2PYOA

Drosophila nucleosome core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoA00
5F99C 1P3IA 4XZQB 2YFWB 3MGPC 3AZKC 4X23A 1TAFB 5BO0A 3LZ1A 3VH5A 4J8WA 4XUJA 1BFMA 3AZMA 1TZYA 3X1TB 4Z66B 5B40B 2FJ7C 3REJA 1EQZB 3MVDB 1ZLAB 1S32A 3A6NA 4UUZA 3LJAA 5AV5B 5GT0A 3B6FC 3UTAC 2PYOD 1BH8B 3LELD 2NQBA 3W97C 3AV1D 4G92B 3AFAD 3C1BC 3REHD 3AZFD 1AOID 1U35D 5JRGB 3W96D 3KUYD 3X1VD 5AV9A 3REKA 3AZNC 1P3IB 1P34D 4H9SA 4X23B 5BO0B 4LD9B 3LZ1B 3RELB 4J8WB 5BT1D 4XUJB 3AZMB 1P3KD 5GSUD 1JFIB 5C3IB 3MNNA 4XZQD 3REJB 1S32B 3A6NB 4Z2MG 5DNMC 3UT9A 3WA9B 5GT0B 5B24D 3X1TD 3NQJA 5DNNA 5B40D 4H9QB 5AY8A 4Z66D 1EQZD 1ZLAD 2NQBB 3AZLA 1M18C 3WAAA 3TU4A 3UTAB 5AV5D 4J8XA 3W97B 3X1UD 4R8PA 5AV9B 4QLCA 1KX5A 4ZUXA 3MGQA 1ID3A 4J8UC 5CPJC 1KX4A 5B2JA 3MNNB 1P3ID 4M6BA 5CHLB 4X23D 3B0CT 3AZIB 3LZ1D 4J8WD 4XUJD 3AZMD 4YS3A 1TZYD 3NQJB 5DNNB 2BYMA 5B1MA 5AY8B 3KWQA 3REJD 5DNMB 1S32D 3AZLB 3A6ND 4WU8A 1P3AA 5CP6B 3C1CA 3TU4B 3WA9D 5GT0D 1B67A 5B32G 2HIOA 5BNXA 2NQBD 3LELC 4QLCB 3AV1C 1KX5B 3MGQB 3AFAC 5E5AA 5GXQA 3REHC 3AZFC 5B0ZA 1ID3B 2IO5C 1U35C 1AOIC 2JSSA 5AV9D 3X1VC 3KUYC 4J8UB 1P3MA 5B31A 1P34C 2LY8A 5B0YB 5G49A 5BT1C 5AVBA 4YS3B 1P3KC 5GSUC 3MNND 2BYMB 3VH6T 3KWQB 3MGRA 4XZQC 3AZHB 4WU8B 3AZID 3C1CB 3UT9D 5B2IA 3WKJA 5DNND 5B24C 5AY8D 3X1TC 2HIOB 5BNXB 4Z66C 5B40C 5BS7C 3AZLD 1EQZC 3MVDC 1B6WA 5CP6D 1ZLAC 3TU4D 3WAAD 1HQ3A 2PYOB 5GXQB 5E5AB 4J8XD 5AV5C 5B0ZB 4R8PD 3AFAB 2CV5A 4QLCD 1U35B 1P3MB 4G92C 4ZUXD 1KX5D 3MGQD 5B31B 1ULYA 3W96B 1ID3D 3VH5W 5G49B 1KX4D 5B2JD 4CSRA 4KHAA 3MGRB 1P3IC 3AV2A 4X23C 3LZ1C 3AZEA 5GT3A 4J8WC 4YS3D 3X1SA 4XUJC 3AZMC 5C3IC 1TZYC 5B1MD 3KWQD 1P3AD 3AZHD 3REJC 4WU8D 1S32C 3C1CD 3A6NC 5B24B 4H9NA 3VH6A 4WNNA 5AV6B 3WA9C 5GT0C 1P3BA 2HIOD 5B33A 1Q9CA 2NQBC 3AN2B 1P3OA 3R45A 3X1UB 5GXQD 4NE6A 5E5AD 5B0ZD 3KXBA 3V9RA 2HUEB 4WV4B 4CSRB 5AV9C 4KHAB 1P3MD 5B31D 4H9SC 3AV2B 3B6GA 1H3OB 3AZEB 5GT3B 5B1LA 5AVBD 4CAYA 3MNNC 3MGRD 4AWLB 3AZJA 3AZIC 2YFVA 1TZYB 4H9NB 1A7WA 2CWEA 3WKJD 5AV8A 3MGSA 4UUZB 3LJAB 1P3BB 1F66A 5DNNC 5AY8C 5B33B 3AZLC 5CP6C 1P3OB 1HQ3D 3TU4C 5AV6D 3V9RB 5CPIA 2CV5D 3AN2D 4QLCC 4WZSB 4ZUXC 1P3FA 3MGQC 1KX5C 1N1JA 3B6GB 3UTBA 1ID3C 4KUDA 5B1LB 3REKB 5B32A 1KX4C 4CAYB 3REIA 3AV2D 2RVQD 4J8VA 2YFVB 5B0YC 3AZED 5GT3D 3X1SD 4YS3C 2F8NG 5AV8B 3MGSB 1F66B 5JA4A 4HGAB 5B1MC 4DRAA 4Z5TA 3KWQC 3UT9B 3AZHC 4WU8C 4H9PA 1M1AA 3C1CC 1P3GA 4YM6A 3LJAD 1P3BD 3WAAB 5B33D 1P3PA 2HIOC 4E44A 4J8XB 1P3OD 3O62A 3LZ0A 1P3FB 4R8PB 1N1JB 2PYOC 3NQUA 5E5AC 5GXQC 5B0ZC 2F8NH 5B32B 4ZUXB 1M19A 1P3MC 5CPJA 5B31C 3B6GD 1KX4B 5B2JB 3AZGA 3W96C 1BH9A 5B1LD 1P3LA 3REKD 3B0CW 5JA4B 2NZDA 3MGRC 4Z5TB 3AZJD 4H9PB 1M1AB 5B1MB 5AV8D 3MGSD 1P3AB 1KX3A 4YM6B 1F66D 4EO5B 1P3PB 2AROA 4WU9A 3LZ0B 1HQ3C 5AV6C 2F8NK 5CPID 3AZFA 4KGCA 2CV5C 1M19B 3AYWA 3AN2C 1P3FD 3X1UC 3KUYA 3UTBD 5AVCA 3AZGB 1BH9B 4KUDD 5B32D 2HUEC 1WWIA 4NE5A 2NZDB 3REID 1BH8A 5AVBB 4J8VD 3AV2C 2RVQC 3AZEC 3VH6W 1F1EA 5GT3C 2YFWA 3X1SC 4JJNA 1TAFA 4AWLC 4Z5TD 2AROB 5B2IB 1M1AD 3WKJB 3B0DB 4WU9B 3W99A 5BS7A 5FUGA 3MVDA 1P3GD 4YM6D 3LJAC 1P3BC 1P3PD 1HQ3B 4E45A 5AV5A 5B33C 3AYWB 3O62D 3LZ0D 1P3OC 5AVCB 3WTPA 2CV5B 2BYKA 5JRGA 1M19D 3AZGD 3B6GC 1P3LD 3W98A 5B1LC 3REKC 4JJNB 5CPKA 4LD9A 2NZDD 3RELA 5F99A 3X1SB 3MGPA 3AZJC 3AZKA 1JFIA 3W99B 5FUGB 1KX3D 3B0BA 5AV8C 3MGSC 1F66C 4H9RA 2FJ7A 4HGAC 2AROD 4WNNB 5B2ID 3WA9A 3UT9C 4G91B 4WU9D 4H9QA 3WTPB 2F8NA 3B6FA 5CPIC 3UTAA 3R45B 2BYKB 3WAAC 4KGCD 3W97A 3KXBB 3AYWD 4J8XC 4H9OA 3C1BA 1P3FC 5AVCD 4R8PC 3UTBC 3W98B 4KUDC 4ZBJB 5B32C 5CPKB 5F99B 3AZNA 3REIC 3AZKB 3MGPB 5B2JC 4J8VC 4JJND 3AZJB 3AZIA 4H9RB 2FJ7B 4Z5TC 5BNVA 3W99D 1M1AC 3MVDD 5DNMA 2F8NB 1P3GC 1P3AC 5CP6A 3B6FB 4YM6C 4EO5C 1P3PC 1M18A 4H9OB 3O62C 3LZ0C 3C1BB 5CPIB 3WTPD 4Z2MH 5JRGD 3KXBD 3UTBB 1M19C 3AZNB 4KUDB 3W98D 3AZGC 4J8UA 4NE3A 1P3LC 3REIB 5CPKD 4LD9D 5B0YA 3RELD 4J8VB 5F99D 2NZDC 3AZKD 5BNVB 3MGPD 5AVBC 4DRBA 3AZHA 1KX3C 2FJ7D 2AROC 5B2IC 1P3GB 1M18B 3WKJC 5KDMA 3B0DC 4WU9C 2F8ND 4NFTA 3B6FD 3UTAD 3O62B 2PYOA 3W97D 4KGCC 3NQUB 3LELA 3AV1A 3AYWC 3C1BD 3AFAA 3REHA 5AVCC 1AOIA 1U35A 5CPJB 3W96A 1HTAA 3X1VA 3AZND 1P3LB 3VH5T 1P34A 4JJNC 1P3KA 5GSUA 4XZQA 1KX3B 2L5AA 5KDMB 3W99C 5DNMD 1KU5A 5B24A 3X1TA 5B40A 4Z66A 5AV6A 1EQZA 3LELB 1M18D 1ZLAA 3AV1B 4G91C 3KSYA 5B31G 3REHB 3AZFB 1AOIB 3WTPC 4KGCB 2IO5B 3AN2A 1R4VA 3X1UA 3WTPE 3KUYB 5JRGC 3X1VB 3KXBC 1P34B 4J8UD 1WWSA 3W98C 5CPJD 4ZBJC 5B0YD 1H3OA 1P3KB 5GSUB 5CPKC 4LD9C 3RELC
chains in the Genus database with same CATH superfamily
5F99C 1P3IA 4XZQB 2YFWB 3MGPC 3AZKC 4X23A 2Y2QA 1TAFB 5BO0A 3LZ1A 3VH5A 4J8WA 4XUJA 1BFMA 3AZMA 1TZYA 3X1TB 4Z66B 5B40B 2DF4C 2FJ7C 3REJA 1EQZB 3MVDB 1ZLAB 1S32A 3A6NA 4UUZA 3LJAA 5AV5B 5GT0A 3B6FC 3UTAC 2PYOD 1BH8B 3LELD 2NQBA 3W97C 3AV1D 4G92B 1Z2CB 3AFAD 3C1BC 3REHD 3AZFD 1AOID 3P5JB 1U35D 5JRGB 2VQRA 3W96D 3EG5B 3KUYD 3X1VD 5AV9A 3REKA 3AZNC 1P3IB 1P34D 4H9SA 4X23B 5BO0B 4LD9B 3LZ1B 3RELB 4J8WB 5BT1D 4XUJB 3AZMB 1P3KD 5GSUD 1JFIB 5C3IB 3MNNA 4XZQD 3REJB 1S32B 3A6NB 4Z2MG 2Y2JA 5DNMC 3UT9A 3WA9B 5GT0B 5B24D 3X1TD 3NQJA 5B40D 5DNNA 4H9QB 5AY8A 4Z66D 1EQZD 1ZLAD 2NQBB 3AZLA 1M18C 3WAAA 3A1IA 3TU4A 3UTAB 5AV5D 3F6TA 4J8XA 3W97B 3X1UD 4R8PA 5AV9B 4QLCA 1KX5A 4ZUXA 3MGQA 1ID3A 4J8UC 1T3UA 5CPJC 1KX4A 5B2JA 3MNNB 1P3ID 2Y2OA 4M6BA 5CHLB 4X23D 3B0CT 3AZIB 3LZ1D 4J8WD 4XUJD 3AZMD 4YS3A 1TZYD 3NQJB 5DNNB 2BYMA 5B1MA 5AY8B 3KWQA 3REJD 5DNMB 1S32D 3AZLB 3A6ND 4WU8A 1P3AA 5CP6B 3C1CA 3TU4B 3WA9D 5GT0D 1B67A 5B32G 2HIOA 5BNXA 2NQBD 3LELC 4QLCB 3AV1C 1KX5B 3MGQB 3AFAC 2Y2LA 5E5AA 5GXQA 3REHC 5B0ZA 3AZFC 2IO5C 1U35C 1ID3B 2JSSA 1AOIC 5AV9D 3X1VC 3KUYC 4J8UB 1P3MA 5B31A 1P34C 2LY8A 5B0YB 5G49A 5BT1C 5AVBA 4YS3B 1P3KC 5GSUC 3MNND 2BYMB 3VH6T 3KWQB 3MGRA 4XZQC 3AZHB 4WU8B 3AZID 3C1CB 3UT9D 5B2IA 3WKJA 5DNND 5B24C 5AY8D 3X1TC 2HIOB 5BNXB 4Z66C 5B40C 5BS7C 3AZLD 1EQZC 3MVDC 1B6WA 5CP6D 1ZLAC 3TU4D 3WAAD 1HQ3A 2PYOB 5GXQB 5E5AB 4J8XD 5AV5C 5B0ZB 4R8PD 3AFAB 2CV5A 4QLCD 1U35B 1P3MB 2F2AC 4ZUXD 4G92C 3MGQD 5B31B 1KX5D 3EPHA 2ZY4A 1ULYA 3W96B 2Y2GA 1ID3D 3VH5W 3EPLA 5G49B 1KX4D 5B2JD 2ZY3A 4CSRA 4KHAA 3MGRB 1P3IC 3AV2A 4X23C 3LZ1C 3AZEA 3IP4C 5GT3A 4J8WC 4YS3D 3X1SA 4XUJC 3AZMC 4WJ3C 5C3IC 1TZYC 5B1MD 3KWQD 1P3AD 3AZHD 3REJC 4WU8D 1S32C 1W2EA 2DQNC 3A6NC 3C1CD 5B24B 4H9NA 3VH6A 4WNNA 5AV6B 3WA9C 2ZM5A 5GT0C 1P3BA 2HIOD 5B33A 1Q9CA 2NQBC 3AN2B 1P3OA 3R45A 3X1UB 2ZY2A 4NE6A 3H0RC 5GXQD 5E5AD 5B0ZD 3KXBA 3V9RA 2HUEB 2UWXA 4WV4B 4CSRB 5AV9C 4KHAB 1P3MD 5B31D 1PZRA 4H9SC 3AV2B 3B6GA 1H3OB 3H0MC 3AZEB 5GT3B 5B1LA 5AVBD 4CAYA 3MNNC 3MGRD 4AWLB 3AZJA 3AZIC 2YFVA 1TZYB 4H9NB 1A7WA 2CWEA 3WKJD 5AV8A 3MGSA 4UUZB 3LJAB 1P3BB 1F66A 5DNNC 5AY8C 5B33B 3AZLC 5CP6C 1P3OB 1HQ3D 3TU4C 5AV6D 3V9RB 5CPIA 2JE5A 2CV5D 3AN2D 4QLCC 2W8SA 4WZSB 4ZUXC 1P3FA 3MGQC 1KX5C 1N1JA 3B6GB 3UTBA 1ID3C 4KUDA 5B1LB 3REKB 5B32A 1KX4C 4CAYB 3REIA 3AV2D 2RVQD 4J8VA 2YFVB 5B0YC 3AZED 5GT3D 3X1SD 4YS3C 2F8NG 5AV8B 3MGSB 1F66B 5JA4A 4HGAB 5B1MC 4DRAA 4Z5TA 3KWQC 3UT9B 3AZHC 4WU8C 4H9PA 1M1AA 3C1CC 1P3GA 4YM6A 3LJAD 1P3BD 3WAAB 5B33D 1P3PA 2HIOC 4E44A 4UPKA 4J8XB 1P3OD 3O62A 3LZ0A 1P3FB 4R8PB 1N1JB 2PYOC 3NQUA 5E5AC 5GXQC 5B0ZC 2F8NH 5B32B 3H0LC 4ZUXB 1M19A 1P3MC 5CPJA 5B31C 3B6GD 1KX4B 5B2JB 3AZGA 3W96C 1BH9A 5B1LD 1P3LA 3REKD 2FFFB 3KFUG 3A1KA 3B0CW 5JA4B 2NZDA 3MGRC 4Z5TB 3AZJD 2XD5A 4H9PB 1M1AB 5B1MB 5AV8D 3MGSD 1P3AB 1KX3A 4YM6B 1F66D 4EO5B 1P3PB 2Y2IA 2AROA 4WU9A 3LZ0B 1HQ3C 5AV6C 2F8NK 2Y2MA 5CPID 3AZFA 4KGCA 2CV5C 1M19B 3AYWA 3AN2C 1P3FD 3X1UC 3KUYA 3UTBD 5AVCA 3AZGB 1BH9B 4KUDD 5B32D 2HUEC 1WWIA 4NE5A 2NZDB 3REID 1BH8A 5AVBB 4J8VD 3AV2C 2RVQC 3AZEC 3VH6W 1F1EA 5GT3C 2YFWA 3X1SC 4JJNA 1TAFA 4AWLC 4Z5TD 2AROB 5B2IB 1M1AD 3WKJB 3B0DB 4WU9B 3W99A 5BS7A 5FUGA 3MVDA 1P3GD 4YM6D 3LJAC 1P3BC 1P3PD 1HQ3B 4E45A 5AV5A 5B33C 3AYWB 3O62D 3LZ0D 1P3OC 5AVCB 3WTPA 2CV5B 2BYKA 5JRGA 1M19D 2Y2KA 3AZGD 3B6GC 1P3LD 3W98A 5B1LC 3REKC 4JJNB 5CPKA 4LD9A 2NZDD 2BG1A 4DQYB 3RELA 5F99A 3X1SB 3MGPA 3AZJC 3AZKA 1JFIA 3W99B 5FUGB 1KX3D 3B0BA 5AV8C 3MGSC 1F66C 4H9RA 2FJ7A 4HGAC 2AROD 4WNNB 5B2ID 3WA9A 3UT9C 4G91B 4WU9D 4H9QA 2J8PA 3WTPB 2F8NA 3B6FA 2Y2HA 5CPIC 3UTAA 3R45B 2BYKB 3WAAC 4KGCD 2Y2NA 3W97A 3KXBB 3AYWD 4J8XC 4H9OA 3C1BA 1P3FC 4R8PC 5AVCD 3UTBC 3W98B 4KUDC 4ZBJB 5B32C 5CPKB 5F99B 3AZNA 3REIC 3AZKB 3MGPB 5B2JC 4J8VC 4JJND 3AZJB 3AZIA 4H9RB 2FJ7B 2RIQA 4Z5TC 5BNVA 2G5IC 3W99D 1M1AC 3MVDD 5DNMA 3EPKA 2F8NB 1P3GC 1P3AC 5CP6A 3B6FB 4YM6C 2Y2PA 4EO5C 1P3PC 1M18A 2XD1A 4H9OB 3O62C 3LZ0C 3C1BB 5CPIB 3WTPD 4Z2MH 5JRGD 3AL0C 3KXBD 3UTBB 1M19C 3AZNB 4KUDB 2JCHA 3W98D 3AZGC 4J8UA 4NE3A 1P3LC 3REIB 5CPKD 4LD9D 5B0YA 3RELD 4J8VB 5F99D 2NZDC 3AZKD 5BNVB 3MGPD 3FDDA 5AVBC 4DRBA 3AZHA 1KX3C 2FJ7D 2AROC 5B2IC 1P3GB 1M18B 3EPJA 3WKJC 5KDMA 3B0DC 4WU9C 2F8ND 4NFTA 3B6FD 2ZY5A 3UTAD 3O62B 2G5HC 2PYOA 3W97D 4KGCC 3NQUB 3LELA 3AV1A 3AYWC 3C1BD 3AFAA 3REHA 5AVCC 1AOIA 1U35A 5CPJB 3W96A 1HTAA 3X1VA 3AZND 1P3LB 3VH5T 1P34A 4JJNC 1P3KA 5GSUA 4XZQA 1KX3B 2L5AA 5KDMB 3W99C 5DNMD 1KU5A 5B24A 3X1TA 5B40A 4Z66A 5AV6A 1EQZA 3LELB 1M18D 1ZLAA 3AV1B 4G91C 3KSYA 5B31G 3REHB 3AZFB 1AOIB 3WTPC 4KGCB 2IO5B 3AN2A 1R4VA 3X1UA 3WTPE 3KUYB 5JRGC 3X1VB 3KXBC 1P34B 4J8UD 1WWSA 3W98C 5CPJD 4ZBJC 5B0YD 1H3OA 1P3KB 5GSUB 5CPKC 4LD9C 3RELC
chains in the Genus database with same CATH topology
5F99C 1P3IA 4XZQB 2YFWB 3MGPC 3AZKC 4X23A 2Y2QA 1TAFB 5BO0A 3LZ1A 3VH5A 4J8WA 4XUJA 1BFMA 3AZMA 1TZYA 3X1TB 4Z66B 5B40B 2DF4C 2FJ7C 3REJA 1EQZB 3MVDB 1ZLAB 1S32A 3A6NA 4UUZA 3LJAA 5AV5B 5GT0A 3B6FC 3UTAC 2PYOD 1BH8B 3LELD 2NQBA 3W97C 3AV1D 4G92B 1Z2CB 3AFAD 3C1BC 3REHD 3AZFD 1AOID 3P5JB 1U35D 5JRGB 2VQRA 3W96D 3EG5B 3KUYD 3X1VD 5AV9A 3REKA 3AZNC 1P3IB 1P34D 4H9SA 4X23B 5BO0B 4LD9B 3LZ1B 3RELB 4J8WB 5BT1D 4XUJB 3AZMB 1P3KD 5GSUD 1JFIB 5C3IB 3MNNA 4XZQD 3REJB 1S32B 3A6NB 4Z2MG 2Y2JA 5DNMC 3UT9A 3WA9B 5GT0B 5B24D 3X1TD 3NQJA 5B40D 5DNNA 4H9QB 5AY8A 4Z66D 1EQZD 1ZLAD 2NQBB 3AZLA 1M18C 3WAAA 3A1IA 3TU4A 3UTAB 5AV5D 3F6TA 4J8XA 3W97B 3X1UD 4R8PA 5AV9B 4QLCA 1KX5A 4ZUXA 3MGQA 1ID3A 4J8UC 1T3UA 5CPJC 1KX4A 5B2JA 3MNNB 1P3ID 2Y2OA 4M6BA 5CHLB 4X23D 3B0CT 3AZIB 3LZ1D 4J8WD 4XUJD 3AZMD 4YS3A 1TZYD 3NQJB 5DNNB 2BYMA 5B1MA 5AY8B 3KWQA 3REJD 5DNMB 1S32D 3AZLB 3A6ND 4WU8A 1P3AA 5CP6B 3C1CA 3TU4B 3WA9D 5GT0D 1B67A 5B32G 2HIOA 5BNXA 2NQBD 3LELC 4QLCB 3AV1C 1KX5B 3MGQB 3AFAC 2Y2LA 5E5AA 5GXQA 3REHC 5B0ZA 3AZFC 2IO5C 1U35C 1ID3B 2JSSA 1AOIC 5AV9D 3X1VC 3KUYC 4J8UB 1P3MA 5B31A 1P34C 2LY8A 5B0YB 5G49A 5BT1C 5AVBA 4YS3B 1P3KC 5GSUC 3MNND 2BYMB 3VH6T 3KWQB 3MGRA 4XZQC 3AZHB 4WU8B 3AZID 3C1CB 3UT9D 5B2IA 3WKJA 5DNND 5B24C 5AY8D 3X1TC 2HIOB 5BNXB 4Z66C 5B40C 5BS7C 3AZLD 1EQZC 3MVDC 1B6WA 5CP6D 1ZLAC 3TU4D 3WAAD 1HQ3A 2PYOB 5GXQB 5E5AB 4J8XD 5AV5C 5B0ZB 4R8PD 3AFAB 2CV5A 4QLCD 1U35B 1P3MB 2F2AC 4ZUXD 4G92C 3MGQD 5B31B 1KX5D 3EPHA 2ZY4A 1ULYA 3W96B 2Y2GA 1ID3D 3VH5W 3EPLA 5G49B 1KX4D 5B2JD 2ZY3A 4CSRA 4KHAA 3MGRB 1P3IC 3AV2A 4X23C 3LZ1C 3AZEA 3IP4C 5GT3A 4J8WC 4YS3D 3X1SA 4XUJC 3AZMC 4WJ3C 5C3IC 1TZYC 5B1MD 3KWQD 1P3AD 3AZHD 3REJC 4WU8D 1S32C 1W2EA 2DQNC 3A6NC 3C1CD 5B24B 4H9NA 3VH6A 4WNNA 5AV6B 3WA9C 2ZM5A 5GT0C 1P3BA 2HIOD 5B33A 1Q9CA 2NQBC 3AN2B 1P3OA 3R45A 3X1UB 2ZY2A 4NE6A 3H0RC 5GXQD 5E5AD 5B0ZD 3KXBA 3V9RA 2HUEB 2UWXA 4WV4B 4CSRB 5AV9C 4KHAB 1P3MD 5B31D 1PZRA 4H9SC 3AV2B 3B6GA 1H3OB 3H0MC 3AZEB 5GT3B 5B1LA 5AVBD 4CAYA 3MNNC 3MGRD 4AWLB 3AZJA 3AZIC 2YFVA 1TZYB 4H9NB 1A7WA 2CWEA 3WKJD 5AV8A 3MGSA 4UUZB 3LJAB 1P3BB 1F66A 5DNNC 5AY8C 5B33B 3AZLC 5CP6C 1P3OB 1HQ3D 3TU4C 5AV6D 3V9RB 5CPIA 2JE5A 2CV5D 3AN2D 4QLCC 2W8SA 4WZSB 4ZUXC 1P3FA 3MGQC 1KX5C 1N1JA 3B6GB 3UTBA 1ID3C 4KUDA 5B1LB 3REKB 5B32A 1KX4C 4CAYB 3REIA 3AV2D 2RVQD 4J8VA 2YFVB 5B0YC 3AZED 5GT3D 3X1SD 4YS3C 2F8NG 5AV8B 3MGSB 1F66B 5JA4A 4HGAB 5B1MC 4DRAA 4Z5TA 3KWQC 3UT9B 3AZHC 4WU8C 4H9PA 1M1AA 3C1CC 1P3GA 4YM6A 3LJAD 1P3BD 3WAAB 5B33D 1P3PA 2HIOC 4E44A 4UPKA 4J8XB 1P3OD 3O62A 3LZ0A 1P3FB 4R8PB 1N1JB 2PYOC 3NQUA 5E5AC 5GXQC 5B0ZC 2F8NH 5B32B 3H0LC 4ZUXB 1M19A 1P3MC 5CPJA 5B31C 3B6GD 1KX4B 5B2JB 3AZGA 3W96C 1BH9A 5B1LD 1P3LA 3REKD 2FFFB 3KFUG 3A1KA 3B0CW 5JA4B 2NZDA 3MGRC 4Z5TB 3AZJD 2XD5A 4H9PB 1M1AB 5B1MB 5AV8D 3MGSD 1P3AB 1KX3A 4YM6B 1F66D 4EO5B 1P3PB 2Y2IA 2AROA 4WU9A 3LZ0B 1HQ3C 5AV6C 2F8NK 2Y2MA 5CPID 3AZFA 4KGCA 2CV5C 1M19B 3AYWA 3AN2C 1P3FD 3X1UC 3KUYA 3UTBD 5AVCA 3AZGB 1BH9B 4KUDD 5B32D 2HUEC 1WWIA 4NE5A 2NZDB 3REID 1BH8A 5AVBB 4J8VD 3AV2C 2RVQC 3AZEC 3VH6W 1F1EA 5GT3C 2YFWA 3X1SC 4JJNA 1TAFA 4AWLC 4Z5TD 2AROB 5B2IB 1M1AD 3WKJB 3B0DB 4WU9B 3W99A 5BS7A 5FUGA 3MVDA 1P3GD 4YM6D 3LJAC 1P3BC 1P3PD 1HQ3B 4E45A 5AV5A 5B33C 3AYWB 3O62D 3LZ0D 1P3OC 5AVCB 3WTPA 2CV5B 2BYKA 5JRGA 1M19D 2Y2KA 3AZGD 3B6GC 1P3LD 3W98A 5B1LC 3REKC 4JJNB 5CPKA 4LD9A 2NZDD 2BG1A 4DQYB 3RELA 5F99A 3X1SB 3MGPA 3AZJC 3AZKA 1JFIA 3W99B 5FUGB 1KX3D 3B0BA 5AV8C 3MGSC 1F66C 4H9RA 2FJ7A 4HGAC 2AROD 4WNNB 5B2ID 3WA9A 3UT9C 4G91B 4WU9D 4H9QA 2J8PA 3WTPB 2F8NA 3B6FA 2Y2HA 5CPIC 3UTAA 3R45B 2BYKB 3WAAC 4KGCD 2Y2NA 3W97A 3KXBB 3AYWD 4J8XC 4H9OA 3C1BA 1P3FC 4R8PC 5AVCD 3UTBC 3W98B 4KUDC 4ZBJB 5B32C 5CPKB 5F99B 3AZNA 3REIC 3AZKB 3MGPB 5B2JC 4J8VC 4JJND 3AZJB 3AZIA 4H9RB 2FJ7B 2RIQA 4Z5TC 5BNVA 2G5IC 3W99D 1M1AC 3MVDD 5DNMA 3EPKA 2F8NB 1P3GC 1P3AC 5CP6A 3B6FB 4YM6C 2Y2PA 4EO5C 1P3PC 1M18A 2XD1A 4H9OB 3O62C 3LZ0C 3C1BB 5CPIB 3WTPD 4Z2MH 5JRGD 3AL0C 3KXBD 3UTBB 1M19C 3AZNB 4KUDB 2JCHA 3W98D 3AZGC 4J8UA 4NE3A 1P3LC 3REIB 5CPKD 4LD9D 5B0YA 3RELD 4J8VB 5F99D 2NZDC 3AZKD 5BNVB 3MGPD 3FDDA 5AVBC 4DRBA 3AZHA 1KX3C 2FJ7D 2AROC 5B2IC 1P3GB 1M18B 3EPJA 3WKJC 5KDMA 3B0DC 4WU9C 2F8ND 4NFTA 3B6FD 2ZY5A 3UTAD 3O62B 2G5HC 2PYOA 3W97D 4KGCC 3NQUB 3LELA 3AV1A 3AYWC 3C1BD 3AFAA 3REHA 5AVCC 1AOIA 1U35A 5CPJB 3W96A 1HTAA 3X1VA 3AZND 1P3LB 3VH5T 1P34A 4JJNC 1P3KA 5GSUA 4XZQA 1KX3B 2L5AA 5KDMB 3W99C 5DNMD 1KU5A 5B24A 3X1TA 5B40A 4Z66A 5AV6A 1EQZA 3LELB 1M18D 1ZLAA 3AV1B 4G91C 3KSYA 5B31G 3REHB 3AZFB 1AOIB 3WTPC 4KGCB 2IO5B 3AN2A 1R4VA 3X1UA 3WTPE 3KUYB 5JRGC 3X1VB 3KXBC 1P34B 4J8UD 1WWSA 3W98C 5CPJD 4ZBJC 5B0YD 1H3OA 1P3KB 5GSUB 5CPKC 4LD9C 3RELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 C;  1P3I A;  4XZQ B;  2YFW B;  3MGP C;  3AZK C;  4X23 A;  1TAF B;  5BO0 A;  3LZ1 A;  3VH5 A;  4J8W A;  4XUJ A;  1BFM A;  3AZM A;  1TZY A;  3X1T B;  4Z66 B;  5B40 B;  2FJ7 C;  3REJ A;  1EQZ B;  3MVD B;  1ZLA B;  1S32 A;  3A6N A;  4UUZ A;  3LJA A;  5AV5 B;  5GT0 A;  3B6F C;  3UTA C;  2PYO D;  1BH8 B;  3LEL D;  2NQB A;  3W97 C;  3AV1 D;  4G92 B;  3AFA D;  3C1B C;  3REH D;  3AZF D;  1AOI D;  1U35 D;  5JRG B;  3W96 D;  3KUY D;  3X1V D;  5AV9 A;  3REK A;  3AZN C;  1P3I B;  1P34 D;  4H9S A;  4X23 B;  5BO0 B;  4LD9 B;  3LZ1 B;  3REL B;  4J8W B;  5BT1 D;  4XUJ B;  3AZM B;  1P3K D;  5GSU D;  1JFI B;  5C3I B;  3MNN A;  4XZQ D;  3REJ B;  1S32 B;  3A6N B;  4Z2M G;  5DNM C;  3UT9 A;  3WA9 B;  5GT0 B;  5B24 D;  3X1T D;  3NQJ A;  5DNN A;  5B40 D;  4H9Q B;  5AY8 A;  4Z66 D;  1EQZ D;  1ZLA D;  2NQB B;  3AZL A;  1M18 C;  3WAA A;  3TU4 A;  3UTA B;  5AV5 D;  4J8X A;  3W97 B;  3X1U D;  4R8P A;  5AV9 B;  4QLC A;  1KX5 A;  4ZUX A;  3MGQ A;  1ID3 A;  4J8U C;  5CPJ C;  1KX4 A;  5B2J A;  3MNN B;  1P3I D;  4M6B A;  5CHL B;  4X23 D;  3B0C T;  3AZI B;  3LZ1 D;  4J8W D;  4XUJ D;  3AZM D;  4YS3 A;  1TZY D;  3NQJ B;  5DNN B;  2BYM A;  5B1M A;  5AY8 B;  3KWQ A;  3REJ D;  5DNM B;  1S32 D;  3AZL B;  3A6N D;  4WU8 A;  1P3A A;  5CP6 B;  3C1C A;  3TU4 B;  3WA9 D;  5GT0 D;  1B67 A;  5B32 G;  2HIO A;  5BNX A;  2NQB D;  3LEL C;  4QLC B;  3AV1 C;  1KX5 B;  3MGQ B;  3AFA C;  5E5A A;  5GXQ A;  3REH C;  3AZF C;  5B0Z A;  1ID3 B;  2IO5 C;  1U35 C;  1AOI C;  2JSS A;  5AV9 D;  3X1V C;  3KUY C;  4J8U B;  1P3M A;  5B31 A;  1P34 C;  2LY8 A;  5B0Y B;  5G49 A;  5BT1 C;  5AVB A;  4YS3 B;  1P3K C;  5GSU C;  3MNN D;  2BYM B;  3VH6 T;  3KWQ B;  3MGR A;  4XZQ C;  3AZH B;  4WU8 B;  3AZI D;  3C1C B;  3UT9 D;  5B2I A;  3WKJ A;  5DNN D;  5B24 C;  5AY8 D;  3X1T C;  2HIO B;  5BNX B;  4Z66 C;  5B40 C;  5BS7 C;  3AZL D;  1EQZ C;  3MVD C;  1B6W A;  5CP6 D;  1ZLA C;  3TU4 D;  3WAA D;  1HQ3 A;  2PYO B;  5GXQ B;  5E5A B;  4J8X D;  5AV5 C;  5B0Z B;  4R8P D;  3AFA B;  2CV5 A;  4QLC D;  1U35 B;  1P3M B;  4G92 C;  4ZUX D;  1KX5 D;  3MGQ D;  5B31 B;  1ULY A;  3W96 B;  1ID3 D;  3VH5 W;  5G49 B;  1KX4 D;  5B2J D;  4CSR A;  4KHA A;  3MGR B;  1P3I C;  3AV2 A;  4X23 C;  3LZ1 C;  3AZE A;  5GT3 A;  4J8W C;  4YS3 D;  3X1S A;  4XUJ C;  3AZM C;  5C3I C;  1TZY C;  5B1M D;  3KWQ D;  1P3A D;  3AZH D;  3REJ C;  4WU8 D;  1S32 C;  3C1C D;  3A6N C;  5B24 B;  4H9N A;  3VH6 A;  4WNN A;  5AV6 B;  3WA9 C;  5GT0 C;  1P3B A;  2HIO D;  5B33 A;  1Q9C A;  2NQB C;  3AN2 B;  1P3O A;  3R45 A;  3X1U B;  5GXQ D;  4NE6 A;  5E5A D;  5B0Z D;  3KXB A;  3V9R A;  2HUE B;  4WV4 B;  4CSR B;  5AV9 C;  4KHA B;  1P3M D;  5B31 D;  4H9S C;  3AV2 B;  3B6G A;  1H3O B;  3AZE B;  5GT3 B;  5B1L A;  5AVB D;  4CAY A;  3MNN C;  3MGR D;  4AWL B;  3AZJ A;  3AZI C;  2YFV A;  1TZY B;  4H9N B;  1A7W A;  2CWE A;  3WKJ D;  5AV8 A;  3MGS A;  4UUZ B;  3LJA B;  1P3B B;  1F66 A;  5DNN C;  5AY8 C;  5B33 B;  3AZL C;  5CP6 C;  1P3O B;  1HQ3 D;  3TU4 C;  5AV6 D;  3V9R B;  5CPI A;  2CV5 D;  3AN2 D;  4QLC C;  4WZS B;  4ZUX C;  1P3F A;  3MGQ C;  1KX5 C;  1N1J A;  3B6G B;  3UTB A;  1ID3 C;  4KUD A;  5B1L B;  3REK B;  5B32 A;  1KX4 C;  4CAY B;  3REI A;  3AV2 D;  2RVQ D;  4J8V A;  2YFV B;  5B0Y C;  3AZE D;  5GT3 D;  3X1S D;  4YS3 C;  2F8N G;  5AV8 B;  3MGS B;  1F66 B;  5JA4 A;  4HGA B;  5B1M C;  4DRA A;  4Z5T A;  3KWQ C;  3UT9 B;  3AZH C;  4WU8 C;  4H9P A;  1M1A A;  3C1C C;  1P3G A;  4YM6 A;  3LJA D;  1P3B D;  3WAA B;  5B33 D;  1P3P A;  2HIO C;  4E44 A;  4J8X B;  1P3O D;  3O62 A;  3LZ0 A;  1P3F B;  4R8P B;  1N1J B;  2PYO C;  3NQU A;  5E5A C;  5GXQ C;  5B0Z C;  2F8N H;  5B32 B;  4ZUX B;  1M19 A;  1P3M C;  5CPJ A;  5B31 C;  3B6G D;  1KX4 B;  5B2J B;  3AZG A;  3W96 C;  1BH9 A;  5B1L D;  1P3L A;  3REK D;  3B0C W;  5JA4 B;  2NZD A;  3MGR C;  4Z5T B;  3AZJ D;  4H9P B;  1M1A B;  5B1M B;  5AV8 D;  3MGS D;  1P3A B;  1KX3 A;  4YM6 B;  1F66 D;  4EO5 B;  1P3P B;  2ARO A;  4WU9 A;  3LZ0 B;  1HQ3 C;  5AV6 C;  2F8N K;  5CPI D;  3AZF A;  4KGC A;  2CV5 C;  1M19 B;  3AYW A;  3AN2 C;  1P3F D;  3X1U C;  3KUY A;  3UTB D;  5AVC A;  3AZG B;  1BH9 B;  4KUD D;  5B32 D;  2HUE C;  1WWI A;  4NE5 A;  2NZD B;  3REI D;  1BH8 A;  5AVB B;  4J8V D;  3AV2 C;  2RVQ C;  3AZE C;  3VH6 W;  1F1E A;  5GT3 C;  2YFW A;  3X1S C;  4JJN A;  1TAF A;  4AWL C;  4Z5T D;  2ARO B;  5B2I B;  1M1A D;  3WKJ B;  3B0D B;  4WU9 B;  3W99 A;  5BS7 A;  5FUG A;  3MVD A;  1P3G D;  4YM6 D;  3LJA C;  1P3B C;  1P3P D;  1HQ3 B;  4E45 A;  5AV5 A;  5B33 C;  3AYW B;  3O62 D;  3LZ0 D;  1P3O C;  5AVC B;  3WTP A;  2CV5 B;  2BYK A;  5JRG A;  1M19 D;  3AZG D;  3B6G C;  1P3L D;  3W98 A;  5B1L C;  3REK C;  4JJN B;  5CPK A;  4LD9 A;  2NZD D;  3REL A;  5F99 A;  3X1S B;  3MGP A;  3AZJ C;  3AZK A;  1JFI A;  3W99 B;  5FUG B;  1KX3 D;  3B0B A;  5AV8 C;  3MGS C;  1F66 C;  4H9R A;  2FJ7 A;  4HGA C;  2ARO D;  4WNN B;  5B2I D;  3WA9 A;  3UT9 C;  4G91 B;  4WU9 D;  4H9Q A;  3WTP B;  2F8N A;  3B6F A;  5CPI C;  3UTA A;  3R45 B;  2BYK B;  3WAA C;  4KGC D;  3W97 A;  3KXB B;  3AYW D;  4J8X C;  4H9O A;  3C1B A;  1P3F C;  5AVC D;  4R8P C;  3UTB C;  3W98 B;  4KUD C;  4ZBJ B;  5B32 C;  5CPK B;  5F99 B;  3AZN A;  3REI C;  3AZK B;  3MGP B;  5B2J C;  4J8V C;  4JJN D;  3AZJ B;  3AZI A;  4H9R B;  2FJ7 B;  4Z5T C;  5BNV A;  3W99 D;  1M1A C;  3MVD D;  5DNM A;  2F8N B;  1P3G C;  1P3A C;  5CP6 A;  3B6F B;  4YM6 C;  4EO5 C;  1P3P C;  1M18 A;  4H9O B;  3O62 C;  3LZ0 C;  3C1B B;  5CPI B;  3WTP D;  4Z2M H;  5JRG D;  3KXB D;  3UTB B;  1M19 C;  3AZN B;  4KUD B;  3W98 D;  3AZG C;  4J8U A;  4NE3 A;  1P3L C;  3REI B;  5CPK D;  4LD9 D;  5B0Y A;  3REL D;  4J8V B;  5F99 D;  2NZD C;  3AZK D;  5BNV B;  3MGP D;  5AVB C;  4DRB A;  3AZH A;  1KX3 C;  2FJ7 D;  2ARO C;  5B2I C;  1P3G B;  1M18 B;  3WKJ C;  5KDM A;  3B0D C;  4WU9 C;  2F8N D;  4NFT A;  3B6F D;  3UTA D;  3O62 B;  2PYO A;  3W97 D;  4KGC C;  3NQU B;  3LEL A;  3AV1 A;  3AYW C;  3C1B D;  3AFA A;  3REH A;  5AVC C;  1AOI A;  1U35 A;  5CPJ B;  3W96 A;  1HTA A;  3X1V A;  3AZN D;  1P3L B;  3VH5 T;  1P34 A;  4JJN C;  1P3K A;  5GSU A;  4XZQ A;  1KX3 B;  2L5A A;  5KDM B;  3W99 C;  5DNM D;  1KU5 A;  5B24 A;  3X1T A;  5B40 A;  4Z66 A;  5AV6 A;  1EQZ A;  3LEL B;  1M18 D;  1ZLA A;  3AV1 B;  4G91 C;  3KSY A;  5B31 G;  3REH B;  3AZF B;  1AOI B;  3WTP C;  4KGC B;  2IO5 B;  3AN2 A;  1R4V A;  3X1U A;  3WTP E;  3KUY B;  5JRG C;  3X1V B;  3KXB C;  1P34 B;  4J8U D;  1WWS A;  3W98 C;  5CPJ D;  4ZBJ C;  5B0Y D;  1H3O A;  1P3K B;  5GSU B;  5CPK C;  4LD9 C;  3REL C; 
#chains in the Genus database with same CATH topology
 5F99 C;  1P3I A;  4XZQ B;  2YFW B;  3MGP C;  3AZK C;  4X23 A;  2Y2Q A;  1TAF B;  5BO0 A;  3LZ1 A;  3VH5 A;  4J8W A;  4XUJ A;  1BFM A;  3AZM A;  1TZY A;  3X1T B;  4Z66 B;  5B40 B;  2DF4 C;  2FJ7 C;  3REJ A;  1EQZ B;  3MVD B;  1ZLA B;  1S32 A;  3A6N A;  4UUZ A;  3LJA A;  5AV5 B;  5GT0 A;  3B6F C;  3UTA C;  2PYO D;  1BH8 B;  3LEL D;  2NQB A;  3W97 C;  3AV1 D;  4G92 B;  1Z2C B;  3AFA D;  3C1B C;  3REH D;  3AZF D;  1AOI D;  3P5J B;  1U35 D;  5JRG B;  2VQR A;  3W96 D;  3EG5 B;  3KUY D;  3X1V D;  5AV9 A;  3REK A;  3AZN C;  1P3I B;  1P34 D;  4H9S A;  4X23 B;  5BO0 B;  4LD9 B;  3LZ1 B;  3REL B;  4J8W B;  5BT1 D;  4XUJ B;  3AZM B;  1P3K D;  5GSU D;  1JFI B;  5C3I B;  3MNN A;  4XZQ D;  3REJ B;  1S32 B;  3A6N B;  4Z2M G;  2Y2J A;  5DNM C;  3UT9 A;  3WA9 B;  5GT0 B;  5B24 D;  3X1T D;  3NQJ A;  5B40 D;  5DNN A;  4H9Q B;  5AY8 A;  4Z66 D;  1EQZ D;  1ZLA D;  2NQB B;  3AZL A;  1M18 C;  3WAA A;  3A1I A;  3TU4 A;  3UTA B;  5AV5 D;  3F6T A;  4J8X A;  3W97 B;  3X1U D;  4R8P A;  5AV9 B;  4QLC A;  1KX5 A;  4ZUX A;  3MGQ A;  1ID3 A;  4J8U C;  1T3U A;  5CPJ C;  1KX4 A;  5B2J A;  3MNN B;  1P3I D;  2Y2O A;  4M6B A;  5CHL B;  4X23 D;  3B0C T;  3AZI B;  3LZ1 D;  4J8W D;  4XUJ D;  3AZM D;  4YS3 A;  1TZY D;  3NQJ B;  5DNN B;  2BYM A;  5B1M A;  5AY8 B;  3KWQ A;  3REJ D;  5DNM B;  1S32 D;  3AZL B;  3A6N D;  4WU8 A;  1P3A A;  5CP6 B;  3C1C A;  3TU4 B;  3WA9 D;  5GT0 D;  1B67 A;  5B32 G;  2HIO A;  5BNX A;  2NQB D;  3LEL C;  4QLC B;  3AV1 C;  1KX5 B;  3MGQ B;  3AFA C;  2Y2L A;  5E5A A;  5GXQ A;  3REH C;  5B0Z A;  3AZF C;  2IO5 C;  1U35 C;  1ID3 B;  2JSS A;  1AOI C;  5AV9 D;  3X1V C;  3KUY C;  4J8U B;  1P3M A;  5B31 A;  1P34 C;  2LY8 A;  5B0Y B;  5G49 A;  5BT1 C;  5AVB A;  4YS3 B;  1P3K C;  5GSU C;  3MNN D;  2BYM B;  3VH6 T;  3KWQ B;  3MGR A;  4XZQ C;  3AZH B;  4WU8 B;  3AZI D;  3C1C B;  3UT9 D;  5B2I A;  3WKJ A;  5DNN D;  5B24 C;  5AY8 D;  3X1T C;  2HIO B;  5BNX B;  4Z66 C;  5B40 C;  5BS7 C;  3AZL D;  1EQZ C;  3MVD C;  1B6W A;  5CP6 D;  1ZLA C;  3TU4 D;  3WAA D;  1HQ3 A;  2PYO B;  5GXQ B;  5E5A B;  4J8X D;  5AV5 C;  5B0Z B;  4R8P D;  3AFA B;  2CV5 A;  4QLC D;  1U35 B;  1P3M B;  2F2A C;  4ZUX D;  4G92 C;  3MGQ D;  5B31 B;  1KX5 D;  3EPH A;  2ZY4 A;  1ULY A;  3W96 B;  2Y2G A;  1ID3 D;  3VH5 W;  3EPL A;  5G49 B;  1KX4 D;  5B2J D;  2ZY3 A;  4CSR A;  4KHA A;  3MGR B;  1P3I C;  3AV2 A;  4X23 C;  3LZ1 C;  3AZE A;  3IP4 C;  5GT3 A;  4J8W C;  4YS3 D;  3X1S A;  4XUJ C;  3AZM C;  4WJ3 C;  5C3I C;  1TZY C;  5B1M D;  3KWQ D;  1P3A D;  3AZH D;  3REJ C;  4WU8 D;  1S32 C;  1W2E A;  2DQN C;  3A6N C;  3C1C D;  5B24 B;  4H9N A;  3VH6 A;  4WNN A;  5AV6 B;  3WA9 C;  2ZM5 A;  5GT0 C;  1P3B A;  2HIO D;  5B33 A;  1Q9C A;  2NQB C;  3AN2 B;  1P3O A;  3R45 A;  3X1U B;  2ZY2 A;  4NE6 A;  3H0R C;  5GXQ D;  5E5A D;  5B0Z D;  3KXB A;  3V9R A;  2HUE B;  2UWX A;  4WV4 B;  4CSR B;  5AV9 C;  4KHA B;  1P3M D;  5B31 D;  1PZR A;  4H9S C;  3AV2 B;  3B6G A;  1H3O B;  3H0M C;  3AZE B;  5GT3 B;  5B1L A;  5AVB D;  4CAY A;  3MNN C;  3MGR D;  4AWL B;  3AZJ A;  3AZI C;  2YFV A;  1TZY B;  4H9N B;  1A7W A;  2CWE A;  3WKJ D;  5AV8 A;  3MGS A;  4UUZ B;  3LJA B;  1P3B B;  1F66 A;  5DNN C;  5AY8 C;  5B33 B;  3AZL C;  5CP6 C;  1P3O B;  1HQ3 D;  3TU4 C;  5AV6 D;  3V9R B;  5CPI A;  2JE5 A;  2CV5 D;  3AN2 D;  4QLC C;  2W8S A;  4WZS B;  4ZUX C;  1P3F A;  3MGQ C;  1KX5 C;  1N1J A;  3B6G B;  3UTB A;  1ID3 C;  4KUD A;  5B1L B;  3REK B;  5B32 A;  1KX4 C;  4CAY B;  3REI A;  3AV2 D;  2RVQ D;  4J8V A;  2YFV B;  5B0Y C;  3AZE D;  5GT3 D;  3X1S D;  4YS3 C;  2F8N G;  5AV8 B;  3MGS B;  1F66 B;  5JA4 A;  4HGA B;  5B1M C;  4DRA A;  4Z5T A;  3KWQ C;  3UT9 B;  3AZH C;  4WU8 C;  4H9P A;  1M1A A;  3C1C C;  1P3G A;  4YM6 A;  3LJA D;  1P3B D;  3WAA B;  5B33 D;  1P3P A;  2HIO C;  4E44 A;  4UPK A;  4J8X B;  1P3O D;  3O62 A;  3LZ0 A;  1P3F B;  4R8P B;  1N1J B;  2PYO C;  3NQU A;  5E5A C;  5GXQ C;  5B0Z C;  2F8N H;  5B32 B;  3H0L C;  4ZUX B;  1M19 A;  1P3M C;  5CPJ A;  5B31 C;  3B6G D;  1KX4 B;  5B2J B;  3AZG A;  3W96 C;  1BH9 A;  5B1L D;  1P3L A;  3REK D;  2FFF B;  3KFU G;  3A1K A;  3B0C W;  5JA4 B;  2NZD A;  3MGR C;  4Z5T B;  3AZJ D;  2XD5 A;  4H9P B;  1M1A B;  5B1M B;  5AV8 D;  3MGS D;  1P3A B;  1KX3 A;  4YM6 B;  1F66 D;  4EO5 B;  1P3P B;  2Y2I A;  2ARO A;  4WU9 A;  3LZ0 B;  1HQ3 C;  5AV6 C;  2F8N K;  2Y2M A;  5CPI D;  3AZF A;  4KGC A;  2CV5 C;  1M19 B;  3AYW A;  3AN2 C;  1P3F D;  3X1U C;  3KUY A;  3UTB D;  5AVC A;  3AZG B;  1BH9 B;  4KUD D;  5B32 D;  2HUE C;  1WWI A;  4NE5 A;  2NZD B;  3REI D;  1BH8 A;  5AVB B;  4J8V D;  3AV2 C;  2RVQ C;  3AZE C;  3VH6 W;  1F1E A;  5GT3 C;  2YFW A;  3X1S C;  4JJN A;  1TAF A;  4AWL C;  4Z5T D;  2ARO B;  5B2I B;  1M1A D;  3WKJ B;  3B0D B;  4WU9 B;  3W99 A;  5BS7 A;  5FUG A;  3MVD A;  1P3G D;  4YM6 D;  3LJA C;  1P3B C;  1P3P D;  1HQ3 B;  4E45 A;  5AV5 A;  5B33 C;  3AYW B;  3O62 D;  3LZ0 D;  1P3O C;  5AVC B;  3WTP A;  2CV5 B;  2BYK A;  5JRG A;  1M19 D;  2Y2K A;  3AZG D;  3B6G C;  1P3L D;  3W98 A;  5B1L C;  3REK C;  4JJN B;  5CPK A;  4LD9 A;  2NZD D;  2BG1 A;  4DQY B;  3REL A;  5F99 A;  3X1S B;  3MGP A;  3AZJ C;  3AZK A;  1JFI A;  3W99 B;  5FUG B;  1KX3 D;  3B0B A;  5AV8 C;  3MGS C;  1F66 C;  4H9R A;  2FJ7 A;  4HGA C;  2ARO D;  4WNN B;  5B2I D;  3WA9 A;  3UT9 C;  4G91 B;  4WU9 D;  4H9Q A;  2J8P A;  3WTP B;  2F8N A;  3B6F A;  2Y2H A;  5CPI C;  3UTA A;  3R45 B;  2BYK B;  3WAA C;  4KGC D;  2Y2N A;  3W97 A;  3KXB B;  3AYW D;  4J8X C;  4H9O A;  3C1B A;  1P3F C;  4R8P C;  5AVC D;  3UTB C;  3W98 B;  4KUD C;  4ZBJ B;  5B32 C;  5CPK B;  5F99 B;  3AZN A;  3REI C;  3AZK B;  3MGP B;  5B2J C;  4J8V C;  4JJN D;  3AZJ B;  3AZI A;  4H9R B;  2FJ7 B;  2RIQ A;  4Z5T C;  5BNV A;  2G5I C;  3W99 D;  1M1A C;  3MVD D;  5DNM A;  3EPK A;  2F8N B;  1P3G C;  1P3A C;  5CP6 A;  3B6F B;  4YM6 C;  2Y2P A;  4EO5 C;  1P3P C;  1M18 A;  2XD1 A;  4H9O B;  3O62 C;  3LZ0 C;  3C1B B;  5CPI B;  3WTP D;  4Z2M H;  5JRG D;  3AL0 C;  3KXB D;  3UTB B;  1M19 C;  3AZN B;  4KUD B;  2JCH A;  3W98 D;  3AZG C;  4J8U A;  4NE3 A;  1P3L C;  3REI B;  5CPK D;  4LD9 D;  5B0Y A;  3REL D;  4J8V B;  5F99 D;  2NZD C;  3AZK D;  5BNV B;  3MGP D;  3FDD A;  5AVB C;  4DRB A;  3AZH A;  1KX3 C;  2FJ7 D;  2ARO C;  5B2I C;  1P3G B;  1M18 B;  3EPJ A;  3WKJ C;  5KDM A;  3B0D C;  4WU9 C;  2F8N D;  4NFT A;  3B6F D;  2ZY5 A;  3UTA D;  3O62 B;  2G5H C;  2PYO A;  3W97 D;  4KGC C;  3NQU B;  3LEL A;  3AV1 A;  3AYW C;  3C1B D;  3AFA A;  3REH A;  5AVC C;  1AOI A;  1U35 A;  5CPJ B;  3W96 A;  1HTA A;  3X1V A;  3AZN D;  1P3L B;  3VH5 T;  1P34 A;  4JJN C;  1P3K A;  5GSU A;  4XZQ A;  1KX3 B;  2L5A A;  5KDM B;  3W99 C;  5DNM D;  1KU5 A;  5B24 A;  3X1T A;  5B40 A;  4Z66 A;  5AV6 A;  1EQZ A;  3LEL B;  1M18 D;  1ZLA A;  3AV1 B;  4G91 C;  3KSY A;  5B31 G;  3REH B;  3AZF B;  1AOI B;  3WTP C;  4KGC B;  2IO5 B;  3AN2 A;  1R4V A;  3X1U A;  3WTP E;  3KUY B;  5JRG C;  3X1V B;  3KXB C;  1P34 B;  4J8U D;  1WWS A;  3W98 C;  5CPJ D;  4ZBJ C;  5B0Y D;  1H3O A;  1P3K B;  5GSU B;  5CPK C;  4LD9 C;  3REL C; 
#chains in the Genus database with same CATH homology
 5F99 C;  1P3I A;  4XZQ B;  2YFW B;  3MGP C;  3AZK C;  4X23 A;  2Y2Q A;  1TAF B;  5BO0 A;  3LZ1 A;  3VH5 A;  4J8W A;  4XUJ A;  1BFM A;  3AZM A;  1TZY A;  3X1T B;  4Z66 B;  5B40 B;  2DF4 C;  2FJ7 C;  3REJ A;  1EQZ B;  3MVD B;  1ZLA B;  1S32 A;  3A6N A;  4UUZ A;  3LJA A;  5AV5 B;  5GT0 A;  3B6F C;  3UTA C;  2PYO D;  1BH8 B;  3LEL D;  2NQB A;  3W97 C;  3AV1 D;  4G92 B;  1Z2C B;  3AFA D;  3C1B C;  3REH D;  3AZF D;  1AOI D;  3P5J B;  1U35 D;  5JRG B;  2VQR A;  3W96 D;  3EG5 B;  3KUY D;  3X1V D;  5AV9 A;  3REK A;  3AZN C;  1P3I B;  1P34 D;  4H9S A;  4X23 B;  5BO0 B;  4LD9 B;  3LZ1 B;  3REL B;  4J8W B;  5BT1 D;  4XUJ B;  3AZM B;  1P3K D;  5GSU D;  1JFI B;  5C3I B;  3MNN A;  4XZQ D;  3REJ B;  1S32 B;  3A6N B;  4Z2M G;  2Y2J A;  5DNM C;  3UT9 A;  3WA9 B;  5GT0 B;  5B24 D;  3X1T D;  3NQJ A;  5B40 D;  5DNN A;  4H9Q B;  5AY8 A;  4Z66 D;  1EQZ D;  1ZLA D;  2NQB B;  3AZL A;  1M18 C;  3WAA A;  3A1I A;  3TU4 A;  3UTA B;  5AV5 D;  3F6T A;  4J8X A;  3W97 B;  3X1U D;  4R8P A;  5AV9 B;  4QLC A;  1KX5 A;  4ZUX A;  3MGQ A;  1ID3 A;  4J8U C;  1T3U A;  5CPJ C;  1KX4 A;  5B2J A;  3MNN B;  1P3I D;  2Y2O A;  4M6B A;  5CHL B;  4X23 D;  3B0C T;  3AZI B;  3LZ1 D;  4J8W D;  4XUJ D;  3AZM D;  4YS3 A;  1TZY D;  3NQJ B;  5DNN B;  2BYM A;  5B1M A;  5AY8 B;  3KWQ A;  3REJ D;  5DNM B;  1S32 D;  3AZL B;  3A6N D;  4WU8 A;  1P3A A;  5CP6 B;  3C1C A;  3TU4 B;  3WA9 D;  5GT0 D;  1B67 A;  5B32 G;  2HIO A;  5BNX A;  2NQB D;  3LEL C;  4QLC B;  3AV1 C;  1KX5 B;  3MGQ B;  3AFA C;  2Y2L A;  5E5A A;  5GXQ A;  3REH C;  5B0Z A;  3AZF C;  2IO5 C;  1U35 C;  1ID3 B;  2JSS A;  1AOI C;  5AV9 D;  3X1V C;  3KUY C;  4J8U B;  1P3M A;  5B31 A;  1P34 C;  2LY8 A;  5B0Y B;  5G49 A;  5BT1 C;  5AVB A;  4YS3 B;  1P3K C;  5GSU C;  3MNN D;  2BYM B;  3VH6 T;  3KWQ B;  3MGR A;  4XZQ C;  3AZH B;  4WU8 B;  3AZI D;  3C1C B;  3UT9 D;  5B2I A;  3WKJ A;  5DNN D;  5B24 C;  5AY8 D;  3X1T C;  2HIO B;  5BNX B;  4Z66 C;  5B40 C;  5BS7 C;  3AZL D;  1EQZ C;  3MVD C;  1B6W A;  5CP6 D;  1ZLA C;  3TU4 D;  3WAA D;  1HQ3 A;  2PYO B;  5GXQ B;  5E5A B;  4J8X D;  5AV5 C;  5B0Z B;  4R8P D;  3AFA B;  2CV5 A;  4QLC D;  1U35 B;  1P3M B;  2F2A C;  4ZUX D;  4G92 C;  3MGQ D;  5B31 B;  1KX5 D;  3EPH A;  2ZY4 A;  1ULY A;  3W96 B;  2Y2G A;  1ID3 D;  3VH5 W;  3EPL A;  5G49 B;  1KX4 D;  5B2J D;  2ZY3 A;  4CSR A;  4KHA A;  3MGR B;  1P3I C;  3AV2 A;  4X23 C;  3LZ1 C;  3AZE A;  3IP4 C;  5GT3 A;  4J8W C;  4YS3 D;  3X1S A;  4XUJ C;  3AZM C;  4WJ3 C;  5C3I C;  1TZY C;  5B1M D;  3KWQ D;  1P3A D;  3AZH D;  3REJ C;  4WU8 D;  1S32 C;  1W2E A;  2DQN C;  3A6N C;  3C1C D;  5B24 B;  4H9N A;  3VH6 A;  4WNN A;  5AV6 B;  3WA9 C;  2ZM5 A;  5GT0 C;  1P3B A;  2HIO D;  5B33 A;  1Q9C A;  2NQB C;  3AN2 B;  1P3O A;  3R45 A;  3X1U B;  2ZY2 A;  4NE6 A;  3H0R C;  5GXQ D;  5E5A D;  5B0Z D;  3KXB A;  3V9R A;  2HUE B;  2UWX A;  4WV4 B;  4CSR B;  5AV9 C;  4KHA B;  1P3M D;  5B31 D;  1PZR A;  4H9S C;  3AV2 B;  3B6G A;  1H3O B;  3H0M C;  3AZE B;  5GT3 B;  5B1L A;  5AVB D;  4CAY A;  3MNN C;  3MGR D;  4AWL B;  3AZJ A;  3AZI C;  2YFV A;  1TZY B;  4H9N B;  1A7W A;  2CWE A;  3WKJ D;  5AV8 A;  3MGS A;  4UUZ B;  3LJA B;  1P3B B;  1F66 A;  5DNN C;  5AY8 C;  5B33 B;  3AZL C;  5CP6 C;  1P3O B;  1HQ3 D;  3TU4 C;  5AV6 D;  3V9R B;  5CPI A;  2JE5 A;  2CV5 D;  3AN2 D;  4QLC C;  2W8S A;  4WZS B;  4ZUX C;  1P3F A;  3MGQ C;  1KX5 C;  1N1J A;  3B6G B;  3UTB A;  1ID3 C;  4KUD A;  5B1L B;  3REK B;  5B32 A;  1KX4 C;  4CAY B;  3REI A;  3AV2 D;  2RVQ D;  4J8V A;  2YFV B;  5B0Y C;  3AZE D;  5GT3 D;  3X1S D;  4YS3 C;  2F8N G;  5AV8 B;  3MGS B;  1F66 B;  5JA4 A;  4HGA B;  5B1M C;  4DRA A;  4Z5T A;  3KWQ C;  3UT9 B;  3AZH C;  4WU8 C;  4H9P A;  1M1A A;  3C1C C;  1P3G A;  4YM6 A;  3LJA D;  1P3B D;  3WAA B;  5B33 D;  1P3P A;  2HIO C;  4E44 A;  4UPK A;  4J8X B;  1P3O D;  3O62 A;  3LZ0 A;  1P3F B;  4R8P B;  1N1J B;  2PYO C;  3NQU A;  5E5A C;  5GXQ C;  5B0Z C;  2F8N H;  5B32 B;  3H0L C;  4ZUX B;  1M19 A;  1P3M C;  5CPJ A;  5B31 C;  3B6G D;  1KX4 B;  5B2J B;  3AZG A;  3W96 C;  1BH9 A;  5B1L D;  1P3L A;  3REK D;  2FFF B;  3KFU G;  3A1K A;  3B0C W;  5JA4 B;  2NZD A;  3MGR C;  4Z5T B;  3AZJ D;  2XD5 A;  4H9P B;  1M1A B;  5B1M B;  5AV8 D;  3MGS D;  1P3A B;  1KX3 A;  4YM6 B;  1F66 D;  4EO5 B;  1P3P B;  2Y2I A;  2ARO A;  4WU9 A;  3LZ0 B;  1HQ3 C;  5AV6 C;  2F8N K;  2Y2M A;  5CPI D;  3AZF A;  4KGC A;  2CV5 C;  1M19 B;  3AYW A;  3AN2 C;  1P3F D;  3X1U C;  3KUY A;  3UTB D;  5AVC A;  3AZG B;  1BH9 B;  4KUD D;  5B32 D;  2HUE C;  1WWI A;  4NE5 A;  2NZD B;  3REI D;  1BH8 A;  5AVB B;  4J8V D;  3AV2 C;  2RVQ C;  3AZE C;  3VH6 W;  1F1E A;  5GT3 C;  2YFW A;  3X1S C;  4JJN A;  1TAF A;  4AWL C;  4Z5T D;  2ARO B;  5B2I B;  1M1A D;  3WKJ B;  3B0D B;  4WU9 B;  3W99 A;  5BS7 A;  5FUG A;  3MVD A;  1P3G D;  4YM6 D;  3LJA C;  1P3B C;  1P3P D;  1HQ3 B;  4E45 A;  5AV5 A;  5B33 C;  3AYW B;  3O62 D;  3LZ0 D;  1P3O C;  5AVC B;  3WTP A;  2CV5 B;  2BYK A;  5JRG A;  1M19 D;  2Y2K A;  3AZG D;  3B6G C;  1P3L D;  3W98 A;  5B1L C;  3REK C;  4JJN B;  5CPK A;  4LD9 A;  2NZD D;  2BG1 A;  4DQY B;  3REL A;  5F99 A;  3X1S B;  3MGP A;  3AZJ C;  3AZK A;  1JFI A;  3W99 B;  5FUG B;  1KX3 D;  3B0B A;  5AV8 C;  3MGS C;  1F66 C;  4H9R A;  2FJ7 A;  4HGA C;  2ARO D;  4WNN B;  5B2I D;  3WA9 A;  3UT9 C;  4G91 B;  4WU9 D;  4H9Q A;  2J8P A;  3WTP B;  2F8N A;  3B6F A;  2Y2H A;  5CPI C;  3UTA A;  3R45 B;  2BYK B;  3WAA C;  4KGC D;  2Y2N A;  3W97 A;  3KXB B;  3AYW D;  4J8X C;  4H9O A;  3C1B A;  1P3F C;  4R8P C;  5AVC D;  3UTB C;  3W98 B;  4KUD C;  4ZBJ B;  5B32 C;  5CPK B;  5F99 B;  3AZN A;  3REI C;  3AZK B;  3MGP B;  5B2J C;  4J8V C;  4JJN D;  3AZJ B;  3AZI A;  4H9R B;  2FJ7 B;  2RIQ A;  4Z5T C;  5BNV A;  2G5I C;  3W99 D;  1M1A C;  3MVD D;  5DNM A;  3EPK A;  2F8N B;  1P3G C;  1P3A C;  5CP6 A;  3B6F B;  4YM6 C;  2Y2P A;  4EO5 C;  1P3P C;  1M18 A;  2XD1 A;  4H9O B;  3O62 C;  3LZ0 C;  3C1B B;  5CPI B;  3WTP D;  4Z2M H;  5JRG D;  3AL0 C;  3KXB D;  3UTB B;  1M19 C;  3AZN B;  4KUD B;  2JCH A;  3W98 D;  3AZG C;  4J8U A;  4NE3 A;  1P3L C;  3REI B;  5CPK D;  4LD9 D;  5B0Y A;  3REL D;  4J8V B;  5F99 D;  2NZD C;  3AZK D;  5BNV B;  3MGP D;  3FDD A;  5AVB C;  4DRB A;  3AZH A;  1KX3 C;  2FJ7 D;  2ARO C;  5B2I C;  1P3G B;  1M18 B;  3EPJ A;  3WKJ C;  5KDM A;  3B0D C;  4WU9 C;  2F8N D;  4NFT A;  3B6F D;  2ZY5 A;  3UTA D;  3O62 B;  2G5H C;  2PYO A;  3W97 D;  4KGC C;  3NQU B;  3LEL A;  3AV1 A;  3AYW C;  3C1B D;  3AFA A;  3REH A;  5AVC C;  1AOI A;  1U35 A;  5CPJ B;  3W96 A;  1HTA A;  3X1V A;  3AZN D;  1P3L B;  3VH5 T;  1P34 A;  4JJN C;  1P3K A;  5GSU A;  4XZQ A;  1KX3 B;  2L5A A;  5KDM B;  3W99 C;  5DNM D;  1KU5 A;  5B24 A;  3X1T A;  5B40 A;  4Z66 A;  5AV6 A;  1EQZ A;  3LEL B;  1M18 D;  1ZLA A;  3AV1 B;  4G91 C;  3KSY A;  5B31 G;  3REH B;  3AZF B;  1AOI B;  3WTP C;  4KGC B;  2IO5 B;  3AN2 A;  1R4V A;  3X1U A;  3WTP E;  3KUY B;  5JRG C;  3X1V B;  3KXB C;  1P34 B;  4J8U D;  1WWS A;  3W98 C;  5CPJ D;  4ZBJ C;  5B0Y D;  1H3O A;  1P3K B;  5GSU B;  5CPK C;  4LD9 C;  3REL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...