJB 2YFVB 3AYWB 1TZYA 3AYWC 5CPJC 1P3OB 5B1LB 5BO0B 5B0YB 1P3ID 3MGRA 1TZYC 2BYKB 5E5AD 3MGRB 3MGRC 3X1TD 4X23D 5GT0A 1M1AA 1P3LA 1F66D 5AV6B 4H9RA 4LD9B 5GT0C 1M1AB 1M1AC 1P3LC 3B6GD 3W97A 2F8NG 4M6BA 3AZIA 3REHB 4KUDB 1KU5A 3W97C 5B31D 3AZIC 1P3BD 2F8NH 5DNNB 3R45B 5AV9A 4QLCB 1BFMA 3X1UB 4J8WD 1P3PB 1KX4D 3AZMA 1Q9CA 3VH5W 4Z66D 3X1TA 1ZLAB 5AV9C 4XUJB 5AV9B 1P34B 5JRGB 3AZMC 3X1TC 3AN2A 4J8XD 5KDMA 4CAYB 3AZJD 3AN2C 3LZ1B 4J8UD 5KDMB 1R4VA 5DNMA 3WA9D 4G91B 5B33D 3X1VA 3MGPB 5DNMC 3AZLA 3W98D 3X1VB 3UT9A 3A6NA 3AZLC 1M18B 5CHLB 3UT9C 3A6NC 3KSYA 4WU9B 4DRBA 1EQZD 5B0ZD 4H9QB 2RVQD 5AY8B 4NE3A 3X1SA 1P3GD 3AZJC 4AWLB 3O62D 4WNNB 1P3AD 1P3KD 5C3IB 5C3IC 4ZBJB 3X1SB 3AV1D 1ID3A 2NQBA 5B2JD 3AFAA 2IO5C 1ID3C 5B2IA 1ID3B 3W96D 2NQBC 5AV8B 3AFAC 2PYOA 3LZ0B 4YM6B 5CPKB 5CP6B 5AVBA 3W99A 5B2IC 5F99D 2CV5D 2PYOC 3MGSB 1M19A 3W99C 5AVBC 3W99B 5B24A 4JJNB 3WAAA 2NZDA 3RELA 4WU8B 3KXBA 4J8VB 4Z2MG 1M19C 1HQ3A 5B24C 1HTAA 3WAAC 4NFTA 1TAFA 5GT3A 2NZDC 3O62C 3RELB 3RELC 3KXBC 1HQ3B 5BNXA 4Z2MH 3C1CA 1ULYA 5GT3C 5AVCB 3TU4A 4ZUXB 5BNXB 3C1CC 3WKJD 3AZFA 3B0DB 3TU4C 4CSRB 3VH6T 1AOID 4KHAA 1KX5D 5F99C 3WTPD 3AZFC 2LY8A 1KX3B 4E45A 4R8PB 3AV2A 1B6WA 4XZQD 3LJAD 3REIA 2AROA 5GXQD 3AZGA 1N1JA 3AV2C 4YS3B 2FJ7B 3REJD 3REIC 2AROC 3UTBD 3AZGC 3AZKA 3B6FD 2YFWB 4Z5TA 5B32B 1N1JB 3UTAA 3WKJA 3AZEA 1P3OD 3AZKC 4H9PB 5B0YD 4Z5TC 5CPJB 3MNNA 3UTAC 3WKJC 3AZEC 2F8NB 1TZYB 3MNNC 1F1EA 5GXQA 5AV6D 5B1MA 2HIOD 4KGCA 4LD9D 5GXQC 1JFIA 5BT1C 5B1MC 3MVDA 5GT0B 3REHD 4KGCB 4KGCC 1P3LB 5B40A 3B0BA 3B6FC 4H9RB 3MVDC 4WZSB 5B40B 5DNND 5B40C 1P3IA 1WWIA 3W97B 1P3PD 3AZIB 3B0CT 1S32D 5E5AA 1ZLAD 3AZND 2L5AA 1P34D 1P3IC 1P3IB 3VH6W 5JRGD 5G49A 4X23A 2HIOA 5E5AC 1F66A 3AZMB 3X1TB 4X23C 2HIOC 1F66C 3B6GA 1U35D 3LZ1D 3LELD 3AN2B 3B6GC 1BH8A 3VH5A 3MGPD 5B31A 3WTPE 1S32A 1P3BA 4J8WA 1KX4A 5DNMB 5B31C 4Z66A 1S32C 1P3BC 3AZNC 1M18D 4J8WB 4J8WC 1KX4C 3AZLB 4Z66C 4J8XA 3UT9B 3A6NB 5AY8D 3AZJA 4H9OA 4HGAC 4J8XC 4J8UA 4E44A 3WA9A 5B33A 3AZJB 1P3MD 5B31G 4J8UC 3WA9C 3W98A 5B33C 2IO5B 5AV8D 3LZ0D 5CPKD 5CP6D 3W98C 2NQBB 3B0CW 3AFAB 3MGSD 3KUYD 1EQZA 5B2IB 5B0ZA 4JJND 2PYOB 5AVBB 4J8VD 4WU8D 1EQZC 1P3GA 2HUEC 5B0ZC 1P3FD 2RVQC 5GSUD 3O62A 3REKD 1P3AA 1P3KA 1M19B 3AV1A 5B24B 1P3GC 3WAAB 5B2JA 3AZHD 2NZDB 4DRAA 3O62B 3C1BD 3KXBB 1P3AC 5JA4A 5AVCD 3AV1C 1P3KC 3W96A 5AV5D 5B2JC 4ZUXD 1TAFB 5GT3B 5BNVA 1BH9A 3KUYA 3W96C 5F99A 3C1CB 2CV5A 3MGQD 1BH9B 3TU4B 1KX3D 3KUYC 4H9NA 1A7WA 5F99B 3AZFB 2CV5C 5GSUA 3REKA 4KHAB 5CPID 4YS3D 2F8NK 5GSUC 3REKC 3C1BA 3KWQD 3AV2B 5B32D 3REIB 5FUGA 2AROB 3C1BC 3AZGB 3AYWD 5CPJD 3V9RA
chains in the Genus database with same CATH superfamily
5B1LD 3AZKB 1AOIA 2Y2LA 4Z5TB 1KX5A 1TZYD 3WTPA 3UTAB 3WKJB 3AZEB 1AOIC 3MGRD 1KX5C 3MNNB 4XZQA 3WTPC 3LJAA 5CPIC 1WWSA 4XZQC 3LJAB 3LJAC 3REJA 5GXQB 2ZY2A 5GT0D 3UTBA 1M1AD 1P3LD 3B6FA 3NQJA 2VQRA 5B1MB 3REJC 1P3OA 4KUDD 5B1LA 3UTBB 3UTBC 1JFIB 3B6FB 5B0YA 3H0RC 3W97D 2BYMA 2BYKA 3MVDB 5BS7A 3AZID 1P3OC 5B1LC 4QLCD 5B0YC 3X1UD 2BYMB 5BS7C 5AV9D 4XUJD 5AV6A 3AZMD 5E5AB 4LD9A 5B32G 5AV6C 5G49B 4X23B 2HIOB 3REHA 4LD9C 4KUDA 1F66B 3AN2D 3NQUA 2G5HC 3REHC 4KUDC 3B6GB 5DNNA 3R45A 4QLCA 3VH6A 3X1UA 3IP4C 1P3PA 3NQUB 5DNMD 1ZLAA 3AZNA 5DNNC 3X1VD 1BH8B 4XUJA 4QLCC 1P34A 3X1UC 1P3PC 5JRGA 5B31B 1S32B 3AZLD 1P3BB 1ZLAC 3AZNB 1P34C 4XUJC 1KX4B 3UT9D 3A6ND 5JRGC 4Z66B 4WU9D 4CAYA 1U35A 3LZ1A 4G92B 3LELA 4G92C 3H0LC 4HGAB 4J8XB 1U35C 1U35B 3LZ1C 3LELB 3LELC 3MGPA 4G91C 3X1SD 4H9OB 4NE5A 4J8UB 2ZM5A 3WA9B 3MGPC 5B33B 2Y2NA 1ID3D 2NQBD 1M18A 3X1VC 3AFAD 4YM6D 4WU9A 3W98B 5B2ID 4H9QA 1M18C 5AY8A 2PYOD 3W99D 5AVBD 4WU9C 5AY8C 4WNNA 1M19D 1EQZB 2HUEB 5B24D 5B0ZB 3WAAD 1P3MA 2ZY3A 2NZDD 4AWLC 3RELD 3KXBD 1P3GB 3X1SC 4ZBJC 1HQ3D 3KFUG 1P3MB 1P3MC 5AV8A 4DQYB 5GT3D 1P3AB 3LZ0A 4YM6A 1PZRA 1W2EA 3AV1B 5CPKA 5CP6A 1P3KB 5B2JB 5AV8C 3C1CD 3LZ0C 4YM6C 5JA4B 3MGSA 3TU4D 5CPKC 5CP6C 3W96B 4JJNA 5BNVB 2CWEA 3AZFD 3MGSC 3KUYB 4WU8A 4J8VA 4R8PD 4JJNC 1B67A 1P3FA 4UPKA 2CV5B 4J8VC 4WU8C 4H9NB 4EO5C 4EO5B 3AZHA 1P3FB 4WV4B 1P3FC 3AV2D 2FJ7D 5GSUB 3REKB 3REID 2AROD 5AVCA 3AZGD 5AV5A 1HQ3C 4ZUXA 3AZHB 3AZHC 3C1BB 5AVCC 4CSRA 3AZKD 5AV5C 2JSSA 5AV5B 4Z5TD 4ZUXC 4UUZA 1H3OA 5FUGB 3MGQA 3UTAD 3AZED 1KX3A 2F8ND 3B0DC 2ZY4A 4R8PA 3VH5T 4UUZB 3V9RB 3MNND 1H3OB 3MGQB 3MGQC 1KX3C 1AOIB 4R8PC 5CPIA 1KX5B 2JCHA 3WTPB 4YS3A 4H9SA 2FJ7A 1Z2CB 3KWQA 5BT1D 5CPIB 2YFWA 4XZQB 5B32A 2FJ7C 4YS3C 4H9SC 5B1MD 4KGCD 4NE6A 4H9PA 3KWQC 3KWQB 2YFVA 3AYWA 5CPJA 5B32C 3REJB 3MVDD 2F8NA 5B40D 5BO0A 3NQJB 2YFVB 3AYWB 1TZYA 3AYWC 5CPJC 1P3OB 5B1LB 5BO0B 5B0YB 1P3ID 3MGRA 1TZYC 2BYKB 5E5AD 3MGRB 3MGRC 3X1TD 4X23D 5GT0A 1M1AA 1P3LA 1F66D 5AV6B 2UWXA 3AL0C 4H9RA 4LD9B 5GT0C 1M1AB 1M1AC 1P3LC 3B6GD 3W97A 2F8NG 4M6BA 3AZIA 3REHB 4KUDB 1KU5A 3W97C 5B31D 3AZIC 1P3BD 2F8NH 5DNNB 3R45B 5AV9A 4QLCB 1BFMA 3X1UB 4J8WD 1P3PB 1KX4D 3AZMA 3FDDA 1Q9CA 2Y2KA 3VH5W 4Z66D 3X1TA 1ZLAB 5AV9C 4XUJB 5AV9B 1P34B 5JRGB 3AZMC 2Y2JA 3X1TC 3AN2A 4J8XD 5KDMA 4CAYB 3AZJD 3AN2C 3LZ1B 4J8UD 5KDMB 1R4VA 5DNMA 3WA9D 4G91B 5B33D 3X1VA 3MGPB 5DNMC 2XD1A 3AZLA 3W98D 3X1VB 3UT9A 3A6NA 3AZLC 1M18B 5CHLB 3UT9C 3A6NC 3KSYA 4WU9B 4DRBA 1EQZD 3EPJA 2Y2GA 4H9QB 5B0ZD 2RVQD 5AY8B 4NE3A 3X1SA 1P3GD 3AZJC 4AWLB 3O62D 4WNNB 1P3AD 1P3KD 5C3IB 5C3IC 4ZBJB 3X1SB 3AV1D 1ID3A 2NQBA 5B2JD 3AFAA 2IO5C 1ID3C 5B2IA 1ID3B 3W96D 2NQBC 5AV8B 3AFAC 2PYOA 3LZ0B 4YM6B 5CPKB 5CP6B 5AVBA 3W99A 2Y2OA 5B2IC 5F99D 2CV5D 2PYOC 3MGSB 1M19A 3W99C 5AVBC 3W99B 5B24A 4JJNB 3WAAA 2NZDA 3RELA 4WU8B 3KXBA 4J8VB 4Z2MG 1M19C 1HQ3A 5B24C 1HTAA 3F6TA 3WAAC 4NFTA 1TAFA 5GT3A 2NZDC 2BG1A 3O62C 3RELB 3RELC 3KXBC 1HQ3B 5BNXA 4WJ3C 4Z2MH 3C1CA 1ULYA 5GT3C 5AVCB 3TU4A 4ZUXB 5BNXB 3C1CC 3WKJD 3AZFA 3B0DB 3TU4C 4CSRB 3VH6T 1AOID 4KHAA 1KX5D 5F99C 3WTPD 3AZFC 2LY8A 1KX3B 4E45A 4R8PB 3AV2A 1B6WA 4XZQD 3H0MC 3LJAD 3REIA 2AROA 5GXQD 3AZGA 3EG5B 2F2AC 1N1JA 3AV2C 4YS3B 2FJ7B 3REJD 3REIC 2AROC 3UTBD 3AZGC 3AZKA 3B6FD 2YFWB 4Z5TA 5B32B 1N1JB 3UTAA 3WKJA 3AZEA 1P3OD 3AZKC 4H9PB 5B0YD 4Z5TC 5CPJB 3MNNA 3UTAC 3WKJC 3AZEC 2F8NB 3P5JB 1TZYB 3MNNC 1F1EA 5GXQA 3EPHA 2G5IC 5AV6D 2Y2MA 5B1MA 2HIOD 4KGCA 4LD9D 5GXQC 1JFIA 5BT1C 5B1MC 3MVDA 5GT0B 3REHD 4KGCB 4KGCC 1P3LB 5B40A 3B0BA 3B6FC 1T3UA 4H9RB 3MVDC 2W8SA 4WZSB 5B40B 5DNND 2RIQA 5B40C 1P3IA 1WWIA 3W97B 1P3PD 3A1KA 3AZIB 2ZY5A 3B0CT 3EPKA 2DF4C 1S32D 5E5AA 1ZLAD 3AZND 2L5AA 1P34D 2XD5A 1P3IC 1P3IB 3VH6W 5JRGD 5G49A 4X23A 2HIOA 5E5AC 1F66A 3AZMB 3X1TB 4X23C 2HIOC 1F66C 3B6GA 1U35D 3LZ1D 3LELD 3AN2B 3B6GC 1BH8A 2JE5A 3VH5A 3MGPD 5B31A 3WTPE 1S32A 1P3BA 2Y2IA 4J8WA 1KX4A 5DNMB 5B31C 4Z66A 1S32C 1P3BC 3AZNC 1M18D 4J8WB 4J8WC 1KX4C 3AZLB 4Z66C 4J8XA 3UT9B 3A6NB 5AY8D 3AZJA 4H9OA 4HGAC 4J8XC 4J8UA 4E44A 3WA9A 5B33A 3AZJB 1P3MD 3EPLA 5B31G 4J8UC 3WA9C 3W98A 5B33C 2FFFB 2IO5B 5AV8D 3LZ0D 5CPKD 5CP6D 3W98C 2NQBB 3B0CW 3AFAB 3MGSD 3KUYD 1EQZA 5B2IB 5B0ZA 4JJND 2PYOB 5AVBB 4J8VD 4WU8D 1EQZC 2J8PA 1P3GA 2HUEC 5B0ZC 1P3FD 2RVQC 2Y2PA 5GSUD 3O62A 3REKD 1P3AA 1P3KA 1M19B 3AV1A 5B24B 1P3GC 3WAAB 5B2JA 3AZHD 2NZDB 4DRAA 2Y2QA 3O62B 3C1BD 3KXBB 1P3AC 5JA4A 5AVCD 3AV1C 1P3KC 3W96A 5AV5D 5B2JC 4ZUXD 1TAFB 5GT3B 5BNVA 1BH9A 3KUYA 3W96C 3A1IA 5F99A 3C1CB 2CV5A 3MGQD 1BH9B 3TU4B 1KX3D 3KUYC 4H9NA 1A7WA 5F99B 3AZFB 2CV5C 5GSUA 3REKA 4KHAB 5CPID 4YS3D 2F8NK 5GSUC 3REKC 3C1BA 3KWQD 3AV2B 5B32D 2DQNC 3REIB 5FUGA 2AROB 3C1BC 3AZGB 3AYWD 5CPJD 3V9RA 2Y2HA
chains in the Genus database with same CATH topology
5B1LD 3AZKB 1AOIA 2Y2LA 4Z5TB 1KX5A 1TZYD 3WTPA 3UTAB 3WKJB 3AZEB 1AOIC 3MGRD 1KX5C 3MNNB 4XZQA 3WTPC 3LJAA 5CPIC 1WWSA 4XZQC 3LJAB 3LJAC 3REJA 5GXQB 2ZY2A 5GT0D 3UTBA 1M1AD 1P3LD 3B6FA 3NQJA 2VQRA 5B1MB 3REJC 1P3OA 4KUDD 5B1LA 3UTBB 3UTBC 1JFIB 3B6FB 5B0YA 3H0RC 3W97D 2BYMA 2BYKA 3MVDB 5BS7A 3AZID 1P3OC 5B1LC 4QLCD 5B0YC 3X1UD 2BYMB 5BS7C 5AV9D 4XUJD 5AV6A 3AZMD 5E5AB 4LD9A 5B32G 5AV6C 5G49B 4X23B 2HIOB 3REHA 4LD9C 4KUDA 1F66B 3AN2D 3NQUA 2G5HC 3REHC 4KUDC 3B6GB 5DNNA 3R45A 4QLCA 3VH6A 3X1UA 3IP4C 1P3PA 3NQUB 5DNMD 1ZLAA 3AZNA 5DNNC 3X1VD 1BH8B 4XUJA 4QLCC 1P34A 3X1UC 1P3PC 5JRGA 5B31B 1S32B 3AZLD 1P3BB 1ZLAC 3AZNB 1P34C 4XUJC 1KX4B 3UT9D 3A6ND 5JRGC 4Z66B 4WU9D 4CAYA 1U35A 3LZ1A 4G92B 3LELA 4G92C 3H0LC 4HGAB 4J8XB 1U35C 1U35B 3LZ1C 3LELB 3LELC 3MGPA 4G91C 3X1SD 4H9OB 4NE5A 4J8UB 2ZM5A 3WA9B 3MGPC 5B33B 2Y2NA 1ID3D 2NQBD 1M18A 3X1VC 3AFAD 4YM6D 4WU9A 3W98B 5B2ID 4H9QA 1M18C 5AY8A 2PYOD 3W99D 5AVBD 4WU9C 5AY8C 4WNNA 1M19D 1EQZB 2HUEB 5B24D 5B0ZB 3WAAD 1P3MA 2ZY3A 2NZDD 4AWLC 3RELD 3KXBD 1P3GB 3X1SC 4ZBJC 1HQ3D 3KFUG 1P3MB 1P3MC 5AV8A 4DQYB 5GT3D 1P3AB 3LZ0A 4YM6A 1PZRA 1W2EA 3AV1B 5CPKA 5CP6A 1P3KB 5B2JB 5AV8C 3C1CD 3LZ0C 4YM6C 5JA4B 3MGSA 3TU4D 5CPKC 5CP6C 3W96B 4JJNA 5BNVB 2CWEA 3AZFD 3MGSC 3KUYB 4WU8A 4J8VA 4R8PD 4JJNC 1B67A 1P3FA 4UPKA 2CV5B 4J8VC 4WU8C 4H9NB 4EO5C 4EO5B 3AZHA 1P3FB 4WV4B 1P3FC 3AV2D 2FJ7D 5GSUB 3REKB 3REID 2AROD 5AVCA 3AZGD 5AV5A 1HQ3C 4ZUXA 3AZHB 3AZHC 3C1BB 5AVCC 4CSRA 3AZKD 5AV5C 2JSSA 5AV5B 4Z5TD 4ZUXC 4UUZA 1H3OA 5FUGB 3MGQA 3UTAD 3AZED 1KX3A 2F8ND 3B0DC 2ZY4A 4R8PA 3VH5T 4UUZB 3V9RB 3MNND 1H3OB 3MGQB 3MGQC 1KX3C 1AOIB 4R8PC 5CPIA 1KX5B 2JCHA 3WTPB 4YS3A 4H9SA 2FJ7A 1Z2CB 3KWQA 5BT1D 5CPIB 2YFWA 4XZQB 5B32A 2FJ7C 4YS3C 4H9SC 5B1MD 4KGCD 4NE6A 4H9PA 3KWQC 3KWQB 2YFVA 3AYWA 5CPJA 5B32C 3REJB 3MVDD 2F8NA 5B40D 5BO0A 3NQJB 2YFVB 3AYWB 1TZYA 3AYWC 5CPJC 1P3OB 5B1LB 5BO0B 5B0YB 1P3ID 3MGRA 1TZYC 2BYKB 5E5AD 3MGRB 3MGRC 3X1TD 4X23D 5GT0A 1M1AA 1P3LA 1F66D 5AV6B 2UWXA 3AL0C 4H9RA 4LD9B 5GT0C 1M1AB 1M1AC 1P3LC 3B6GD 3W97A 2F8NG 4M6BA 3AZIA 3REHB 4KUDB 1KU5A 3W97C 5B31D 3AZIC 1P3BD 2F8NH 5DNNB 3R45B 5AV9A 4QLCB 1BFMA 3X1UB 4J8WD 1P3PB 1KX4D 3AZMA 3FDDA 1Q9CA 2Y2KA 3VH5W 4Z66D 3X1TA 1ZLAB 5AV9C 4XUJB 5AV9B 1P34B 5JRGB 3AZMC 2Y2JA 3X1TC 3AN2A 4J8XD 5KDMA 4CAYB 3AZJD 3AN2C 3LZ1B 4J8UD 5KDMB 1R4VA 5DNMA 3WA9D 4G91B 5B33D 3X1VA 3MGPB 5DNMC 2XD1A 3AZLA 3W98D 3X1VB 3UT9A 3A6NA 3AZLC 1M18B 5CHLB 3UT9C 3A6NC 3KSYA 4WU9B 4DRBA 1EQZD 3EPJA 2Y2GA 4H9QB 5B0ZD 2RVQD 5AY8B 4NE3A 3X1SA 1P3GD 3AZJC 4AWLB 3O62D 4WNNB 1P3AD 1P3KD 5C3IB 5C3IC 4ZBJB 3X1SB 3AV1D 1ID3A 2NQBA 5B2JD 3AFAA 2IO5C 1ID3C 5B2IA 1ID3B 3W96D 2NQBC 5AV8B 3AFAC 2PYOA 3LZ0B 4YM6B 5CPKB 5CP6B 5AVBA 3W99A 2Y2OA 5B2IC 5F99D 2CV5D 2PYOC 3MGSB 1M19A 3W99C 5AVBC 3W99B 5B24A 4JJNB 3WAAA 2NZDA 3RELA 4WU8B 3KXBA 4J8VB 4Z2MG 1M19C 1HQ3A 5B24C 1HTAA 3F6TA 3WAAC 4NFTA 1TAFA 5GT3A 2NZDC 2BG1A 3O62C 3RELB 3RELC 3KXBC 1HQ3B 5BNXA 4WJ3C 4Z2MH 3C1CA 1ULYA 5GT3C 5AVCB 3TU4A 4ZUXB 5BNXB 3C1CC 3WKJD 3AZFA 3B0DB 3TU4C 4CSRB 3VH6T 1AOID 4KHAA 1KX5D 5F99C 3WTPD 3AZFC 2LY8A 1KX3B 4E45A 4R8PB 3AV2A 1B6WA 4XZQD 3H0MC 3LJAD 3REIA 2AROA 5GXQD 3AZGA 3EG5B 2F2AC 1N1JA 3AV2C 4YS3B 2FJ7B 3REJD 3REIC 2AROC 3UTBD 3AZGC 3AZKA 3B6FD 2YFWB 4Z5TA 5B32B 1N1JB 3UTAA 3WKJA 3AZEA 1P3OD 3AZKC 4H9PB 5B0YD 4Z5TC 5CPJB 3MNNA 3UTAC 3WKJC 3AZEC 2F8NB 3P5JB 1TZYB 3MNNC 1F1EA 5GXQA 3EPHA 2G5IC 5AV6D 2Y2MA 5B1MA 2HIOD 4KGCA 4LD9D 5GXQC 1JFIA 5BT1C 5B1MC 3MVDA 5GT0B 3REHD 4KGCB 4KGCC 1P3LB 5B40A 3B0BA 3B6FC 1T3UA 4H9RB 3MVDC 2W8SA 4WZSB 5B40B 5DNND 2RIQA 5B40C 1P3IA 1WWIA 3W97B 1P3PD 3A1KA 3AZIB 2ZY5A 3B0CT 3EPKA 2DF4C 1S32D 5E5AA 1ZLAD 3AZND 2L5AA 1P34D 2XD5A 1P3IC 1P3IB 3VH6W 5JRGD 5G49A 4X23A 2HIOA 5E5AC 1F66A 3AZMB 3X1TB 4X23C 2HIOC 1F66C 3B6GA 1U35D 3LZ1D 3LELD 3AN2B 3B6GC 1BH8A 2JE5A 3VH5A 3MGPD 5B31A 3WTPE 1S32A 1P3BA 2Y2IA 4J8WA 1KX4A 5DNMB 5B31C 4Z66A 1S32C 1P3BC 3AZNC 1M18D 4J8WB 4J8WC 1KX4C 3AZLB 4Z66C 4J8XA 3UT9B 3A6NB 5AY8D 3AZJA 4H9OA 4HGAC 4J8XC 4J8UA 4E44A 3WA9A 5B33A 3AZJB 1P3MD 3EPLA 5B31G 4J8UC 3WA9C 3W98A 5B33C 2FFFB 2IO5B 5AV8D 3LZ0D 5CPKD 5CP6D 3W98C 2NQBB 3B0CW 3AFAB 3MGSD 3KUYD 1EQZA 5B2IB 5B0ZA 4JJND 2PYOB 5AVBB 4J8VD 4WU8D 1EQZC 2J8PA 1P3GA 2HUEC 5B0ZC 1P3FD 2RVQC 2Y2PA 5GSUD 3O62A 3REKD 1P3AA 1P3KA 1M19B 3AV1A 5B24B 1P3GC 3WAAB 5B2JA 3AZHD 2NZDB 4DRAA 2Y2QA 3O62B 3C1BD 3KXBB 1P3AC 5JA4A 5AVCD 3AV1C 1P3KC 3W96A 5AV5D 5B2JC 4ZUXD 1TAFB 5GT3B 5BNVA 1BH9A 3KUYA 3W96C 3A1IA 5F99A 3C1CB 2CV5A 3MGQD 1BH9B 3TU4B 1KX3D 3KUYC 4H9NA 1A7WA 5F99B 3AZFB 2CV5C 5GSUA 3REKA 4KHAB 5CPID 4YS3D 2F8NK 5GSUC 3REKC 3C1BA 3KWQD 3AV2B 5B32D 2DQNC 3REIB 5FUGA 2AROB 3C1BC 3AZGB 3AYWD 5CPJD 3V9RA 2Y2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L D;  3AZK B;  1AOI A;  4Z5T B;  1KX5 A;  1TZY D;  3WTP A;  3UTA B;  3WKJ B;  3AZE B;  1AOI C;  3MGR D;  1KX5 C;  3MNN B;  4XZQ A;  3WTP C;  3LJA A;  5CPI C;  1WWS A;  4XZQ C;  3LJA B;  3LJA C;  3REJ A;  5GXQ B;  5GT0 D;  3UTB A;  1M1A D;  1P3L D;  3B6F A;  3NQJ A;  5B1M B;  3REJ C;  1P3O A;  4KUD D;  5B1L A;  3UTB B;  3UTB C;  1JFI B;  3B6F B;  5B0Y A;  3W97 D;  2BYM A;  2BYK A;  3MVD B;  5BS7 A;  3AZI D;  1P3O C;  5B1L C;  4QLC D;  5B0Y C;  3X1U D;  2BYM B;  5BS7 C;  5AV9 D;  4XUJ D;  5AV6 A;  3AZM D;  5E5A B;  4LD9 A;  5B32 G;  5AV6 C;  5G49 B;  4X23 B;  2HIO B;  3REH A;  4LD9 C;  4KUD A;  1F66 B;  3AN2 D;  3NQU A;  3REH C;  4KUD C;  3B6G B;  5DNN A;  3R45 A;  4QLC A;  3VH6 A;  3X1U A;  1P3P A;  3NQU B;  5DNM D;  1ZLA A;  3AZN A;  5DNN C;  3X1V D;  1BH8 B;  4XUJ A;  4QLC C;  1P34 A;  3X1U C;  1P3P C;  5JRG A;  5B31 B;  1S32 B;  3AZL D;  1P3B B;  1ZLA C;  3AZN B;  1P34 C;  4XUJ C;  1KX4 B;  3UT9 D;  3A6N D;  5JRG C;  4Z66 B;  4WU9 D;  4CAY A;  1U35 A;  3LZ1 A;  4G92 B;  3LEL A;  4G92 C;  4HGA B;  4J8X B;  1U35 C;  1U35 B;  3LZ1 C;  3LEL B;  3LEL C;  3MGP A;  4G91 C;  3X1S D;  4H9O B;  4NE5 A;  4J8U B;  3WA9 B;  3MGP C;  5B33 B;  1ID3 D;  2NQB D;  1M18 A;  3X1V C;  3AFA D;  4YM6 D;  4WU9 A;  3W98 B;  5B2I D;  4H9Q A;  1M18 C;  5AY8 A;  2PYO D;  3W99 D;  5AVB D;  4WU9 C;  5AY8 C;  4WNN A;  1M19 D;  1EQZ B;  2HUE B;  5B24 D;  5B0Z B;  3WAA D;  1P3M A;  2NZD D;  4AWL C;  3REL D;  3KXB D;  1P3G B;  3X1S C;  4ZBJ C;  1HQ3 D;  1P3M B;  1P3M C;  5AV8 A;  5GT3 D;  1P3A B;  3LZ0 A;  4YM6 A;  1P3K B;  3AV1 B;  5CPK A;  5CP6 A;  5B2J B;  5AV8 C;  3C1C D;  3LZ0 C;  4YM6 C;  5JA4 B;  3MGS A;  3TU4 D;  5CPK C;  5CP6 C;  3W96 B;  4JJN A;  5BNV B;  2CWE A;  3AZF D;  3MGS C;  3KUY B;  4WU8 A;  4J8V A;  4R8P D;  4JJN C;  1B67 A;  1P3F A;  2CV5 B;  4J8V C;  4WU8 C;  4H9N B;  4EO5 C;  4EO5 B;  3AZH A;  1P3F B;  4WV4 B;  1P3F C;  3AV2 D;  2FJ7 D;  5GSU B;  3REK B;  3REI D;  2ARO D;  5AVC A;  3AZG D;  5AV5 A;  1HQ3 C;  4ZUX A;  3AZH B;  3AZH C;  3C1B B;  5AVC C;  4CSR A;  3AZK D;  5AV5 C;  2JSS A;  5AV5 B;  4Z5T D;  4ZUX C;  4UUZ A;  1H3O A;  5FUG B;  3MGQ A;  3UTA D;  3AZE D;  1KX3 A;  2F8N D;  3B0D C;  4R8P A;  3VH5 T;  4UUZ B;  3V9R B;  3MNN D;  1H3O B;  3MGQ B;  3MGQ C;  1KX3 C;  1AOI B;  4R8P C;  5CPI A;  1KX5 B;  3WTP B;  2FJ7 A;  4YS3 A;  4H9S A;  3KWQ A;  5BT1 D;  5CPI B;  2YFW A;  4XZQ B;  5B32 A;  2FJ7 C;  4YS3 C;  4H9S C;  5B1M D;  4KGC D;  4NE6 A;  4H9P A;  3KWQ C;  3KWQ B;  2YFV A;  3AYW A;  5CPJ A;  5B32 C;  3REJ B;  3MVD D;  2F8N A;  5B40 D;  5BO0 A;  3NQJ B;  2YFV B;  3AYW B;  1TZY A;  3AYW C;  5CPJ C;  1P3O B;  5B1L B;  5BO0 B;  5B0Y B;  1P3I D;  3MGR A;  1TZY C;  2BYK B;  5E5A D;  3MGR B;  3MGR C;  3X1T D;  4X23 D;  5GT0 A;  1M1A A;  1P3L A;  1F66 D;  5AV6 B;  4H9R A;  4LD9 B;  5GT0 C;  1M1A B;  1M1A C;  1P3L C;  3B6G D;  3W97 A;  2F8N G;  4M6B A;  3AZI A;  3REH B;  4KUD B;  1KU5 A;  3W97 C;  5B31 D;  3AZI C;  1P3B D;  2F8N H;  5DNN B;  3R45 B;  5AV9 A;  4QLC B;  1BFM A;  3X1U B;  4J8W D;  1P3P B;  1KX4 D;  3AZM A;  1Q9C A;  3VH5 W;  4Z66 D;  3X1T A;  1ZLA B;  5AV9 C;  4XUJ B;  5AV9 B;  1P34 B;  5JRG B;  3AZM C;  3X1T C;  3AN2 A;  4J8X D;  5KDM A;  4CAY B;  3AZJ D;  3AN2 C;  3LZ1 B;  4J8U D;  5KDM B;  1R4V A;  5DNM A;  3WA9 D;  4G91 B;  5B33 D;  3X1V A;  3MGP B;  5DNM C;  3AZL A;  3W98 D;  3X1V B;  3UT9 A;  3A6N A;  3AZL C;  1M18 B;  5CHL B;  3UT9 C;  3A6N C;  3KSY A;  4WU9 B;  4DRB A;  1EQZ D;  5B0Z D;  4H9Q B;  2RVQ D;  5AY8 B;  4NE3 A;  3X1S A;  1P3G D;  3AZJ C;  4AWL B;  3O62 D;  4WNN B;  1P3A D;  1P3K D;  5C3I B;  5C3I C;  4ZBJ B;  3X1S B;  3AV1 D;  1ID3 A;  2NQB A;  5B2J D;  3AFA A;  2IO5 C;  1ID3 C;  5B2I A;  1ID3 B;  3W96 D;  2NQB C;  5AV8 B;  3AFA C;  2PYO A;  3LZ0 B;  4YM6 B;  5CPK B;  5CP6 B;  5AVB A;  3W99 A;  5B2I C;  5F99 D;  2CV5 D;  2PYO C;  3MGS B;  1M19 A;  3W99 C;  5AVB C;  3W99 B;  5B24 A;  4JJN B;  3WAA A;  2NZD A;  3REL A;  4WU8 B;  3KXB A;  4J8V B;  4Z2M G;  1M19 C;  1HQ3 A;  5B24 C;  1HTA A;  3WAA C;  4NFT A;  1TAF A;  5GT3 A;  2NZD C;  3O62 C;  3REL B;  3REL C;  3KXB C;  1HQ3 B;  5BNX A;  4Z2M H;  3C1C A;  1ULY A;  5GT3 C;  5AVC B;  3TU4 A;  4ZUX B;  5BNX B;  3C1C C;  3WKJ D;  3AZF A;  3B0D B;  3TU4 C;  4CSR B;  3VH6 T;  1AOI D;  4KHA A;  1KX5 D;  5F99 C;  3WTP D;  3AZF C;  2LY8 A;  1KX3 B;  4E45 A;  4R8P B;  3AV2 A;  1B6W A;  4XZQ D;  3LJA D;  3REI A;  2ARO A;  5GXQ D;  3AZG A;  1N1J A;  3AV2 C;  4YS3 B;  2FJ7 B;  3REJ D;  3REI C;  2ARO C;  3UTB D;  3AZG C;  3AZK A;  3B6F D;  2YFW B;  4Z5T A;  5B32 B;  1N1J B;  3UTA A;  3WKJ A;  3AZE A;  1P3O D;  3AZK C;  4H9P B;  5B0Y D;  4Z5T C;  5CPJ B;  3MNN A;  3UTA C;  3WKJ C;  3AZE C;  2F8N B;  1TZY B;  3MNN C;  1F1E A;  5GXQ A;  5AV6 D;  5B1M A;  2HIO D;  4KGC A;  4LD9 D;  5GXQ C;  1JFI A;  5BT1 C;  5B1M C;  3MVD A;  5GT0 B;  3REH D;  4KGC B;  4KGC C;  1P3L B;  5B40 A;  3B0B A;  3B6F C;  4H9R B;  3MVD C;  4WZS B;  5B40 B;  5DNN D;  5B40 C;  1P3I A;  1WWI A;  3W97 B;  1P3P D;  3AZI B;  3B0C T;  1S32 D;  5E5A A;  1ZLA D;  3AZN D;  2L5A A;  1P34 D;  1P3I C;  1P3I B;  3VH6 W;  5JRG D;  5G49 A;  4X23 A;  2HIO A;  5E5A C;  1F66 A;  3AZM B;  3X1T B;  4X23 C;  2HIO C;  1F66 C;  3B6G A;  1U35 D;  3LZ1 D;  3LEL D;  3AN2 B;  3B6G C;  1BH8 A;  3VH5 A;  3MGP D;  5B31 A;  3WTP E;  1S32 A;  1P3B A;  4J8W A;  1KX4 A;  5DNM B;  5B31 C;  4Z66 A;  1S32 C;  1P3B C;  3AZN C;  1M18 D;  4J8W B;  4J8W C;  1KX4 C;  3AZL B;  4Z66 C;  4J8X A;  3UT9 B;  3A6N B;  5AY8 D;  3AZJ A;  4H9O A;  4HGA C;  4J8X C;  4J8U A;  4E44 A;  3WA9 A;  5B33 A;  3AZJ B;  1P3M D;  5B31 G;  4J8U C;  3WA9 C;  3W98 A;  5B33 C;  2IO5 B;  5AV8 D;  3LZ0 D;  5CPK D;  5CP6 D;  3W98 C;  2NQB B;  3B0C W;  3AFA B;  3MGS D;  3KUY D;  1EQZ A;  5B2I B;  5B0Z A;  4JJN D;  2PYO B;  5AVB B;  4J8V D;  4WU8 D;  1EQZ C;  1P3G A;  2HUE C;  5B0Z C;  1P3F D;  2RVQ C;  5GSU D;  3O62 A;  3REK D;  1P3A A;  1P3K A;  1M19 B;  3AV1 A;  5B24 B;  1P3G C;  3WAA B;  5B2J A;  3AZH D;  2NZD B;  4DRA A;  3O62 B;  3C1B D;  3KXB B;  1P3A C;  5JA4 A;  5AVC D;  3AV1 C;  1P3K C;  3W96 A;  5AV5 D;  5B2J C;  4ZUX D;  1TAF B;  5GT3 B;  5BNV A;  1BH9 A;  3KUY A;  3W96 C;  5F99 A;  3C1C B;  2CV5 A;  3MGQ D;  1BH9 B;  3TU4 B;  1KX3 D;  3KUY C;  4H9N A;  1A7W A;  5F99 B;  3AZF B;  2CV5 C;  5GSU A;  3REK A;  4KHA B;  5CPI D;  4YS3 D;  2F8N K;  5GSU C;  3REK C;  3C1B A;  3KWQ D;  3AV2 B;  5B32 D;  3REI B;  5FUG A;  2ARO B;  3C1B C;  3AZG B;  3AYW D;  5CPJ D;  3V9R A; 
#chains in the Genus database with same CATH topology
 5B1L D;  3AZK B;  1AOI A;  2Y2L A;  4Z5T B;  1KX5 A;  1TZY D;  3WTP A;  3UTA B;  3WKJ B;  3AZE B;  1AOI C;  3MGR D;  1KX5 C;  3MNN B;  4XZQ A;  3WTP C;  3LJA A;  5CPI C;  1WWS A;  4XZQ C;  3LJA B;  3LJA C;  3REJ A;  5GXQ B;  2ZY2 A;  5GT0 D;  3UTB A;  1M1A D;  1P3L D;  3B6F A;  3NQJ A;  2VQR A;  5B1M B;  3REJ C;  1P3O A;  4KUD D;  5B1L A;  3UTB B;  3UTB C;  1JFI B;  3B6F B;  5B0Y A;  3H0R C;  3W97 D;  2BYM A;  2BYK A;  3MVD B;  5BS7 A;  3AZI D;  1P3O C;  5B1L C;  4QLC D;  5B0Y C;  3X1U D;  2BYM B;  5BS7 C;  5AV9 D;  4XUJ D;  5AV6 A;  3AZM D;  5E5A B;  4LD9 A;  5B32 G;  5AV6 C;  5G49 B;  4X23 B;  2HIO B;  3REH A;  4LD9 C;  4KUD A;  1F66 B;  3AN2 D;  3NQU A;  2G5H C;  3REH C;  4KUD C;  3B6G B;  5DNN A;  3R45 A;  4QLC A;  3VH6 A;  3X1U A;  3IP4 C;  1P3P A;  3NQU B;  5DNM D;  1ZLA A;  3AZN A;  5DNN C;  3X1V D;  1BH8 B;  4XUJ A;  4QLC C;  1P34 A;  3X1U C;  1P3P C;  5JRG A;  5B31 B;  1S32 B;  3AZL D;  1P3B B;  1ZLA C;  3AZN B;  1P34 C;  4XUJ C;  1KX4 B;  3UT9 D;  3A6N D;  5JRG C;  4Z66 B;  4WU9 D;  4CAY A;  1U35 A;  3LZ1 A;  4G92 B;  3LEL A;  4G92 C;  3H0L C;  4HGA B;  4J8X B;  1U35 C;  1U35 B;  3LZ1 C;  3LEL B;  3LEL C;  3MGP A;  4G91 C;  3X1S D;  4H9O B;  4NE5 A;  4J8U B;  2ZM5 A;  3WA9 B;  3MGP C;  5B33 B;  2Y2N A;  1ID3 D;  2NQB D;  1M18 A;  3X1V C;  3AFA D;  4YM6 D;  4WU9 A;  3W98 B;  5B2I D;  4H9Q A;  1M18 C;  5AY8 A;  2PYO D;  3W99 D;  5AVB D;  4WU9 C;  5AY8 C;  4WNN A;  1M19 D;  1EQZ B;  2HUE B;  5B24 D;  5B0Z B;  3WAA D;  1P3M A;  2ZY3 A;  2NZD D;  4AWL C;  3REL D;  3KXB D;  1P3G B;  3X1S C;  4ZBJ C;  1HQ3 D;  3KFU G;  1P3M B;  1P3M C;  5AV8 A;  4DQY B;  5GT3 D;  1P3A B;  3LZ0 A;  4YM6 A;  1PZR A;  1W2E A;  3AV1 B;  5CPK A;  5CP6 A;  1P3K B;  5B2J B;  5AV8 C;  3C1C D;  3LZ0 C;  4YM6 C;  5JA4 B;  3MGS A;  3TU4 D;  5CPK C;  5CP6 C;  3W96 B;  4JJN A;  5BNV B;  2CWE A;  3AZF D;  3MGS C;  3KUY B;  4WU8 A;  4J8V A;  4R8P D;  4JJN C;  1B67 A;  1P3F A;  4UPK A;  2CV5 B;  4J8V C;  4WU8 C;  4H9N B;  4EO5 C;  4EO5 B;  3AZH A;  1P3F B;  4WV4 B;  1P3F C;  3AV2 D;  2FJ7 D;  5GSU B;  3REK B;  3REI D;  2ARO D;  5AVC A;  3AZG D;  5AV5 A;  1HQ3 C;  4ZUX A;  3AZH B;  3AZH C;  3C1B B;  5AVC C;  4CSR A;  3AZK D;  5AV5 C;  2JSS A;  5AV5 B;  4Z5T D;  4ZUX C;  4UUZ A;  1H3O A;  5FUG B;  3MGQ A;  3UTA D;  3AZE D;  1KX3 A;  2F8N D;  3B0D C;  2ZY4 A;  4R8P A;  3VH5 T;  4UUZ B;  3V9R B;  3MNN D;  1H3O B;  3MGQ B;  3MGQ C;  1KX3 C;  1AOI B;  4R8P C;  5CPI A;  1KX5 B;  2JCH A;  3WTP B;  4YS3 A;  4H9S A;  2FJ7 A;  1Z2C B;  3KWQ A;  5BT1 D;  5CPI B;  2YFW A;  4XZQ B;  5B32 A;  2FJ7 C;  4YS3 C;  4H9S C;  5B1M D;  4KGC D;  4NE6 A;  4H9P A;  3KWQ C;  3KWQ B;  2YFV A;  3AYW A;  5CPJ A;  5B32 C;  3REJ B;  3MVD D;  2F8N A;  5B40 D;  5BO0 A;  3NQJ B;  2YFV B;  3AYW B;  1TZY A;  3AYW C;  5CPJ C;  1P3O B;  5B1L B;  5BO0 B;  5B0Y B;  1P3I D;  3MGR A;  1TZY C;  2BYK B;  5E5A D;  3MGR B;  3MGR C;  3X1T D;  4X23 D;  5GT0 A;  1M1A A;  1P3L A;  1F66 D;  5AV6 B;  2UWX A;  3AL0 C;  4H9R A;  4LD9 B;  5GT0 C;  1M1A B;  1M1A C;  1P3L C;  3B6G D;  3W97 A;  2F8N G;  4M6B A;  3AZI A;  3REH B;  4KUD B;  1KU5 A;  3W97 C;  5B31 D;  3AZI C;  1P3B D;  2F8N H;  5DNN B;  3R45 B;  5AV9 A;  4QLC B;  1BFM A;  3X1U B;  4J8W D;  1P3P B;  1KX4 D;  3AZM A;  3FDD A;  1Q9C A;  2Y2K A;  3VH5 W;  4Z66 D;  3X1T A;  1ZLA B;  5AV9 C;  4XUJ B;  5AV9 B;  1P34 B;  5JRG B;  3AZM C;  2Y2J A;  3X1T C;  3AN2 A;  4J8X D;  5KDM A;  4CAY B;  3AZJ D;  3AN2 C;  3LZ1 B;  4J8U D;  5KDM B;  1R4V A;  5DNM A;  3WA9 D;  4G91 B;  5B33 D;  3X1V A;  3MGP B;  5DNM C;  2XD1 A;  3AZL A;  3W98 D;  3X1V B;  3UT9 A;  3A6N A;  3AZL C;  1M18 B;  5CHL B;  3UT9 C;  3A6N C;  3KSY A;  4WU9 B;  4DRB A;  1EQZ D;  3EPJ A;  2Y2G A;  4H9Q B;  5B0Z D;  2RVQ D;  5AY8 B;  4NE3 A;  3X1S A;  1P3G D;  3AZJ C;  4AWL B;  3O62 D;  4WNN B;  1P3A D;  1P3K D;  5C3I B;  5C3I C;  4ZBJ B;  3X1S B;  3AV1 D;  1ID3 A;  2NQB A;  5B2J D;  3AFA A;  2IO5 C;  1ID3 C;  5B2I A;  1ID3 B;  3W96 D;  2NQB C;  5AV8 B;  3AFA C;  2PYO A;  3LZ0 B;  4YM6 B;  5CPK B;  5CP6 B;  5AVB A;  3W99 A;  2Y2O A;  5B2I C;  5F99 D;  2CV5 D;  2PYO C;  3MGS B;  1M19 A;  3W99 C;  5AVB C;  3W99 B;  5B24 A;  4JJN B;  3WAA A;  2NZD A;  3REL A;  4WU8 B;  3KXB A;  4J8V B;  4Z2M G;  1M19 C;  1HQ3 A;  5B24 C;  1HTA A;  3F6T A;  3WAA C;  4NFT A;  1TAF A;  5GT3 A;  2NZD C;  2BG1 A;  3O62 C;  3REL B;  3REL C;  3KXB C;  1HQ3 B;  5BNX A;  4WJ3 C;  4Z2M H;  3C1C A;  1ULY A;  5GT3 C;  5AVC B;  3TU4 A;  4ZUX B;  5BNX B;  3C1C C;  3WKJ D;  3AZF A;  3B0D B;  3TU4 C;  4CSR B;  3VH6 T;  1AOI D;  4KHA A;  1KX5 D;  5F99 C;  3WTP D;  3AZF C;  2LY8 A;  1KX3 B;  4E45 A;  4R8P B;  3AV2 A;  1B6W A;  4XZQ D;  3H0M C;  3LJA D;  3REI A;  2ARO A;  5GXQ D;  3AZG A;  3EG5 B;  2F2A C;  1N1J A;  3AV2 C;  4YS3 B;  2FJ7 B;  3REJ D;  3REI C;  2ARO C;  3UTB D;  3AZG C;  3AZK A;  3B6F D;  2YFW B;  4Z5T A;  5B32 B;  1N1J B;  3UTA A;  3WKJ A;  3AZE A;  1P3O D;  3AZK C;  4H9P B;  5B0Y D;  4Z5T C;  5CPJ B;  3MNN A;  3UTA C;  3WKJ C;  3AZE C;  2F8N B;  3P5J B;  1TZY B;  3MNN C;  1F1E A;  5GXQ A;  3EPH A;  2G5I C;  5AV6 D;  2Y2M A;  5B1M A;  2HIO D;  4KGC A;  4LD9 D;  5GXQ C;  1JFI A;  5BT1 C;  5B1M C;  3MVD A;  5GT0 B;  3REH D;  4KGC B;  4KGC C;  1P3L B;  5B40 A;  3B0B A;  3B6F C;  1T3U A;  4H9R B;  3MVD C;  2W8S A;  4WZS B;  5B40 B;  5DNN D;  2RIQ A;  5B40 C;  1P3I A;  1WWI A;  3W97 B;  1P3P D;  3A1K A;  3AZI B;  2ZY5 A;  3B0C T;  3EPK A;  2DF4 C;  1S32 D;  5E5A A;  1ZLA D;  3AZN D;  2L5A A;  1P34 D;  2XD5 A;  1P3I C;  1P3I B;  3VH6 W;  5JRG D;  5G49 A;  4X23 A;  2HIO A;  5E5A C;  1F66 A;  3AZM B;  3X1T B;  4X23 C;  2HIO C;  1F66 C;  3B6G A;  1U35 D;  3LZ1 D;  3LEL D;  3AN2 B;  3B6G C;  1BH8 A;  2JE5 A;  3VH5 A;  3MGP D;  5B31 A;  3WTP E;  1S32 A;  1P3B A;  2Y2I A;  4J8W A;  1KX4 A;  5DNM B;  5B31 C;  4Z66 A;  1S32 C;  1P3B C;  3AZN C;  1M18 D;  4J8W B;  4J8W C;  1KX4 C;  3AZL B;  4Z66 C;  4J8X A;  3UT9 B;  3A6N B;  5AY8 D;  3AZJ A;  4H9O A;  4HGA C;  4J8X C;  4J8U A;  4E44 A;  3WA9 A;  5B33 A;  3AZJ B;  1P3M D;  3EPL A;  5B31 G;  4J8U C;  3WA9 C;  3W98 A;  5B33 C;  2FFF B;  2IO5 B;  5AV8 D;  3LZ0 D;  5CPK D;  5CP6 D;  3W98 C;  2NQB B;  3B0C W;  3AFA B;  3MGS D;  3KUY D;  1EQZ A;  5B2I B;  5B0Z A;  4JJN D;  2PYO B;  5AVB B;  4J8V D;  4WU8 D;  1EQZ C;  2J8P A;  1P3G A;  2HUE C;  5B0Z C;  1P3F D;  2RVQ C;  2Y2P A;  5GSU D;  3O62 A;  3REK D;  1P3A A;  1P3K A;  1M19 B;  3AV1 A;  5B24 B;  1P3G C;  3WAA B;  5B2J A;  3AZH D;  2NZD B;  4DRA A;  2Y2Q A;  3O62 B;  3C1B D;  3KXB B;  1P3A C;  5JA4 A;  5AVC D;  3AV1 C;  1P3K C;  3W96 A;  5AV5 D;  5B2J C;  4ZUX D;  1TAF B;  5GT3 B;  5BNV A;  1BH9 A;  3KUY A;  3W96 C;  3A1I A;  5F99 A;  3C1C B;  2CV5 A;  3MGQ D;  1BH9 B;  3TU4 B;  1KX3 D;  3KUY C;  4H9N A;  1A7W A;  5F99 B;  3AZF B;  2CV5 C;  5GSU A;  3REK A;  4KHA B;  5CPI D;  4YS3 D;  2F8N K;  5GSU C;  3REK C;  3C1B A;  3KWQ D;  3AV2 B;  5B32 D;  2DQN C;  3REI B;  5FUG A;  2ARO B;  3C1B C;  3AZG B;  3AYW D;  5CPJ D;  3V9R A;  2Y2H A; 
#chains in the Genus database with same CATH homology
 5B1L D;  3AZK B;  1AOI A;  2Y2L A;  4Z5T B;  1KX5 A;  1TZY D;  3WTP A;  3UTA B;  3WKJ B;  3AZE B;  1AOI C;  3MGR D;  1KX5 C;  3MNN B;  4XZQ A;  3WTP C;  3LJA A;  5CPI C;  1WWS A;  4XZQ C;  3LJA B;  3LJA C;  3REJ A;  5GXQ B;  2ZY2 A;  5GT0 D;  3UTB A;  1M1A D;  1P3L D;  3B6F A;  3NQJ A;  2VQR A;  5B1M B;  3REJ C;  1P3O A;  4KUD D;  5B1L A;  3UTB B;  3UTB C;  1JFI B;  3B6F B;  5B0Y A;  3H0R C;  3W97 D;  2BYM A;  2BYK A;  3MVD B;  5BS7 A;  3AZI D;  1P3O C;  5B1L C;  4QLC D;  5B0Y C;  3X1U D;  2BYM B;  5BS7 C;  5AV9 D;  4XUJ D;  5AV6 A;  3AZM D;  5E5A B;  4LD9 A;  5B32 G;  5AV6 C;  5G49 B;  4X23 B;  2HIO B;  3REH A;  4LD9 C;  4KUD A;  1F66 B;  3AN2 D;  3NQU A;  2G5H C;  3REH C;  4KUD C;  3B6G B;  5DNN A;  3R45 A;  4QLC A;  3VH6 A;  3X1U A;  3IP4 C;  1P3P A;  3NQU B;  5DNM D;  1ZLA A;  3AZN A;  5DNN C;  3X1V D;  1BH8 B;  4XUJ A;  4QLC C;  1P34 A;  3X1U C;  1P3P C;  5JRG A;  5B31 B;  1S32 B;  3AZL D;  1P3B B;  1ZLA C;  3AZN B;  1P34 C;  4XUJ C;  1KX4 B;  3UT9 D;  3A6N D;  5JRG C;  4Z66 B;  4WU9 D;  4CAY A;  1U35 A;  3LZ1 A;  4G92 B;  3LEL A;  4G92 C;  3H0L C;  4HGA B;  4J8X B;  1U35 C;  1U35 B;  3LZ1 C;  3LEL B;  3LEL C;  3MGP A;  4G91 C;  3X1S D;  4H9O B;  4NE5 A;  4J8U B;  2ZM5 A;  3WA9 B;  3MGP C;  5B33 B;  2Y2N A;  1ID3 D;  2NQB D;  1M18 A;  3X1V C;  3AFA D;  4YM6 D;  4WU9 A;  3W98 B;  5B2I D;  4H9Q A;  1M18 C;  5AY8 A;  2PYO D;  3W99 D;  5AVB D;  4WU9 C;  5AY8 C;  4WNN A;  1M19 D;  1EQZ B;  2HUE B;  5B24 D;  5B0Z B;  3WAA D;  1P3M A;  2ZY3 A;  2NZD D;  4AWL C;  3REL D;  3KXB D;  1P3G B;  3X1S C;  4ZBJ C;  1HQ3 D;  3KFU G;  1P3M B;  1P3M C;  5AV8 A;  4DQY B;  5GT3 D;  1P3A B;  3LZ0 A;  4YM6 A;  1PZR A;  1W2E A;  3AV1 B;  5CPK A;  5CP6 A;  1P3K B;  5B2J B;  5AV8 C;  3C1C D;  3LZ0 C;  4YM6 C;  5JA4 B;  3MGS A;  3TU4 D;  5CPK C;  5CP6 C;  3W96 B;  4JJN A;  5BNV B;  2CWE A;  3AZF D;  3MGS C;  3KUY B;  4WU8 A;  4J8V A;  4R8P D;  4JJN C;  1B67 A;  1P3F A;  4UPK A;  2CV5 B;  4J8V C;  4WU8 C;  4H9N B;  4EO5 C;  4EO5 B;  3AZH A;  1P3F B;  4WV4 B;  1P3F C;  3AV2 D;  2FJ7 D;  5GSU B;  3REK B;  3REI D;  2ARO D;  5AVC A;  3AZG D;  5AV5 A;  1HQ3 C;  4ZUX A;  3AZH B;  3AZH C;  3C1B B;  5AVC C;  4CSR A;  3AZK D;  5AV5 C;  2JSS A;  5AV5 B;  4Z5T D;  4ZUX C;  4UUZ A;  1H3O A;  5FUG B;  3MGQ A;  3UTA D;  3AZE D;  1KX3 A;  2F8N D;  3B0D C;  2ZY4 A;  4R8P A;  3VH5 T;  4UUZ B;  3V9R B;  3MNN D;  1H3O B;  3MGQ B;  3MGQ C;  1KX3 C;  1AOI B;  4R8P C;  5CPI A;  1KX5 B;  2JCH A;  3WTP B;  4YS3 A;  4H9S A;  2FJ7 A;  1Z2C B;  3KWQ A;  5BT1 D;  5CPI B;  2YFW A;  4XZQ B;  5B32 A;  2FJ7 C;  4YS3 C;  4H9S C;  5B1M D;  4KGC D;  4NE6 A;  4H9P A;  3KWQ C;  3KWQ B;  2YFV A;  3AYW A;  5CPJ A;  5B32 C;  3REJ B;  3MVD D;  2F8N A;  5B40 D;  5BO0 A;  3NQJ B;  2YFV B;  3AYW B;  1TZY A;  3AYW C;  5CPJ C;  1P3O B;  5B1L B;  5BO0 B;  5B0Y B;  1P3I D;  3MGR A;  1TZY C;  2BYK B;  5E5A D;  3MGR B;  3MGR C;  3X1T D;  4X23 D;  5GT0 A;  1M1A A;  1P3L A;  1F66 D;  5AV6 B;  2UWX A;  3AL0 C;  4H9R A;  4LD9 B;  5GT0 C;  1M1A B;  1M1A C;  1P3L C;  3B6G D;  3W97 A;  2F8N G;  4M6B A;  3AZI A;  3REH B;  4KUD B;  1KU5 A;  3W97 C;  5B31 D;  3AZI C;  1P3B D;  2F8N H;  5DNN B;  3R45 B;  5AV9 A;  4QLC B;  1BFM A;  3X1U B;  4J8W D;  1P3P B;  1KX4 D;  3AZM A;  3FDD A;  1Q9C A;  2Y2K A;  3VH5 W;  4Z66 D;  3X1T A;  1ZLA B;  5AV9 C;  4XUJ B;  5AV9 B;  1P34 B;  5JRG B;  3AZM C;  2Y2J A;  3X1T C;  3AN2 A;  4J8X D;  5KDM A;  4CAY B;  3AZJ D;  3AN2 C;  3LZ1 B;  4J8U D;  5KDM B;  1R4V A;  5DNM A;  3WA9 D;  4G91 B;  5B33 D;  3X1V A;  3MGP B;  5DNM C;  2XD1 A;  3AZL A;  3W98 D;  3X1V B;  3UT9 A;  3A6N A;  3AZL C;  1M18 B;  5CHL B;  3UT9 C;  3A6N C;  3KSY A;  4WU9 B;  4DRB A;  1EQZ D;  3EPJ A;  2Y2G A;  4H9Q B;  5B0Z D;  2RVQ D;  5AY8 B;  4NE3 A;  3X1S A;  1P3G D;  3AZJ C;  4AWL B;  3O62 D;  4WNN B;  1P3A D;  1P3K D;  5C3I B;  5C3I C;  4ZBJ B;  3X1S B;  3AV1 D;  1ID3 A;  2NQB A;  5B2J D;  3AFA A;  2IO5 C;  1ID3 C;  5B2I A;  1ID3 B;  3W96 D;  2NQB C;  5AV8 B;  3AFA C;  2PYO A;  3LZ0 B;  4YM6 B;  5CPK B;  5CP6 B;  5AVB A;  3W99 A;  2Y2O A;  5B2I C;  5F99 D;  2CV5 D;  2PYO C;  3MGS B;  1M19 A;  3W99 C;  5AVB C;  3W99 B;  5B24 A;  4JJN B;  3WAA A;  2NZD A;  3REL A;  4WU8 B;  3KXB A;  4J8V B;  4Z2M G;  1M19 C;  1HQ3 A;  5B24 C;  1HTA A;  3F6T A;  3WAA C;  4NFT A;  1TAF A;  5GT3 A;  2NZD C;  2BG1 A;  3O62 C;  3REL B;  3REL C;  3KXB C;  1HQ3 B;  5BNX A;  4WJ3 C;  4Z2M H;  3C1C A;  1ULY A;  5GT3 C;  5AVC B;  3TU4 A;  4ZUX B;  5BNX B;  3C1C C;  3WKJ D;  3AZF A;  3B0D B;  3TU4 C;  4CSR B;  3VH6 T;  1AOI D;  4KHA A;  1KX5 D;  5F99 C;  3WTP D;  3AZF C;  2LY8 A;  1KX3 B;  4E45 A;  4R8P B;  3AV2 A;  1B6W A;  4XZQ D;  3H0M C;  3LJA D;  3REI A;  2ARO A;  5GXQ D;  3AZG A;  3EG5 B;  2F2A C;  1N1J A;  3AV2 C;  4YS3 B;  2FJ7 B;  3REJ D;  3REI C;  2ARO C;  3UTB D;  3AZG C;  3AZK A;  3B6F D;  2YFW B;  4Z5T A;  5B32 B;  1N1J B;  3UTA A;  3WKJ A;  3AZE A;  1P3O D;  3AZK C;  4H9P B;  5B0Y D;  4Z5T C;  5CPJ B;  3MNN A;  3UTA C;  3WKJ C;  3AZE C;  2F8N B;  3P5J B;  1TZY B;  3MNN C;  1F1E A;  5GXQ A;  3EPH A;  2G5I C;  5AV6 D;  2Y2M A;  5B1M A;  2HIO D;  4KGC A;  4LD9 D;  5GXQ C;  1JFI A;  5BT1 C;  5B1M C;  3MVD A;  5GT0 B;  3REH D;  4KGC B;  4KGC C;  1P3L B;  5B40 A;  3B0B A;  3B6F C;  1T3U A;  4H9R B;  3MVD C;  2W8S A;  4WZS B;  5B40 B;  5DNN D;  2RIQ A;  5B40 C;  1P3I A;  1WWI A;  3W97 B;  1P3P D;  3A1K A;  3AZI B;  2ZY5 A;  3B0C T;  3EPK A;  2DF4 C;  1S32 D;  5E5A A;  1ZLA D;  3AZN D;  2L5A A;  1P34 D;  2XD5 A;  1P3I C;  1P3I B;  3VH6 W;  5JRG D;  5G49 A;  4X23 A;  2HIO A;  5E5A C;  1F66 A;  3AZM B;  3X1T B;  4X23 C;  2HIO C;  1F66 C;  3B6G A;  1U35 D;  3LZ1 D;  3LEL D;  3AN2 B;  3B6G C;  1BH8 A;  2JE5 A;  3VH5 A;  3MGP D;  5B31 A;  3WTP E;  1S32 A;  1P3B A;  2Y2I A;  4J8W A;  1KX4 A;  5DNM B;  5B31 C;  4Z66 A;  1S32 C;  1P3B C;  3AZN C;  1M18 D;  4J8W B;  4J8W C;  1KX4 C;  3AZL B;  4Z66 C;  4J8X A;  3UT9 B;  3A6N B;  5AY8 D;  3AZJ A;  4H9O A;  4HGA C;  4J8X C;  4J8U A;  4E44 A;  3WA9 A;  5B33 A;  3AZJ B;  1P3M D;  3EPL A;  5B31 G;  4J8U C;  3WA9 C;  3W98 A;  5B33 C;  2FFF B;  2IO5 B;  5AV8 D;  3LZ0 D;  5CPK D;  5CP6 D;  3W98 C;  2NQB B;  3B0C W;  3AFA B;  3MGS D;  3KUY D;  1EQZ A;  5B2I B;  5B0Z A;  4JJN D;  2PYO B;  5AVB B;  4J8V D;  4WU8 D;  1EQZ C;  2J8P A;  1P3G A;  2HUE C;  5B0Z C;  1P3F D;  2RVQ C;  2Y2P A;  5GSU D;  3O62 A;  3REK D;  1P3A A;  1P3K A;  1M19 B;  3AV1 A;  5B24 B;  1P3G C;  3WAA B;  5B2J A;  3AZH D;  2NZD B;  4DRA A;  2Y2Q A;  3O62 B;  3C1B D;  3KXB B;  1P3A C;  5JA4 A;  5AVC D;  3AV1 C;  1P3K C;  3W96 A;  5AV5 D;  5B2J C;  4ZUX D;  1TAF B;  5GT3 B;  5BNV A;  1BH9 A;  3KUY A;  3W96 C;  3A1I A;  5F99 A;  3C1C B;  2CV5 A;  3MGQ D;  1BH9 B;  3TU4 B;  1KX3 D;  3KUY C;  4H9N A;  1A7W A;  5F99 B;  3AZF B;  2CV5 C;  5GSU A;  3REK A;  4KHA B;  5CPI D;  4YS3 D;  2F8N K;  5GSU C;  3REK C;  3C1B A;  3KWQ D;  3AV2 B;  5B32 D;  2DQN C;  3REI B;  5FUG A;  2ARO B;  3C1B C;  3AZG B;  3AYW D;  5CPJ D;  3V9R A;  2Y2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...