2NZDD

Nucleosome core particle containing 145 bp of dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdD00
3W96B 5B1MA 3NQJB 3AZEA 3W98B 5FUGA 4Z66A 3WKJD 4JJNB 3LELC 3AZLD 3UTBC 5GT0D 2AROD 2RVQD 3AZMC 3MGQA 1JFIA 4LD9B 3W96A 1F66C 3AZKB 5B31D 3MVDC 5B40C 4Z66D 5G49B 5AV9C 3REKA 4LD9A 3A6NC 2IO5B 5CPKC 3LZ0C 3MGQD 1P3OB 3C1CC 5B32B 5AY8C 3X1SD 1P3IA 3W96D 5E5AD 3MNNC 3AZKA 1M1AA 1ULYA 4ZBJC 4AWLC 3W98D 1KX5C 4JJND 1P3GC 1P34A 5G49A 4KUDC 2HUEC 3AZHC 1P3LD 1P3OA 1TZYD 1P3FB 3AZEC 1H3OB 3AZKD 3AV1D 1HQ3D 5B2IB 1P3FA 2NQBC 5B0YB 1TAFA 5B32D 1H3OA 3RELD 5B1LB 2F8NG 4HGAC 4H9NB 2YFVB 3WAAB 4M6BA 1ID3B 3KUYB 3REKC 5B2IA 2FJ7D 3AYWA 3REJB 5B0YA 5CPJB 3WTPB 3AFAC 1P3IC 4NE6A 3AZGB 4WU9D 1P3KA 5DNNA 1P3AD 5B1LA 1M1AC 3WA9B 4H9NA 2YFVA 3WAAA 3LZ1B 1ID3A 5CPIB 1P34C 3KUYA 4H9SA 3X1UC 3KXBD 3REJA 3W97B 5CPJA 2IO5C 1S32C 3AZFD 1KX4C 1KX3D 3WTPA 5AVCB 5AV5D 1EQZA 5AVBC 3AZGA 1P3MB 5JRGD 5F99A 3MGRC 3AZIA 3WA9A 3AN2C 3LZ1A 5B1LD 3V9RB 1U35B 3WAAD 4J8XB 3W97A 3MGSC 2HIOB 1R4VA 5AV6A 5AVCA 4H9PB 1P3FC 5BO0B 3REIB 1P3MA 3WTPD 2PYOD 2F8NK 4E45A 3MGPC 3V9RA 1U35A 1BFMA 5CPID 4J8XA 2HIOA 1P3PA 5B2IC 2LY8A 4H9PA 3AYWC 3W97D 5B0YC 3REIA 5B33B 5BT1D 1P3KC 1P3MD 5DNNC 4X23B 4J8WA 3TU4A 4QLCD 1ID3C 3AZLB 1U35D 4H9SC 5B0ZC 4J8XD 2AROB 2HIOD 5CPJC 5B33A 1EQZC 3REID 3AZGC 5GSUB 3R45B 5F99C 3AZIC 3B0DC 3WKJA 4XUJB 3LZ1C 4WU8B 5BNVB 3AZLA 3B0CW 5B24B 3AZNB 2AROA 4UUZA 2BYKA 5AV6C 5GSUA 3R45A 5E5AB 5B31A 1WWIA 4WU8A 4X23D 5BNVA 4R8PC 5B2JC 4J8VC 5B24A 4YM6C 3AZNA 1P3PC 1B6WA 1F66D 1P3LB 1TZYB 3X1SA 5E5AA 3NQJA 3W99B 5GSUD 3W98A 3KSYA 4ZUXB 4J8WC 5JA4B 4XUJD 4JJNA 3TU4C 3X1TC 4WU8D 5AV9D 3AV1B 5GT3B 1HQ3B 5B24D 3AZND 2CV5B 3LZ0D 1P3LA 1BH8B 1TZYA 4WZSB 4G92B 3RELB 3LJAD 3VH5W 3VH6T 4ZUXA 4H9QB 3WKJC 1KX5D 3AV1A 5GT3A 4CAYB 3B6FD 4J8UC 4G91C 1HQ3A 4NE5A 5GT0C 2RVQC 1N1JB 1BH8A 2FJ7B 4XZQB 3C1BD 3B0CT 5B32A 3RELA 4WU9B 5B1MC 1P3AB 4EO5C 4H9QA 3X1VB 3W99D 5B31C 4ZUXD 4CAYA 4Z66C 5CP6B 5GT3D 3O62D 2FJ7A 3KXBB 2NQBD 2BYMB 3AZFB 2CV5D 2NZDB 3MGQC 1KX3B 5AV5B 3X1SC 4WU9A 3W96C 5E5AC 1P3AA 5JRGB 5BNXB 5BS7A 3UT9D 3B6GD 3W98C 1AOIB 4JJNC 5CP6A 1P3BD 5GXQB 4Z2MH 3AZJB 4NE3A 3KXBA 2BYMA 3AZFA 1KX3A 5AV5A 5DNMB 4XZQD 1TZYC 3AV2B 2L5AA 1P3LC 2F8NB 4LD9C 1M18D 5JRGA 5BNXA 1F1EA 2PYOB 3AZKC 3X1VD 1AOIA 3AV1C 5AV8D 5GXQA 1HQ3C 5CP6D 3VH5T 1KX4D 2F8NA 1M19B 5AVBD 2NZDD 3MGRD 1P3OC 2PYOA 5B32C 3UTAB 3B0BA 5CPIA 4QLCB 1AOID 5GXQD 3AZJD 4KGCB 3AV2D 5DNMD 2F8ND 4Z5TB 4WU9C 1P3AC 3MGPD 3KWQB 3UTAA 4QLCA 4YS3B 1ZLAD 3AZFC 1KX3C 1M19D 5BO0A 5B1LC 3LELB 3UTAD 4YS3A 3WAAC 5B0ZD 3AZMB 3KUYC 3VH6W 1F66B 3REJC 4KGCD 3WTPC 3NQUB 4Z5TD 4X23A 3KWQD 3WA9C 3MVDB 3REHD 5CPIC 5AV9B 4YS3D 3AZMA 5KDMB 3A6NB 1F66A 3W97C 3LZ0B 1A7WA 3C1CB 3NQUA 5AY8B 5AVCC 5BT1C 3MNNB 1P3MC 4ZBJB 3LJAB 4AWLB 3MVDA 5B2JD 4XUJA 1KX5B 4YM6D 5AV9A 3LELD 3B6FB 3UTBD 1U35C 5B31G 4J8XC 3AZMD 2HIOC 3LZ0A 3C1CA 5AY8A 3C1BB 3REIC 3AZEB 3LJAA 2F8NH 1KX5A 3B6FA 5B40D 3MVDD 3O62B 3A6ND 2NQBB 5CPKD 3C1BA 2JSSA 4CSRB 5B33C 3C1CD 5AY8D 3MNND 3W99A 3UT9B 4HGAB 4X23C 3B6GB 4J8UD 1BH9B 4NFTA 5C3IB 5JA4A 1P3GD 3REKB 3AZLC 1P3BB 3O62A 2NQBA 4KUDD 3AZHD 2AROC 2CV5A 4CSRA 3AFAB 1Q9CA 1P3IB 1M18B 5B1MD 1M1AB 3AZED 3UT9A 3B6GA 4WV4B 5GSUC 1BH9A 4XUJC 1P34B 5B32G 4WU8C 1P3BA 3VH6A 5AV8B 3X1UB 5B24C 3AZNC 1S32B 1N1JA 1KX4B 3AFAA 4XZQA 5AVBB 1M18A 3MGRB 3AN2B 3LJAC 3X1VA 3B6FC 5AV8A 3X1UA 3MGSB 3REKD 1S32A 1KX4A 3WTPE 4LD9D 5AVBA 2NZDA 3C1BC 3AFAD 3MGRA 1TAFB 3AN2A 1P3ID 1M1AD 3MGPB 2CWEA 3W99C 4ZUXC 1P34D 3MGSA 5GT3C 3O62C 3X1UD 3AZJA 1ZLAB 3AYWB 1S32D 2CV5C 3AV2A 5DNMA 1P3OD 1WWSA 1P3KB 5DNNB 3MGPA 4G92C 3RELC 3AN2D 3UT9C 3B6GC 4KHAB 5C3IC 1P3BC 5B0ZB 1ZLAA 3MGSD 4H9RB 1M19A 2FJ7C 4XZQC 1EQZB 1P3FD 1M18C 3VH5A 5F99B 3AZIB 3B0DB 4KHAA 3X1VC 5BS7C 3REHB 5AV8C 1KU5A 5B0ZA 5CP6C 5AV6B 4H9RA 5B2ID 3KXBC 3AYWD 4H9OB 5B0YD 4KGCA 2NZDC 5AV5C 4Z5TA 1P3KD 5DNND 5JRGC 3KWQA 4R8PB 3REHA 5B2JB 4J8VB 4YM6B 1AOIC 1ID3D 3UTBB 3KUYD 1P3PB 5GXQC 3AZJC 3REJD 4H9OA 5CPJD 1B67A 3AV2C 5DNMC 1EQZD 1HTAA 3AZGD 5F99D 3AZID 2PYOC 3WA9D 4J8WB 4R8PA 5B2JA 4WNNB 4YM6A 3LZ1D 4J8VA 3LELA 3TU4B 3X1TB 5B40B 3UTBA 4Z2MG 1ZLAC 5AV6D 5AVCD 1M19C 5CPKB 4WNNA 3X1TA 3WKJB 3UTAC 5B40A 4R8PD 4J8UB 4DRAA 4G91B 4J8VD 1P3GB 4QLCC 5GT0B 4UUZB 2YFWB 2BYKB 1P3PD 5KDMA 3A6NA 4KUDB 2HUEB 3AZHB 5CPKA 4KGCC 3MNNA 5B1MB 4Z5TC 4EO5B 5B31B 3KWQC 4J8WD 5FUGB 4J8UA 3REHC 4Z66B 3TU4D 3X1TD 1P3GA 5CHLB 4DRBA 5GT0A 4YS3C 2YFWA 4KUDA 3AZHA 1JFIB 3MGQB 5B33D 4E44A 3X1SB
chains in the Genus database with same CATH superfamily
3W96B 5B1MA 3NQJB 3AZEA 3A1KA 3W98B 5FUGA 4Z66A 3WKJD 4JJNB 3LELC 3AZLD 3UTBC 5GT0D 2AROD 2RVQD 3AZMC 3MGQA 1JFIA 4LD9B 3W96A 1F66C 3AZKB 5B31D 2Y2KA 3MVDC 5B40C 4Z66D 5G49B 5AV9C 3REKA 4LD9A 3A6NC 2IO5B 5CPKC 3LZ0C 3MGQD 1P3OB 3C1CC 5B32B 5AY8C 3X1SD 1P3IA 3W96D 5E5AD 3MNNC 3AZKA 1M1AA 1ULYA 4ZBJC 4AWLC 3W98D 1KX5C 4JJND 1P3GC 1P34A 5G49A 2Y2HA 4KUDC 2HUEC 3AZHC 2Y2NA 1P3LD 1P3OA 1TZYD 1P3FB 3AZEC 1H3OB 3AZKD 3IP4C 3AV1D 1HQ3D 5B2IB 1P3FA 2NQBC 5B0YB 1TAFA 5B32D 1H3OA 2Y2LA 3RELD 5B1LB 2F8NG 4HGAC 4H9NB 2YFVB 2RIQA 3WAAB 3EPHA 4M6BA 1ID3B 3KUYB 3REKC 5B2IA 2FJ7D 3AYWA 3REJB 5B0YA 5CPJB 3WTPB 3AFAC 1P3IC 4NE6A 3AZGB 4WU9D 1P3KA 5DNNA 1P3AD 5B1LA 1M1AC 3WA9B 4H9NA 2YFVA 4DQYB 3LZ1B 3WAAA 1ID3A 5CPIB 1P34C 3KUYA 4H9SA 3X1UC 3KXBD 3REJA 3W97B 5CPJA 2IO5C 1S32C 3AZFD 1KX4C 1KX3D 3WTPA 5AVCB 5AV5D 1EQZA 5AVBC 3AZGA 1P3MB 5JRGD 5F99A 3MGRC 3AZIA 3WA9A 3AN2C 2Y2PA 3LZ1A 5B1LD 4WJ3C 3V9RB 1U35B 3WAAD 4J8XB 3W97A 3MGSC 2HIOB 1R4VA 5AV6A 5AVCA 2Y2MA 4H9PB 1P3FC 5BO0B 3REIB 1P3MA 3WTPD 2PYOD 2F8NK 4E45A 3MGPC 3V9RA 1U35A 1BFMA 5CPID 4J8XA 2HIOA 1P3PA 5B2IC 2LY8A 4H9PA 3AYWC 3W97D 5B0YC 3REIA 5B33B 5BT1D 2ZM5A 1P3KC 1P3MD 5DNNC 4X23B 4J8WA 3TU4A 4QLCD 1ID3C 3AZLB 1U35D 4H9SC 5B0ZC 4J8XD 2AROB 3F6TA 2HIOD 5CPJC 2VQRA 5B33A 1EQZC 3REID 3AZGC 5GSUB 3R45B 5F99C 3AZIC 3B0DC 3WKJA 4XUJB 3LZ1C 4WU8B 5BNVB 3AZLA 3B0CW 5B24B 3AZNB 2AROA 4UUZA 2BYKA 5AV6C 5GSUA 3R45A 5E5AB 5B31A 1WWIA 4WU8A 4X23D 5BNVA 4R8PC 5B2JC 4J8VC 5B24A 4YM6C 3AZNA 1P3PC 1B6WA 1F66D 1P3LB 1TZYB 3X1SA 5E5AA 3NQJA 3W99B 5GSUD 3W98A 3KSYA 4ZUXB 4J8WC 5JA4B 4XUJD 4JJNA 3TU4C 3X1TC 4WU8D 5AV9D 3AV1B 5GT3B 1HQ3B 5B24D 3AZND 2CV5B 3LZ0D 1P3LA 1BH8B 1TZYA 4WZSB 4G92B 3RELB 3LJAD 3VH5W 3VH6T 4ZUXA 2ZY3A 4H9QB 3WKJC 1KX5D 3AV1A 5GT3A 4CAYB 3B6FD 4J8UC 4G91C 1HQ3A 4NE5A 5GT0C 2RVQC 1N1JB 1BH8A 2FJ7B 4XZQB 3C1BD 1T3UA 3B0CT 5B32A 3RELA 4WU9B 5B1MC 1P3AB 4EO5C 4H9QA 3X1VB 2JE5A 3W99D 5B31C 4ZUXD 4CAYA 4Z66C 5CP6B 5GT3D 3O62D 2FJ7A 3KXBB 2NQBD 2BYMB 3AZFB 2CV5D 2NZDB 3MGQC 1KX3B 2Y2GA 5AV5B 3X1SC 4WU9A 3W96C 3H0LC 5E5AC 1P3AA 5JRGB 5BNXB 5BS7A 3UT9D 3B6GD 3W98C 1AOIB 4JJNC 5CP6A 1P3BD 3A1IA 5GXQB 4Z2MH 3AZJB 4NE3A 3KXBA 2BYMA 3AZFA 1KX3A 5AV5A 5DNMB 4XZQD 1TZYC 3AV2B 2L5AA 1P3LC 2F8NB 4LD9C 1M18D 5JRGA 5BNXA 1F1EA 2PYOB 3AZKC 3X1VD 1AOIA 3EPLA 3AV1C 5AV8D 5GXQA 1HQ3C 5CP6D 3VH5T 1KX4D 2F8NA 1M19B 5AVBD 2NZDD 3MGRD 1P3OC 2PYOA 5B32C 3EPKA 3UTAB 3B0BA 5CPIA 4QLCB 1AOID 2ZY2A 5GXQD 3AZJD 4KGCB 3AV2D 5DNMD 2F8ND 1Z2CB 2ZY4A 4Z5TB 4WU9C 1P3AC 3MGPD 3KWQB 3UTAA 4QLCA 4YS3B 2FFFB 1ZLAD 3AZFC 1KX3C 1M19D 5BO0A 3EPJA 2DF4C 2G5IC 5B1LC 3H0RC 3LELB 3UTAD 4YS3A 3WAAC 2Y2OA 5B0ZD 3AZMB 3KUYC 3VH6W 1F66B 3REJC 4KGCD 3WTPC 3NQUB 4Z5TD 4X23A 3KWQD 3WA9C 3MVDB 3REHD 5CPIC 5AV9B 4YS3D 3AZMA 2DQNC 5KDMB 3A6NB 1F66A 3W97C 3LZ0B 1A7WA 3C1CB 3NQUA 5AY8B 5AVCC 5BT1C 3MNNB 1P3MC 4ZBJB 3LJAB 4AWLB 3MVDA 5B2JD 4XUJA 1KX5B 4YM6D 5AV9A 3LELD 3B6FB 3UTBD 1U35C 5B31G 4J8XC 3AZMD 2HIOC 3LZ0A 3C1CA 5AY8A 3C1BB 3REIC 3AZEB 3LJAA 2Y2QA 2Y2JA 2F8NH 1KX5A 3B6FA 5B40D 3MVDD 3O62B 3A6ND 2NQBB 5CPKD 3C1BA 2JSSA 4UPKA 4CSRB 5B33C 3C1CD 2Y2IA 5AY8D 3MNND 3W99A 3UT9B 4HGAB 4X23C 3B6GB 4J8UD 1BH9B 4NFTA 5C3IB 5JA4A 1P3GD 3REKB 3AZLC 1P3BB 3O62A 2NQBA 4KUDD 3AZHD 2AROC 2CV5A 4CSRA 3AFAB 2JCHA 1Q9CA 1P3IB 1M18B 5B1MD 1M1AB 3AZED 2J8PA 3UT9A 4WV4B 5GSUC 3B6GA 1BH9A 4XUJC 1P34B 5B32G 4WU8C 3H0MC 1P3BA 3VH6A 5AV8B 3X1UB 3P5JB 5B24C 3AZNC 1S32B 1N1JA 1KX4B 3AFAA 4XZQA 5AVBB 3AL0C 1M18A 3MGRB 3AN2B 3LJAC 3X1VA 3KFUG 2BG1A 3B6FC 5AV8A 3X1UA 3MGSB 3REKD 1S32A 1KX4A 3WTPE 4LD9D 5AVBA 2NZDA 3C1BC 3AFAD 3MGRA 1TAFB 3AN2A 1P3ID 1M1AD 3MGPB 2CWEA 3FDDA 3W99C 4ZUXC 1P34D 3MGSA 5GT3C 3O62C 3X1UD 3AZJA 1ZLAB 3AYWB 1S32D 2G5HC 2CV5C 3AV2A 5DNMA 2XD5A 1P3OD 1WWSA 1P3KB 5DNNB 3MGPA 4G92C 3RELC 3AN2D 3UT9C 3B6GC 4KHAB 5C3IC 1P3BC 5B0ZB 1ZLAA 3MGSD 4H9RB 1M19A 2FJ7C 4XZQC 1EQZB 1P3FD 1M18C 3VH5A 5F99B 3AZIB 1W2EA 3B0DB 3EG5B 4KHAA 3X1VC 5BS7C 3REHB 5AV8C 1KU5A 5B0ZA 5CP6C 5AV6B 4H9RA 5B2ID 3KXBC 3AYWD 4H9OB 5B0YD 4KGCA 2NZDC 5AV5C 4Z5TA 1P3KD 5DNND 5JRGC 3KWQA 4R8PB 3REHA 5B2JB 4J8VB 4YM6B 1AOIC 1ID3D 3UTBB 3KUYD 1P3PB 5GXQC 3AZJC 3REJD 2UWXA 4H9OA 5CPJD 1B67A 3AV2C 5DNMC 1EQZD 1HTAA 3AZGD 5F99D 2XD1A 3AZID 2PYOC 4J8WB 4R8PA 3WA9D 5B2JA 4WNNB 4YM6A 3LZ1D 4J8VA 3LELA 3TU4B 3X1TB 5B40B 3UTBA 4Z2MG 1ZLAC 5AV6D 5AVCD 1M19C 5CPKB 4WNNA 3X1TA 3WKJB 2F2AC 3UTAC 5B40A 4R8PD 4J8UB 4DRAA 4G91B 4J8VD 1P3GB 4QLCC 5GT0B 4UUZB 2YFWB 2BYKB 1P3PD 5KDMA 3A6NA 4KUDB 2HUEB 3AZHB 1PZRA 5CPKA 4KGCC 2ZY5A 3MNNA 5B1MB 4Z5TC 4EO5B 5B31B 3KWQC 4J8WD 5FUGB 4J8UA 3REHC 4Z66B 3TU4D 3X1TD 1P3GA 5CHLB 4DRBA 5GT0A 4YS3C 2W8SA 2YFWA 4KUDA 3AZHA 1JFIB 3MGQB 5B33D 4E44A 3X1SB
chains in the Genus database with same CATH topology
3W96B 5B1MA 3NQJB 3AZEA 3A1KA 3W98B 5FUGA 4Z66A 3WKJD 4JJNB 3LELC 3AZLD 3UTBC 5GT0D 2AROD 2RVQD 3AZMC 3MGQA 1JFIA 4LD9B 3W96A 1F66C 3AZKB 5B31D 2Y2KA 3MVDC 5B40C 4Z66D 5G49B 5AV9C 3REKA 4LD9A 3A6NC 2IO5B 5CPKC 3LZ0C 3MGQD 1P3OB 3C1CC 5B32B 5AY8C 3X1SD 1P3IA 3W96D 5E5AD 3MNNC 3AZKA 1M1AA 1ULYA 4ZBJC 4AWLC 3W98D 1KX5C 4JJND 1P3GC 1P34A 5G49A 2Y2HA 4KUDC 2HUEC 3AZHC 2Y2NA 1P3LD 1P3OA 1TZYD 1P3FB 3AZEC 1H3OB 3AZKD 3IP4C 3AV1D 1HQ3D 5B2IB 1P3FA 2NQBC 5B0YB 1TAFA 5B32D 1H3OA 2Y2LA 3RELD 5B1LB 2F8NG 4HGAC 4H9NB 2YFVB 2RIQA 3WAAB 3EPHA 4M6BA 1ID3B 3KUYB 3REKC 5B2IA 2FJ7D 3AYWA 3REJB 5B0YA 5CPJB 3WTPB 3AFAC 1P3IC 4NE6A 3AZGB 4WU9D 1P3KA 5DNNA 1P3AD 5B1LA 1M1AC 3WA9B 4H9NA 2YFVA 4DQYB 3LZ1B 3WAAA 1ID3A 5CPIB 1P34C 3KUYA 4H9SA 3X1UC 3KXBD 3REJA 3W97B 5CPJA 2IO5C 1S32C 3AZFD 1KX4C 1KX3D 3WTPA 5AVCB 5AV5D 1EQZA 5AVBC 3AZGA 1P3MB 5JRGD 5F99A 3MGRC 3AZIA 3WA9A 3AN2C 2Y2PA 3LZ1A 5B1LD 4WJ3C 3V9RB 1U35B 3WAAD 4J8XB 3W97A 3MGSC 2HIOB 1R4VA 5AV6A 5AVCA 2Y2MA 4H9PB 1P3FC 5BO0B 3REIB 1P3MA 3WTPD 2PYOD 2F8NK 4E45A 3MGPC 3V9RA 1U35A 1BFMA 5CPID 4J8XA 2HIOA 1P3PA 5B2IC 2LY8A 4H9PA 3AYWC 3W97D 5B0YC 3REIA 5B33B 5BT1D 2ZM5A 1P3KC 1P3MD 5DNNC 4X23B 4J8WA 3TU4A 4QLCD 1ID3C 3AZLB 1U35D 4H9SC 5B0ZC 4J8XD 2AROB 3F6TA 2HIOD 5CPJC 2VQRA 5B33A 1EQZC 3REID 3AZGC 5GSUB 3R45B 5F99C 3AZIC 3B0DC 3WKJA 4XUJB 3LZ1C 4WU8B 5BNVB 3AZLA 3B0CW 5B24B 3AZNB 2AROA 4UUZA 2BYKA 5AV6C 5GSUA 3R45A 5E5AB 5B31A 1WWIA 4WU8A 4X23D 5BNVA 4R8PC 5B2JC 4J8VC 5B24A 4YM6C 3AZNA 1P3PC 1B6WA 1F66D 1P3LB 1TZYB 3X1SA 5E5AA 3NQJA 3W99B 5GSUD 3W98A 3KSYA 4ZUXB 4J8WC 5JA4B 4XUJD 4JJNA 3TU4C 3X1TC 4WU8D 5AV9D 3AV1B 5GT3B 1HQ3B 5B24D 3AZND 2CV5B 3LZ0D 1P3LA 1BH8B 1TZYA 4WZSB 4G92B 3RELB 3LJAD 3VH5W 3VH6T 4ZUXA 2ZY3A 4H9QB 3WKJC 1KX5D 3AV1A 5GT3A 4CAYB 3B6FD 4J8UC 4G91C 1HQ3A 4NE5A 5GT0C 2RVQC 1N1JB 1BH8A 2FJ7B 4XZQB 3C1BD 1T3UA 3B0CT 5B32A 3RELA 4WU9B 5B1MC 1P3AB 4EO5C 4H9QA 3X1VB 2JE5A 3W99D 5B31C 4ZUXD 4CAYA 4Z66C 5CP6B 5GT3D 3O62D 2FJ7A 3KXBB 2NQBD 2BYMB 3AZFB 2CV5D 2NZDB 3MGQC 1KX3B 2Y2GA 5AV5B 3X1SC 4WU9A 3W96C 3H0LC 5E5AC 1P3AA 5JRGB 5BNXB 5BS7A 3UT9D 3B6GD 3W98C 1AOIB 4JJNC 5CP6A 1P3BD 3A1IA 5GXQB 4Z2MH 3AZJB 4NE3A 3KXBA 2BYMA 3AZFA 1KX3A 5AV5A 5DNMB 4XZQD 1TZYC 3AV2B 2L5AA 1P3LC 2F8NB 4LD9C 1M18D 5JRGA 5BNXA 1F1EA 2PYOB 3AZKC 3X1VD 1AOIA 3EPLA 3AV1C 5AV8D 5GXQA 1HQ3C 5CP6D 3VH5T 1KX4D 2F8NA 1M19B 5AVBD 2NZDD 3MGRD 1P3OC 2PYOA 5B32C 3EPKA 3UTAB 3B0BA 5CPIA 4QLCB 1AOID 2ZY2A 5GXQD 3AZJD 4KGCB 3AV2D 5DNMD 2F8ND 1Z2CB 2ZY4A 4Z5TB 4WU9C 1P3AC 3MGPD 3KWQB 3UTAA 4QLCA 4YS3B 2FFFB 1ZLAD 3AZFC 1KX3C 1M19D 5BO0A 3EPJA 2DF4C 2G5IC 5B1LC 3H0RC 3LELB 3UTAD 4YS3A 3WAAC 2Y2OA 5B0ZD 3AZMB 3KUYC 3VH6W 1F66B 3REJC 4KGCD 3WTPC 3NQUB 4Z5TD 4X23A 3KWQD 3WA9C 3MVDB 3REHD 5CPIC 5AV9B 4YS3D 3AZMA 2DQNC 5KDMB 3A6NB 1F66A 3W97C 3LZ0B 1A7WA 3C1CB 3NQUA 5AY8B 5AVCC 5BT1C 3MNNB 1P3MC 4ZBJB 3LJAB 4AWLB 3MVDA 5B2JD 4XUJA 1KX5B 4YM6D 5AV9A 3LELD 3B6FB 3UTBD 1U35C 5B31G 4J8XC 3AZMD 2HIOC 3LZ0A 3C1CA 5AY8A 3C1BB 3REIC 3AZEB 3LJAA 2Y2QA 2Y2JA 2F8NH 1KX5A 3B6FA 5B40D 3MVDD 3O62B 3A6ND 2NQBB 5CPKD 3C1BA 2JSSA 4UPKA 4CSRB 5B33C 3C1CD 2Y2IA 5AY8D 3MNND 3W99A 3UT9B 4HGAB 4X23C 3B6GB 4J8UD 1BH9B 4NFTA 5C3IB 5JA4A 1P3GD 3REKB 3AZLC 1P3BB 3O62A 2NQBA 4KUDD 3AZHD 2AROC 2CV5A 4CSRA 3AFAB 2JCHA 1Q9CA 1P3IB 1M18B 5B1MD 1M1AB 3AZED 2J8PA 3UT9A 4WV4B 5GSUC 3B6GA 1BH9A 4XUJC 1P34B 5B32G 4WU8C 3H0MC 1P3BA 3VH6A 5AV8B 3X1UB 3P5JB 5B24C 3AZNC 1S32B 1N1JA 1KX4B 3AFAA 4XZQA 5AVBB 3AL0C 1M18A 3MGRB 3AN2B 3LJAC 3X1VA 3KFUG 2BG1A 3B6FC 5AV8A 3X1UA 3MGSB 3REKD 1S32A 1KX4A 3WTPE 4LD9D 5AVBA 2NZDA 3C1BC 3AFAD 3MGRA 1TAFB 3AN2A 1P3ID 1M1AD 3MGPB 2CWEA 3FDDA 3W99C 4ZUXC 1P34D 3MGSA 5GT3C 3O62C 3X1UD 3AZJA 1ZLAB 3AYWB 1S32D 2G5HC 2CV5C 3AV2A 5DNMA 2XD5A 1P3OD 1WWSA 1P3KB 5DNNB 3MGPA 4G92C 3RELC 3AN2D 3UT9C 3B6GC 4KHAB 5C3IC 1P3BC 5B0ZB 1ZLAA 3MGSD 4H9RB 1M19A 2FJ7C 4XZQC 1EQZB 1P3FD 1M18C 3VH5A 5F99B 3AZIB 1W2EA 3B0DB 3EG5B 4KHAA 3X1VC 5BS7C 3REHB 5AV8C 1KU5A 5B0ZA 5CP6C 5AV6B 4H9RA 5B2ID 3KXBC 3AYWD 4H9OB 5B0YD 4KGCA 2NZDC 5AV5C 4Z5TA 1P3KD 5DNND 5JRGC 3KWQA 4R8PB 3REHA 5B2JB 4J8VB 4YM6B 1AOIC 1ID3D 3UTBB 3KUYD 1P3PB 5GXQC 3AZJC 3REJD 2UWXA 4H9OA 5CPJD 1B67A 3AV2C 5DNMC 1EQZD 1HTAA 3AZGD 5F99D 2XD1A 3AZID 2PYOC 4J8WB 4R8PA 3WA9D 5B2JA 4WNNB 4YM6A 3LZ1D 4J8VA 3LELA 3TU4B 3X1TB 5B40B 3UTBA 4Z2MG 1ZLAC 5AV6D 5AVCD 1M19C 5CPKB 4WNNA 3X1TA 3WKJB 2F2AC 3UTAC 5B40A 4R8PD 4J8UB 4DRAA 4G91B 4J8VD 1P3GB 4QLCC 5GT0B 4UUZB 2YFWB 2BYKB 1P3PD 5KDMA 3A6NA 4KUDB 2HUEB 3AZHB 1PZRA 5CPKA 4KGCC 2ZY5A 3MNNA 5B1MB 4Z5TC 4EO5B 5B31B 3KWQC 4J8WD 5FUGB 4J8UA 3REHC 4Z66B 3TU4D 3X1TD 1P3GA 5CHLB 4DRBA 5GT0A 4YS3C 2W8SA 2YFWA 4KUDA 3AZHA 1JFIB 3MGQB 5B33D 4E44A 3X1SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 B;  5B1M A;  3NQJ B;  3AZE A;  3W98 B;  5FUG A;  4Z66 A;  3WKJ D;  4JJN B;  3LEL C;  3AZL D;  3UTB C;  5GT0 D;  2ARO D;  2RVQ D;  3AZM C;  3MGQ A;  1JFI A;  4LD9 B;  3W96 A;  1F66 C;  3AZK B;  5B31 D;  3MVD C;  5B40 C;  4Z66 D;  5G49 B;  5AV9 C;  3REK A;  4LD9 A;  3A6N C;  2IO5 B;  5CPK C;  3LZ0 C;  3MGQ D;  1P3O B;  3C1C C;  5B32 B;  5AY8 C;  3X1S D;  1P3I A;  3W96 D;  5E5A D;  3MNN C;  3AZK A;  1M1A A;  1ULY A;  4ZBJ C;  4AWL C;  3W98 D;  1KX5 C;  4JJN D;  1P3G C;  1P34 A;  5G49 A;  4KUD C;  2HUE C;  3AZH C;  1P3L D;  1P3O A;  1TZY D;  1P3F B;  3AZE C;  1H3O B;  3AZK D;  3AV1 D;  1HQ3 D;  5B2I B;  1P3F A;  2NQB C;  5B0Y B;  1TAF A;  5B32 D;  1H3O A;  3REL D;  5B1L B;  2F8N G;  4HGA C;  4H9N B;  2YFV B;  3WAA B;  4M6B A;  1ID3 B;  3KUY B;  3REK C;  5B2I A;  2FJ7 D;  3AYW A;  3REJ B;  5B0Y A;  5CPJ B;  3WTP B;  3AFA C;  1P3I C;  4NE6 A;  3AZG B;  4WU9 D;  1P3K A;  5DNN A;  1P3A D;  5B1L A;  1M1A C;  3WA9 B;  4H9N A;  2YFV A;  3WAA A;  3LZ1 B;  1ID3 A;  5CPI B;  1P34 C;  3KUY A;  4H9S A;  3X1U C;  3KXB D;  3REJ A;  3W97 B;  5CPJ A;  2IO5 C;  1S32 C;  3AZF D;  1KX4 C;  1KX3 D;  3WTP A;  5AVC B;  5AV5 D;  1EQZ A;  5AVB C;  3AZG A;  1P3M B;  5JRG D;  5F99 A;  3MGR C;  3AZI A;  3WA9 A;  3AN2 C;  3LZ1 A;  5B1L D;  3V9R B;  1U35 B;  3WAA D;  4J8X B;  3W97 A;  3MGS C;  2HIO B;  1R4V A;  5AV6 A;  5AVC A;  4H9P B;  1P3F C;  5BO0 B;  3REI B;  1P3M A;  3WTP D;  2PYO D;  2F8N K;  4E45 A;  3MGP C;  3V9R A;  1U35 A;  1BFM A;  5CPI D;  4J8X A;  2HIO A;  1P3P A;  5B2I C;  2LY8 A;  4H9P A;  3AYW C;  3W97 D;  5B0Y C;  3REI A;  5B33 B;  5BT1 D;  1P3K C;  1P3M D;  5DNN C;  4X23 B;  4J8W A;  3TU4 A;  4QLC D;  1ID3 C;  3AZL B;  1U35 D;  4H9S C;  5B0Z C;  4J8X D;  2ARO B;  2HIO D;  5CPJ C;  5B33 A;  1EQZ C;  3REI D;  3AZG C;  5GSU B;  3R45 B;  5F99 C;  3AZI C;  3B0D C;  3WKJ A;  4XUJ B;  3LZ1 C;  4WU8 B;  5BNV B;  3AZL A;  3B0C W;  5B24 B;  3AZN B;  2ARO A;  4UUZ A;  2BYK A;  5AV6 C;  5GSU A;  3R45 A;  5E5A B;  5B31 A;  1WWI A;  4WU8 A;  4X23 D;  5BNV A;  4R8P C;  5B2J C;  4J8V C;  5B24 A;  4YM6 C;  3AZN A;  1P3P C;  1B6W A;  1F66 D;  1P3L B;  1TZY B;  3X1S A;  5E5A A;  3NQJ A;  3W99 B;  5GSU D;  3W98 A;  3KSY A;  4ZUX B;  4J8W C;  5JA4 B;  4XUJ D;  4JJN A;  3TU4 C;  3X1T C;  4WU8 D;  5AV9 D;  3AV1 B;  5GT3 B;  1HQ3 B;  5B24 D;  3AZN D;  2CV5 B;  3LZ0 D;  1P3L A;  1BH8 B;  1TZY A;  4WZS B;  4G92 B;  3REL B;  3LJA D;  3VH5 W;  3VH6 T;  4ZUX A;  4H9Q B;  3WKJ C;  1KX5 D;  3AV1 A;  5GT3 A;  4CAY B;  3B6F D;  4J8U C;  4G91 C;  1HQ3 A;  4NE5 A;  5GT0 C;  2RVQ C;  1N1J B;  1BH8 A;  2FJ7 B;  4XZQ B;  3C1B D;  3B0C T;  5B32 A;  3REL A;  4WU9 B;  5B1M C;  1P3A B;  4EO5 C;  4H9Q A;  3X1V B;  3W99 D;  5B31 C;  4ZUX D;  4CAY A;  4Z66 C;  5CP6 B;  5GT3 D;  3O62 D;  2FJ7 A;  3KXB B;  2NQB D;  2BYM B;  3AZF B;  2CV5 D;  2NZD B;  3MGQ C;  1KX3 B;  5AV5 B;  3X1S C;  4WU9 A;  3W96 C;  5E5A C;  1P3A A;  5JRG B;  5BNX B;  5BS7 A;  3UT9 D;  3B6G D;  3W98 C;  1AOI B;  4JJN C;  5CP6 A;  1P3B D;  5GXQ B;  4Z2M H;  3AZJ B;  4NE3 A;  3KXB A;  2BYM A;  3AZF A;  1KX3 A;  5AV5 A;  5DNM B;  4XZQ D;  1TZY C;  3AV2 B;  2L5A A;  1P3L C;  2F8N B;  4LD9 C;  1M18 D;  5JRG A;  5BNX A;  1F1E A;  2PYO B;  3AZK C;  3X1V D;  1AOI A;  3AV1 C;  5AV8 D;  5GXQ A;  1HQ3 C;  5CP6 D;  3VH5 T;  1KX4 D;  2F8N A;  1M19 B;  5AVB D;  2NZD D;  3MGR D;  1P3O C;  2PYO A;  5B32 C;  3UTA B;  3B0B A;  5CPI A;  4QLC B;  1AOI D;  5GXQ D;  3AZJ D;  4KGC B;  3AV2 D;  5DNM D;  2F8N D;  4Z5T B;  4WU9 C;  1P3A C;  3MGP D;  3KWQ B;  3UTA A;  4QLC A;  4YS3 B;  1ZLA D;  3AZF C;  1KX3 C;  1M19 D;  5BO0 A;  5B1L C;  3LEL B;  3UTA D;  4YS3 A;  3WAA C;  5B0Z D;  3AZM B;  3KUY C;  3VH6 W;  1F66 B;  3REJ C;  4KGC D;  3WTP C;  3NQU B;  4Z5T D;  4X23 A;  3KWQ D;  3WA9 C;  3MVD B;  3REH D;  5CPI C;  5AV9 B;  4YS3 D;  3AZM A;  5KDM B;  3A6N B;  1F66 A;  3W97 C;  3LZ0 B;  1A7W A;  3C1C B;  3NQU A;  5AY8 B;  5AVC C;  5BT1 C;  3MNN B;  1P3M C;  4ZBJ B;  3LJA B;  4AWL B;  3MVD A;  5B2J D;  4XUJ A;  1KX5 B;  4YM6 D;  5AV9 A;  3LEL D;  3B6F B;  3UTB D;  1U35 C;  5B31 G;  4J8X C;  3AZM D;  2HIO C;  3LZ0 A;  3C1C A;  5AY8 A;  3C1B B;  3REI C;  3AZE B;  3LJA A;  2F8N H;  1KX5 A;  3B6F A;  5B40 D;  3MVD D;  3O62 B;  3A6N D;  2NQB B;  5CPK D;  3C1B A;  2JSS A;  4CSR B;  5B33 C;  3C1C D;  5AY8 D;  3MNN D;  3W99 A;  3UT9 B;  4HGA B;  4X23 C;  3B6G B;  4J8U D;  1BH9 B;  4NFT A;  5C3I B;  5JA4 A;  1P3G D;  3REK B;  3AZL C;  1P3B B;  3O62 A;  2NQB A;  4KUD D;  3AZH D;  2ARO C;  2CV5 A;  4CSR A;  3AFA B;  1Q9C A;  1P3I B;  1M18 B;  5B1M D;  1M1A B;  3AZE D;  3UT9 A;  3B6G A;  4WV4 B;  5GSU C;  1BH9 A;  4XUJ C;  1P34 B;  5B32 G;  4WU8 C;  1P3B A;  3VH6 A;  5AV8 B;  3X1U B;  5B24 C;  3AZN C;  1S32 B;  1N1J A;  1KX4 B;  3AFA A;  4XZQ A;  5AVB B;  1M18 A;  3MGR B;  3AN2 B;  3LJA C;  3X1V A;  3B6F C;  5AV8 A;  3X1U A;  3MGS B;  3REK D;  1S32 A;  1KX4 A;  3WTP E;  4LD9 D;  5AVB A;  2NZD A;  3C1B C;  3AFA D;  3MGR A;  1TAF B;  3AN2 A;  1P3I D;  1M1A D;  3MGP B;  2CWE A;  3W99 C;  4ZUX C;  1P34 D;  3MGS A;  5GT3 C;  3O62 C;  3X1U D;  3AZJ A;  1ZLA B;  3AYW B;  1S32 D;  2CV5 C;  3AV2 A;  5DNM A;  1P3O D;  1WWS A;  1P3K B;  5DNN B;  3MGP A;  4G92 C;  3REL C;  3AN2 D;  3UT9 C;  3B6G C;  4KHA B;  5C3I C;  1P3B C;  5B0Z B;  1ZLA A;  3MGS D;  4H9R B;  1M19 A;  2FJ7 C;  4XZQ C;  1EQZ B;  1P3F D;  1M18 C;  3VH5 A;  5F99 B;  3AZI B;  3B0D B;  4KHA A;  3X1V C;  5BS7 C;  3REH B;  5AV8 C;  1KU5 A;  5B0Z A;  5CP6 C;  5AV6 B;  4H9R A;  5B2I D;  3KXB C;  3AYW D;  4H9O B;  5B0Y D;  4KGC A;  2NZD C;  5AV5 C;  4Z5T A;  1P3K D;  5DNN D;  5JRG C;  3KWQ A;  4R8P B;  3REH A;  5B2J B;  4J8V B;  4YM6 B;  1AOI C;  1ID3 D;  3UTB B;  3KUY D;  1P3P B;  5GXQ C;  3AZJ C;  3REJ D;  4H9O A;  5CPJ D;  1B67 A;  3AV2 C;  5DNM C;  1EQZ D;  1HTA A;  3AZG D;  5F99 D;  3AZI D;  2PYO C;  3WA9 D;  4J8W B;  4R8P A;  5B2J A;  4WNN B;  4YM6 A;  3LZ1 D;  4J8V A;  3LEL A;  3TU4 B;  3X1T B;  5B40 B;  3UTB A;  4Z2M G;  1ZLA C;  5AV6 D;  5AVC D;  1M19 C;  5CPK B;  4WNN A;  3X1T A;  3WKJ B;  3UTA C;  5B40 A;  4R8P D;  4J8U B;  4DRA A;  4G91 B;  4J8V D;  1P3G B;  4QLC C;  5GT0 B;  4UUZ B;  2YFW B;  2BYK B;  1P3P D;  5KDM A;  3A6N A;  4KUD B;  2HUE B;  3AZH B;  5CPK A;  4KGC C;  3MNN A;  5B1M B;  4Z5T C;  4EO5 B;  5B31 B;  3KWQ C;  4J8W D;  5FUG B;  4J8U A;  3REH C;  4Z66 B;  3TU4 D;  3X1T D;  1P3G A;  5CHL B;  4DRB A;  5GT0 A;  4YS3 C;  2YFW A;  4KUD A;  3AZH A;  1JFI B;  3MGQ B;  5B33 D;  4E44 A;  3X1S B; 
#chains in the Genus database with same CATH topology
 3W96 B;  5B1M A;  3NQJ B;  3AZE A;  3A1K A;  3W98 B;  5FUG A;  4Z66 A;  3WKJ D;  4JJN B;  3LEL C;  3AZL D;  3UTB C;  5GT0 D;  2ARO D;  2RVQ D;  3AZM C;  3MGQ A;  1JFI A;  4LD9 B;  3W96 A;  1F66 C;  3AZK B;  5B31 D;  2Y2K A;  3MVD C;  5B40 C;  4Z66 D;  5G49 B;  5AV9 C;  3REK A;  4LD9 A;  3A6N C;  2IO5 B;  5CPK C;  3LZ0 C;  3MGQ D;  1P3O B;  3C1C C;  5B32 B;  5AY8 C;  3X1S D;  1P3I A;  3W96 D;  5E5A D;  3MNN C;  3AZK A;  1M1A A;  1ULY A;  4ZBJ C;  4AWL C;  3W98 D;  1KX5 C;  4JJN D;  1P3G C;  1P34 A;  5G49 A;  2Y2H A;  4KUD C;  2HUE C;  3AZH C;  2Y2N A;  1P3L D;  1P3O A;  1TZY D;  1P3F B;  3AZE C;  1H3O B;  3AZK D;  3IP4 C;  3AV1 D;  1HQ3 D;  5B2I B;  1P3F A;  2NQB C;  5B0Y B;  1TAF A;  5B32 D;  1H3O A;  2Y2L A;  3REL D;  5B1L B;  2F8N G;  4HGA C;  4H9N B;  2YFV B;  2RIQ A;  3WAA B;  3EPH A;  4M6B A;  1ID3 B;  3KUY B;  3REK C;  5B2I A;  2FJ7 D;  3AYW A;  3REJ B;  5B0Y A;  5CPJ B;  3WTP B;  3AFA C;  1P3I C;  4NE6 A;  3AZG B;  4WU9 D;  1P3K A;  5DNN A;  1P3A D;  5B1L A;  1M1A C;  3WA9 B;  4H9N A;  2YFV A;  4DQY B;  3LZ1 B;  3WAA A;  1ID3 A;  5CPI B;  1P34 C;  3KUY A;  4H9S A;  3X1U C;  3KXB D;  3REJ A;  3W97 B;  5CPJ A;  2IO5 C;  1S32 C;  3AZF D;  1KX4 C;  1KX3 D;  3WTP A;  5AVC B;  5AV5 D;  1EQZ A;  5AVB C;  3AZG A;  1P3M B;  5JRG D;  5F99 A;  3MGR C;  3AZI A;  3WA9 A;  3AN2 C;  2Y2P A;  3LZ1 A;  5B1L D;  4WJ3 C;  3V9R B;  1U35 B;  3WAA D;  4J8X B;  3W97 A;  3MGS C;  2HIO B;  1R4V A;  5AV6 A;  5AVC A;  2Y2M A;  4H9P B;  1P3F C;  5BO0 B;  3REI B;  1P3M A;  3WTP D;  2PYO D;  2F8N K;  4E45 A;  3MGP C;  3V9R A;  1U35 A;  1BFM A;  5CPI D;  4J8X A;  2HIO A;  1P3P A;  5B2I C;  2LY8 A;  4H9P A;  3AYW C;  3W97 D;  5B0Y C;  3REI A;  5B33 B;  5BT1 D;  2ZM5 A;  1P3K C;  1P3M D;  5DNN C;  4X23 B;  4J8W A;  3TU4 A;  4QLC D;  1ID3 C;  3AZL B;  1U35 D;  4H9S C;  5B0Z C;  4J8X D;  2ARO B;  3F6T A;  2HIO D;  5CPJ C;  2VQR A;  5B33 A;  1EQZ C;  3REI D;  3AZG C;  5GSU B;  3R45 B;  5F99 C;  3AZI C;  3B0D C;  3WKJ A;  4XUJ B;  3LZ1 C;  4WU8 B;  5BNV B;  3AZL A;  3B0C W;  5B24 B;  3AZN B;  2ARO A;  4UUZ A;  2BYK A;  5AV6 C;  5GSU A;  3R45 A;  5E5A B;  5B31 A;  1WWI A;  4WU8 A;  4X23 D;  5BNV A;  4R8P C;  5B2J C;  4J8V C;  5B24 A;  4YM6 C;  3AZN A;  1P3P C;  1B6W A;  1F66 D;  1P3L B;  1TZY B;  3X1S A;  5E5A A;  3NQJ A;  3W99 B;  5GSU D;  3W98 A;  3KSY A;  4ZUX B;  4J8W C;  5JA4 B;  4XUJ D;  4JJN A;  3TU4 C;  3X1T C;  4WU8 D;  5AV9 D;  3AV1 B;  5GT3 B;  1HQ3 B;  5B24 D;  3AZN D;  2CV5 B;  3LZ0 D;  1P3L A;  1BH8 B;  1TZY A;  4WZS B;  4G92 B;  3REL B;  3LJA D;  3VH5 W;  3VH6 T;  4ZUX A;  2ZY3 A;  4H9Q B;  3WKJ C;  1KX5 D;  3AV1 A;  5GT3 A;  4CAY B;  3B6F D;  4J8U C;  4G91 C;  1HQ3 A;  4NE5 A;  5GT0 C;  2RVQ C;  1N1J B;  1BH8 A;  2FJ7 B;  4XZQ B;  3C1B D;  1T3U A;  3B0C T;  5B32 A;  3REL A;  4WU9 B;  5B1M C;  1P3A B;  4EO5 C;  4H9Q A;  3X1V B;  2JE5 A;  3W99 D;  5B31 C;  4ZUX D;  4CAY A;  4Z66 C;  5CP6 B;  5GT3 D;  3O62 D;  2FJ7 A;  3KXB B;  2NQB D;  2BYM B;  3AZF B;  2CV5 D;  2NZD B;  3MGQ C;  1KX3 B;  2Y2G A;  5AV5 B;  3X1S C;  4WU9 A;  3W96 C;  3H0L C;  5E5A C;  1P3A A;  5JRG B;  5BNX B;  5BS7 A;  3UT9 D;  3B6G D;  3W98 C;  1AOI B;  4JJN C;  5CP6 A;  1P3B D;  3A1I A;  5GXQ B;  4Z2M H;  3AZJ B;  4NE3 A;  3KXB A;  2BYM A;  3AZF A;  1KX3 A;  5AV5 A;  5DNM B;  4XZQ D;  1TZY C;  3AV2 B;  2L5A A;  1P3L C;  2F8N B;  4LD9 C;  1M18 D;  5JRG A;  5BNX A;  1F1E A;  2PYO B;  3AZK C;  3X1V D;  1AOI A;  3EPL A;  3AV1 C;  5AV8 D;  5GXQ A;  1HQ3 C;  5CP6 D;  3VH5 T;  1KX4 D;  2F8N A;  1M19 B;  5AVB D;  2NZD D;  3MGR D;  1P3O C;  2PYO A;  5B32 C;  3EPK A;  3UTA B;  3B0B A;  5CPI A;  4QLC B;  1AOI D;  2ZY2 A;  5GXQ D;  3AZJ D;  4KGC B;  3AV2 D;  5DNM D;  2F8N D;  1Z2C B;  2ZY4 A;  4Z5T B;  4WU9 C;  1P3A C;  3MGP D;  3KWQ B;  3UTA A;  4QLC A;  4YS3 B;  2FFF B;  1ZLA D;  3AZF C;  1KX3 C;  1M19 D;  5BO0 A;  3EPJ A;  2DF4 C;  2G5I C;  5B1L C;  3H0R C;  3LEL B;  3UTA D;  4YS3 A;  3WAA C;  2Y2O A;  5B0Z D;  3AZM B;  3KUY C;  3VH6 W;  1F66 B;  3REJ C;  4KGC D;  3WTP C;  3NQU B;  4Z5T D;  4X23 A;  3KWQ D;  3WA9 C;  3MVD B;  3REH D;  5CPI C;  5AV9 B;  4YS3 D;  3AZM A;  2DQN C;  5KDM B;  3A6N B;  1F66 A;  3W97 C;  3LZ0 B;  1A7W A;  3C1C B;  3NQU A;  5AY8 B;  5AVC C;  5BT1 C;  3MNN B;  1P3M C;  4ZBJ B;  3LJA B;  4AWL B;  3MVD A;  5B2J D;  4XUJ A;  1KX5 B;  4YM6 D;  5AV9 A;  3LEL D;  3B6F B;  3UTB D;  1U35 C;  5B31 G;  4J8X C;  3AZM D;  2HIO C;  3LZ0 A;  3C1C A;  5AY8 A;  3C1B B;  3REI C;  3AZE B;  3LJA A;  2Y2Q A;  2Y2J A;  2F8N H;  1KX5 A;  3B6F A;  5B40 D;  3MVD D;  3O62 B;  3A6N D;  2NQB B;  5CPK D;  3C1B A;  2JSS A;  4UPK A;  4CSR B;  5B33 C;  3C1C D;  2Y2I A;  5AY8 D;  3MNN D;  3W99 A;  3UT9 B;  4HGA B;  4X23 C;  3B6G B;  4J8U D;  1BH9 B;  4NFT A;  5C3I B;  5JA4 A;  1P3G D;  3REK B;  3AZL C;  1P3B B;  3O62 A;  2NQB A;  4KUD D;  3AZH D;  2ARO C;  2CV5 A;  4CSR A;  3AFA B;  2JCH A;  1Q9C A;  1P3I B;  1M18 B;  5B1M D;  1M1A B;  3AZE D;  2J8P A;  3UT9 A;  4WV4 B;  5GSU C;  3B6G A;  1BH9 A;  4XUJ C;  1P34 B;  5B32 G;  4WU8 C;  3H0M C;  1P3B A;  3VH6 A;  5AV8 B;  3X1U B;  3P5J B;  5B24 C;  3AZN C;  1S32 B;  1N1J A;  1KX4 B;  3AFA A;  4XZQ A;  5AVB B;  3AL0 C;  1M18 A;  3MGR B;  3AN2 B;  3LJA C;  3X1V A;  3KFU G;  2BG1 A;  3B6F C;  5AV8 A;  3X1U A;  3MGS B;  3REK D;  1S32 A;  1KX4 A;  3WTP E;  4LD9 D;  5AVB A;  2NZD A;  3C1B C;  3AFA D;  3MGR A;  1TAF B;  3AN2 A;  1P3I D;  1M1A D;  3MGP B;  2CWE A;  3FDD A;  3W99 C;  4ZUX C;  1P34 D;  3MGS A;  5GT3 C;  3O62 C;  3X1U D;  3AZJ A;  1ZLA B;  3AYW B;  1S32 D;  2G5H C;  2CV5 C;  3AV2 A;  5DNM A;  2XD5 A;  1P3O D;  1WWS A;  1P3K B;  5DNN B;  3MGP A;  4G92 C;  3REL C;  3AN2 D;  3UT9 C;  3B6G C;  4KHA B;  5C3I C;  1P3B C;  5B0Z B;  1ZLA A;  3MGS D;  4H9R B;  1M19 A;  2FJ7 C;  4XZQ C;  1EQZ B;  1P3F D;  1M18 C;  3VH5 A;  5F99 B;  3AZI B;  1W2E A;  3B0D B;  3EG5 B;  4KHA A;  3X1V C;  5BS7 C;  3REH B;  5AV8 C;  1KU5 A;  5B0Z A;  5CP6 C;  5AV6 B;  4H9R A;  5B2I D;  3KXB C;  3AYW D;  4H9O B;  5B0Y D;  4KGC A;  2NZD C;  5AV5 C;  4Z5T A;  1P3K D;  5DNN D;  5JRG C;  3KWQ A;  4R8P B;  3REH A;  5B2J B;  4J8V B;  4YM6 B;  1AOI C;  1ID3 D;  3UTB B;  3KUY D;  1P3P B;  5GXQ C;  3AZJ C;  3REJ D;  2UWX A;  4H9O A;  5CPJ D;  1B67 A;  3AV2 C;  5DNM C;  1EQZ D;  1HTA A;  3AZG D;  5F99 D;  2XD1 A;  3AZI D;  2PYO C;  4J8W B;  4R8P A;  3WA9 D;  5B2J A;  4WNN B;  4YM6 A;  3LZ1 D;  4J8V A;  3LEL A;  3TU4 B;  3X1T B;  5B40 B;  3UTB A;  4Z2M G;  1ZLA C;  5AV6 D;  5AVC D;  1M19 C;  5CPK B;  4WNN A;  3X1T A;  3WKJ B;  2F2A C;  3UTA C;  5B40 A;  4R8P D;  4J8U B;  4DRA A;  4G91 B;  4J8V D;  1P3G B;  4QLC C;  5GT0 B;  4UUZ B;  2YFW B;  2BYK B;  1P3P D;  5KDM A;  3A6N A;  4KUD B;  2HUE B;  3AZH B;  1PZR A;  5CPK A;  4KGC C;  2ZY5 A;  3MNN A;  5B1M B;  4Z5T C;  4EO5 B;  5B31 B;  3KWQ C;  4J8W D;  5FUG B;  4J8U A;  3REH C;  4Z66 B;  3TU4 D;  3X1T D;  1P3G A;  5CHL B;  4DRB A;  5GT0 A;  4YS3 C;  2W8S A;  2YFW A;  4KUD A;  3AZH A;  1JFI B;  3MGQ B;  5B33 D;  4E44 A;  3X1S B; 
#chains in the Genus database with same CATH homology
 3W96 B;  5B1M A;  3NQJ B;  3AZE A;  3A1K A;  3W98 B;  5FUG A;  4Z66 A;  3WKJ D;  4JJN B;  3LEL C;  3AZL D;  3UTB C;  5GT0 D;  2ARO D;  2RVQ D;  3AZM C;  3MGQ A;  1JFI A;  4LD9 B;  3W96 A;  1F66 C;  3AZK B;  5B31 D;  2Y2K A;  3MVD C;  5B40 C;  4Z66 D;  5G49 B;  5AV9 C;  3REK A;  4LD9 A;  3A6N C;  2IO5 B;  5CPK C;  3LZ0 C;  3MGQ D;  1P3O B;  3C1C C;  5B32 B;  5AY8 C;  3X1S D;  1P3I A;  3W96 D;  5E5A D;  3MNN C;  3AZK A;  1M1A A;  1ULY A;  4ZBJ C;  4AWL C;  3W98 D;  1KX5 C;  4JJN D;  1P3G C;  1P34 A;  5G49 A;  2Y2H A;  4KUD C;  2HUE C;  3AZH C;  2Y2N A;  1P3L D;  1P3O A;  1TZY D;  1P3F B;  3AZE C;  1H3O B;  3AZK D;  3IP4 C;  3AV1 D;  1HQ3 D;  5B2I B;  1P3F A;  2NQB C;  5B0Y B;  1TAF A;  5B32 D;  1H3O A;  2Y2L A;  3REL D;  5B1L B;  2F8N G;  4HGA C;  4H9N B;  2YFV B;  2RIQ A;  3WAA B;  3EPH A;  4M6B A;  1ID3 B;  3KUY B;  3REK C;  5B2I A;  2FJ7 D;  3AYW A;  3REJ B;  5B0Y A;  5CPJ B;  3WTP B;  3AFA C;  1P3I C;  4NE6 A;  3AZG B;  4WU9 D;  1P3K A;  5DNN A;  1P3A D;  5B1L A;  1M1A C;  3WA9 B;  4H9N A;  2YFV A;  4DQY B;  3LZ1 B;  3WAA A;  1ID3 A;  5CPI B;  1P34 C;  3KUY A;  4H9S A;  3X1U C;  3KXB D;  3REJ A;  3W97 B;  5CPJ A;  2IO5 C;  1S32 C;  3AZF D;  1KX4 C;  1KX3 D;  3WTP A;  5AVC B;  5AV5 D;  1EQZ A;  5AVB C;  3AZG A;  1P3M B;  5JRG D;  5F99 A;  3MGR C;  3AZI A;  3WA9 A;  3AN2 C;  2Y2P A;  3LZ1 A;  5B1L D;  4WJ3 C;  3V9R B;  1U35 B;  3WAA D;  4J8X B;  3W97 A;  3MGS C;  2HIO B;  1R4V A;  5AV6 A;  5AVC A;  2Y2M A;  4H9P B;  1P3F C;  5BO0 B;  3REI B;  1P3M A;  3WTP D;  2PYO D;  2F8N K;  4E45 A;  3MGP C;  3V9R A;  1U35 A;  1BFM A;  5CPI D;  4J8X A;  2HIO A;  1P3P A;  5B2I C;  2LY8 A;  4H9P A;  3AYW C;  3W97 D;  5B0Y C;  3REI A;  5B33 B;  5BT1 D;  2ZM5 A;  1P3K C;  1P3M D;  5DNN C;  4X23 B;  4J8W A;  3TU4 A;  4QLC D;  1ID3 C;  3AZL B;  1U35 D;  4H9S C;  5B0Z C;  4J8X D;  2ARO B;  3F6T A;  2HIO D;  5CPJ C;  2VQR A;  5B33 A;  1EQZ C;  3REI D;  3AZG C;  5GSU B;  3R45 B;  5F99 C;  3AZI C;  3B0D C;  3WKJ A;  4XUJ B;  3LZ1 C;  4WU8 B;  5BNV B;  3AZL A;  3B0C W;  5B24 B;  3AZN B;  2ARO A;  4UUZ A;  2BYK A;  5AV6 C;  5GSU A;  3R45 A;  5E5A B;  5B31 A;  1WWI A;  4WU8 A;  4X23 D;  5BNV A;  4R8P C;  5B2J C;  4J8V C;  5B24 A;  4YM6 C;  3AZN A;  1P3P C;  1B6W A;  1F66 D;  1P3L B;  1TZY B;  3X1S A;  5E5A A;  3NQJ A;  3W99 B;  5GSU D;  3W98 A;  3KSY A;  4ZUX B;  4J8W C;  5JA4 B;  4XUJ D;  4JJN A;  3TU4 C;  3X1T C;  4WU8 D;  5AV9 D;  3AV1 B;  5GT3 B;  1HQ3 B;  5B24 D;  3AZN D;  2CV5 B;  3LZ0 D;  1P3L A;  1BH8 B;  1TZY A;  4WZS B;  4G92 B;  3REL B;  3LJA D;  3VH5 W;  3VH6 T;  4ZUX A;  2ZY3 A;  4H9Q B;  3WKJ C;  1KX5 D;  3AV1 A;  5GT3 A;  4CAY B;  3B6F D;  4J8U C;  4G91 C;  1HQ3 A;  4NE5 A;  5GT0 C;  2RVQ C;  1N1J B;  1BH8 A;  2FJ7 B;  4XZQ B;  3C1B D;  1T3U A;  3B0C T;  5B32 A;  3REL A;  4WU9 B;  5B1M C;  1P3A B;  4EO5 C;  4H9Q A;  3X1V B;  2JE5 A;  3W99 D;  5B31 C;  4ZUX D;  4CAY A;  4Z66 C;  5CP6 B;  5GT3 D;  3O62 D;  2FJ7 A;  3KXB B;  2NQB D;  2BYM B;  3AZF B;  2CV5 D;  2NZD B;  3MGQ C;  1KX3 B;  2Y2G A;  5AV5 B;  3X1S C;  4WU9 A;  3W96 C;  3H0L C;  5E5A C;  1P3A A;  5JRG B;  5BNX B;  5BS7 A;  3UT9 D;  3B6G D;  3W98 C;  1AOI B;  4JJN C;  5CP6 A;  1P3B D;  3A1I A;  5GXQ B;  4Z2M H;  3AZJ B;  4NE3 A;  3KXB A;  2BYM A;  3AZF A;  1KX3 A;  5AV5 A;  5DNM B;  4XZQ D;  1TZY C;  3AV2 B;  2L5A A;  1P3L C;  2F8N B;  4LD9 C;  1M18 D;  5JRG A;  5BNX A;  1F1E A;  2PYO B;  3AZK C;  3X1V D;  1AOI A;  3EPL A;  3AV1 C;  5AV8 D;  5GXQ A;  1HQ3 C;  5CP6 D;  3VH5 T;  1KX4 D;  2F8N A;  1M19 B;  5AVB D;  2NZD D;  3MGR D;  1P3O C;  2PYO A;  5B32 C;  3EPK A;  3UTA B;  3B0B A;  5CPI A;  4QLC B;  1AOI D;  2ZY2 A;  5GXQ D;  3AZJ D;  4KGC B;  3AV2 D;  5DNM D;  2F8N D;  1Z2C B;  2ZY4 A;  4Z5T B;  4WU9 C;  1P3A C;  3MGP D;  3KWQ B;  3UTA A;  4QLC A;  4YS3 B;  2FFF B;  1ZLA D;  3AZF C;  1KX3 C;  1M19 D;  5BO0 A;  3EPJ A;  2DF4 C;  2G5I C;  5B1L C;  3H0R C;  3LEL B;  3UTA D;  4YS3 A;  3WAA C;  2Y2O A;  5B0Z D;  3AZM B;  3KUY C;  3VH6 W;  1F66 B;  3REJ C;  4KGC D;  3WTP C;  3NQU B;  4Z5T D;  4X23 A;  3KWQ D;  3WA9 C;  3MVD B;  3REH D;  5CPI C;  5AV9 B;  4YS3 D;  3AZM A;  2DQN C;  5KDM B;  3A6N B;  1F66 A;  3W97 C;  3LZ0 B;  1A7W A;  3C1C B;  3NQU A;  5AY8 B;  5AVC C;  5BT1 C;  3MNN B;  1P3M C;  4ZBJ B;  3LJA B;  4AWL B;  3MVD A;  5B2J D;  4XUJ A;  1KX5 B;  4YM6 D;  5AV9 A;  3LEL D;  3B6F B;  3UTB D;  1U35 C;  5B31 G;  4J8X C;  3AZM D;  2HIO C;  3LZ0 A;  3C1C A;  5AY8 A;  3C1B B;  3REI C;  3AZE B;  3LJA A;  2Y2Q A;  2Y2J A;  2F8N H;  1KX5 A;  3B6F A;  5B40 D;  3MVD D;  3O62 B;  3A6N D;  2NQB B;  5CPK D;  3C1B A;  2JSS A;  4UPK A;  4CSR B;  5B33 C;  3C1C D;  2Y2I A;  5AY8 D;  3MNN D;  3W99 A;  3UT9 B;  4HGA B;  4X23 C;  3B6G B;  4J8U D;  1BH9 B;  4NFT A;  5C3I B;  5JA4 A;  1P3G D;  3REK B;  3AZL C;  1P3B B;  3O62 A;  2NQB A;  4KUD D;  3AZH D;  2ARO C;  2CV5 A;  4CSR A;  3AFA B;  2JCH A;  1Q9C A;  1P3I B;  1M18 B;  5B1M D;  1M1A B;  3AZE D;  2J8P A;  3UT9 A;  4WV4 B;  5GSU C;  3B6G A;  1BH9 A;  4XUJ C;  1P34 B;  5B32 G;  4WU8 C;  3H0M C;  1P3B A;  3VH6 A;  5AV8 B;  3X1U B;  3P5J B;  5B24 C;  3AZN C;  1S32 B;  1N1J A;  1KX4 B;  3AFA A;  4XZQ A;  5AVB B;  3AL0 C;  1M18 A;  3MGR B;  3AN2 B;  3LJA C;  3X1V A;  3KFU G;  2BG1 A;  3B6F C;  5AV8 A;  3X1U A;  3MGS B;  3REK D;  1S32 A;  1KX4 A;  3WTP E;  4LD9 D;  5AVB A;  2NZD A;  3C1B C;  3AFA D;  3MGR A;  1TAF B;  3AN2 A;  1P3I D;  1M1A D;  3MGP B;  2CWE A;  3FDD A;  3W99 C;  4ZUX C;  1P34 D;  3MGS A;  5GT3 C;  3O62 C;  3X1U D;  3AZJ A;  1ZLA B;  3AYW B;  1S32 D;  2G5H C;  2CV5 C;  3AV2 A;  5DNM A;  2XD5 A;  1P3O D;  1WWS A;  1P3K B;  5DNN B;  3MGP A;  4G92 C;  3REL C;  3AN2 D;  3UT9 C;  3B6G C;  4KHA B;  5C3I C;  1P3B C;  5B0Z B;  1ZLA A;  3MGS D;  4H9R B;  1M19 A;  2FJ7 C;  4XZQ C;  1EQZ B;  1P3F D;  1M18 C;  3VH5 A;  5F99 B;  3AZI B;  1W2E A;  3B0D B;  3EG5 B;  4KHA A;  3X1V C;  5BS7 C;  3REH B;  5AV8 C;  1KU5 A;  5B0Z A;  5CP6 C;  5AV6 B;  4H9R A;  5B2I D;  3KXB C;  3AYW D;  4H9O B;  5B0Y D;  4KGC A;  2NZD C;  5AV5 C;  4Z5T A;  1P3K D;  5DNN D;  5JRG C;  3KWQ A;  4R8P B;  3REH A;  5B2J B;  4J8V B;  4YM6 B;  1AOI C;  1ID3 D;  3UTB B;  3KUY D;  1P3P B;  5GXQ C;  3AZJ C;  3REJ D;  2UWX A;  4H9O A;  5CPJ D;  1B67 A;  3AV2 C;  5DNM C;  1EQZ D;  1HTA A;  3AZG D;  5F99 D;  2XD1 A;  3AZI D;  2PYO C;  4J8W B;  4R8P A;  3WA9 D;  5B2J A;  4WNN B;  4YM6 A;  3LZ1 D;  4J8V A;  3LEL A;  3TU4 B;  3X1T B;  5B40 B;  3UTB A;  4Z2M G;  1ZLA C;  5AV6 D;  5AVC D;  1M19 C;  5CPK B;  4WNN A;  3X1T A;  3WKJ B;  2F2A C;  3UTA C;  5B40 A;  4R8P D;  4J8U B;  4DRA A;  4G91 B;  4J8V D;  1P3G B;  4QLC C;  5GT0 B;  4UUZ B;  2YFW B;  2BYK B;  1P3P D;  5KDM A;  3A6N A;  4KUD B;  2HUE B;  3AZH B;  1PZR A;  5CPK A;  4KGC C;  2ZY5 A;  3MNN A;  5B1M B;  4Z5T C;  4EO5 B;  5B31 B;  3KWQ C;  4J8W D;  5FUG B;  4J8U A;  3REH C;  4Z66 B;  3TU4 D;  3X1T D;  1P3G A;  5CHL B;  4DRB A;  5GT0 A;  4YS3 C;  2W8S A;  2YFW A;  4KUD A;  3AZH A;  1JFI B;  3MGQ B;  5B33 D;  4E44 A;  3X1S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...